Citrus Sinensis ID: 031655

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-----
MEKFLNDKSVREAIGVGDIEFVSCSPTVYQAMLVDWMRNLEVGIPGLLEDGVKLLVYAGEYDLICNWLGNSRWVHAMEWSGQKDFVASPEIPFEVDGSEAGVLKTNGPLSFLKVHDSGHMVPMDQPKAALEMLRRWMEGSLSEVPAGSGKLVAEM
cccccccHHHHHHHcccccccEEccHHHHHHHHccccccHHHHHHHHHHcccEEEEEEccccEEccHHHHHHHHHHccccccccccccccccEEEccEEEEEEEEEccEEEEEEccccccccccHHHHHHHHHHHHHcccccccccccccccccc
ccHHcccHHHHHHHcccccccccccHHHHHHHHccccccHHHHHHHHHHccccEEEEEcccccEEEccccHHHHHHcccccccccEEcccEEEEEccEEEEEEEEcccEEEEEEEccccccccccHHHHHHHHHHHHccccccccccccccEEcc
mekflndksvreaigvgdiefvscsPTVYQAMLVDWMRNLEVGIPGLLEDGVKLLVYAGEYDLICNWLGNSRWVHAMEWsgqkdfvaspeipfevdgseagvlktngplsflkvhdsghmvpmdqpKAALEMLRRWMEgslsevpagsgklvaem
mekflndksvreaigvgdiefvsCSPTVYQAMLVDWMRNLEVGIPGLLEDGVKLLVYAGEYDLICNWLGNSRWVHAMEWSGQKDFVASPEIPFEVDGSEAGVLKTNGPLSFLKVHDSGHMVPMDQPKAALEMLRRWMEGslsevpagsgklvaem
MEKFLNDKSVREAIGVGDIEFVSCSPTVYQAMLVDWMRNLEVGIPGLLEDGVKLLVYAGEYDLICNWLGNSRWVHAMEWSGQKDFVASPEIPFEVDGSEAGVLKTNGPLSFLKVHDSGHMVPMDQPKAALEMLRRWMEGSLSEVPAGSGKLVAEM
**********REAIGVGDIEFVSCSPTVYQAMLVDWMRNLEVGIPGLLEDGVKLLVYAGEYDLICNWLGNSRWVHAMEWSGQKDFVASPEIPFEVDGSEAGVLKTNGPLSFLKVH****************************************
MEKFLNDKSVREAIGVGDIEFVSCSPTVYQAMLVDWMRNLEVGIPGLLEDGVKLLVYAGEYDLICNWLGNSRWVHAMEWSGQKDFVASPEIPFEVDGSEAGVLKTNGPLSFLKVHDSGHMVPMDQPKAALEMLRRWMEGSLSE************
MEKFLNDKSVREAIGVGDIEFVSCSPTVYQAMLVDWMRNLEVGIPGLLEDGVKLLVYAGEYDLICNWLGNSRWVHAMEWSGQKDFVASPEIPFEVDGSEAGVLKTNGPLSFLKVHDSGHMVPMDQPKAALEMLRRWMEGSLSEVPAGSGKLVAEM
MEKFLNDKSVREAIGVGDIEFVSCSPTVYQAMLVDWMRNLEVGIPGLLEDGVKLLVYAGEYDLICNWLGNSRWVHAMEWSGQKDFVASPEIPFEVDGSEAGVLKTNGPLSFLKVHDSGHMVPMDQPKAALEMLRRWMEGS***************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKFLNDKSVREAIGVGDIEFVSCSPTVYQAMLVDWMRNLEVGIPGLLEDGVKLLVYAGEYDLICNWLGNSRWVHAMEWSGQKDFVASPEIPFEVDGSEAGVLKTNGPLSFLKVHDSGHMVPMDQPKAALEMLRRWMEGSLSEVPAGSGKLVAEM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query155 2.2.26 [Sep-21-2011]
P37891500 Serine carboxypeptidase 3 yes no 0.922 0.286 0.797 8e-67
Q41005286 Serine carboxypeptidase-l N/A no 1.0 0.541 0.748 9e-67
Q56WF8510 Serine carboxypeptidase-l yes no 0.941 0.286 0.748 4e-66
P52712429 Serine carboxypeptidase-l no no 1.0 0.361 0.729 5e-64
P21529508 Serine carboxypeptidase 3 N/A no 0.929 0.283 0.756 1e-63
P11515500 Serine carboxypeptidase 3 N/A no 0.922 0.286 0.762 2e-63
P32826516 Serine carboxypeptidase-l no no 1.0 0.300 0.726 3e-63
Q9FFB0505 Serine carboxypeptidase-l no no 0.935 0.287 0.675 3e-58
E5A7I6543 Carboxypeptidase Y homolo N/A no 0.903 0.257 0.420 2e-29
Q0V1R1543 Carboxypeptidase Y homolo N/A no 0.896 0.255 0.423 4e-29
>sp|P37891|CBP3_ORYSJ Serine carboxypeptidase 3 OS=Oryza sativa subsp. japonica GN=CBP3 PE=2 SV=1 Back     alignment and function desciption
 Score =  252 bits (643), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 114/143 (79%), Positives = 131/143 (91%)

Query: 1   MEKFLNDKSVREAIGVGDIEFVSCSPTVYQAMLVDWMRNLEVGIPGLLEDGVKLLVYAGE 60
           +EKF  DK+V+EAIGVGD+EFVSCS TVYQAML DWMRNLEVGIP LLEDG+ +L+YAGE
Sbjct: 343 LEKFFGDKAVKEAIGVGDLEFVSCSTTVYQAMLTDWMRNLEVGIPALLEDGINVLIYAGE 402

Query: 61  YDLICNWLGNSRWVHAMEWSGQKDFVASPEIPFEVDGSEAGVLKTNGPLSFLKVHDSGHM 120
           YDLICNWLGNSRWVH+MEWSGQKDFV+S E PF VDG+EAGVLK++GPLSFLKVH++GHM
Sbjct: 403 YDLICNWLGNSRWVHSMEWSGQKDFVSSHESPFVVDGAEAGVLKSHGPLSFLKVHNAGHM 462

Query: 121 VPMDQPKAALEMLRRWMEGSLSE 143
           VPMDQPKA+LEMLRR+ +G L E
Sbjct: 463 VPMDQPKASLEMLRRFTQGKLKE 485

Oryza sativa subsp. japonica (taxid: 39947)
EC: 3EC: .EC: 4EC: .EC: 1EC: 6EC: .EC: 5
>sp|Q41005|CBPX_PEA Serine carboxypeptidase-like (Fragment) OS=Pisum sativum PE=2 SV=1 Back     alignment and function description
>sp|Q56WF8|SCP48_ARATH Serine carboxypeptidase-like 48 OS=Arabidopsis thaliana GN=SCPL48 PE=2 SV=2 Back     alignment and function description
>sp|P52712|CBPX_ORYSJ Serine carboxypeptidase-like OS=Oryza sativa subsp. japonica GN=CBP31 PE=2 SV=2 Back     alignment and function description
>sp|P21529|CBP3_HORVU Serine carboxypeptidase 3 OS=Hordeum vulgare GN=CBP3 PE=1 SV=2 Back     alignment and function description
>sp|P11515|CBP3_WHEAT Serine carboxypeptidase 3 OS=Triticum aestivum GN=CBP3 PE=2 SV=1 Back     alignment and function description
>sp|P32826|SCP49_ARATH Serine carboxypeptidase-like 49 OS=Arabidopsis thaliana GN=SCPL49 PE=2 SV=2 Back     alignment and function description
>sp|Q9FFB0|SCP47_ARATH Serine carboxypeptidase-like 47 OS=Arabidopsis thaliana GN=SCPL47 PE=2 SV=1 Back     alignment and function description
>sp|E5A7I6|CBPYA_LEPMJ Carboxypeptidase Y homolog A OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=CPYA PE=3 SV=1 Back     alignment and function description
>sp|Q0V1R1|CBPYA_PHANO Carboxypeptidase Y homolog A OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CPYA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query155
21901929 508 carboxypeptidase type III [Theobroma cac 0.993 0.303 0.845 5e-72
255577428 509 Serine carboxypeptidase, putative [Ricin 1.0 0.304 0.819 1e-71
18447763 507 putative serine carboxypeptidase precurs 0.993 0.303 0.832 7e-71
224097766 513 predicted protein [Populus trichocarpa] 1.0 0.302 0.806 2e-70
224113105 513 predicted protein [Populus trichocarpa] 1.0 0.302 0.806 1e-69
449513032 509 PREDICTED: serine carboxypeptidase-like 1.0 0.304 0.793 2e-69
449465302 509 PREDICTED: serine carboxypeptidase-like 1.0 0.304 0.780 2e-68
356535595 499 PREDICTED: serine carboxypeptidase-like 1.0 0.310 0.774 3e-68
357116915 519 PREDICTED: serine carboxypeptidase-like 0.974 0.290 0.774 1e-67
242050222 521 hypothetical protein SORBIDRAFT_02g03317 0.974 0.289 0.768 5e-67
>gi|21901929|emb|CAC86383.1| carboxypeptidase type III [Theobroma cacao] Back     alignment and taxonomy information
 Score =  275 bits (702), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 131/155 (84%), Positives = 144/155 (92%), Gaps = 1/155 (0%)

Query: 1   MEKFLNDKSVREAIGVGDIEFVSCSPTVYQAMLVDWMRNLEVGIPGLLEDGVKLLVYAGE 60
           ME FLN +SVR+A+GVG I+FVSCSPTVYQAMLVDWMRNLEVGIP LLEDGVKLLVYAGE
Sbjct: 355 METFLNQESVRDALGVGSIDFVSCSPTVYQAMLVDWMRNLEVGIPALLEDGVKLLVYAGE 414

Query: 61  YDLICNWLGNSRWVHAMEWSGQKDFVASPEIPFEVDGSEAGVLKTNGPLSFLKVHDSGHM 120
           YDLICNWLGNSRWVHAMEWSGQK+FVASPE+PF VDGSEAGVL+T+GPL FLKVHD+GHM
Sbjct: 415 YDLICNWLGNSRWVHAMEWSGQKEFVASPEVPFVVDGSEAGVLRTHGPLGFLKVHDAGHM 474

Query: 121 VPMDQPKAALEMLRRWMEGSLSEVPAGSGKLVAEM 155
           VPMDQPKAALEML+RW +G+LSE  A S KLVAE+
Sbjct: 475 VPMDQPKAALEMLKRWTKGTLSEA-ADSEKLVAEI 508

Source: Theobroma cacao

Species: Theobroma cacao

Genus: Theobroma

Family: Malvaceae

Order: Malvales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255577428|ref|XP_002529593.1| Serine carboxypeptidase, putative [Ricinus communis] gi|223530926|gb|EEF32785.1| Serine carboxypeptidase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|18447763|gb|AAL67992.1| putative serine carboxypeptidase precursor [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|224097766|ref|XP_002311071.1| predicted protein [Populus trichocarpa] gi|222850891|gb|EEE88438.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224113105|ref|XP_002316392.1| predicted protein [Populus trichocarpa] gi|222865432|gb|EEF02563.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449513032|ref|XP_004164209.1| PREDICTED: serine carboxypeptidase-like 49-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449465302|ref|XP_004150367.1| PREDICTED: serine carboxypeptidase-like 49-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356535595|ref|XP_003536330.1| PREDICTED: serine carboxypeptidase-like 49-like [Glycine max] Back     alignment and taxonomy information
>gi|357116915|ref|XP_003560222.1| PREDICTED: serine carboxypeptidase-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|242050222|ref|XP_002462855.1| hypothetical protein SORBIDRAFT_02g033170 [Sorghum bicolor] gi|241926232|gb|EER99376.1| hypothetical protein SORBIDRAFT_02g033170 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query155
UNIPROTKB|P52712429 CBP31 "Serine carboxypeptidase 0.974 0.351 0.741 1e-59
TAIR|locus:2075929510 scpl48 "serine carboxypeptidas 0.941 0.286 0.748 1e-59
TAIR|locus:2075845516 SCPL49 "SERINE CARBOXYPEPTIDAS 1.0 0.300 0.739 7.3e-59
TAIR|locus:2172711505 scpl47 "serine carboxypeptidas 0.935 0.287 0.675 8e-53
ASPGD|ASPL0000030746552 cpyA [Emericella nidulans (tax 0.890 0.25 0.410 5.3e-27
UNIPROTKB|Q96VC4552 cpyA "Carboxypeptidase Y homol 0.890 0.25 0.410 5.3e-27
UNIPROTKB|Q2TYA1542 cpyA "Carboxypeptidase Y homol 0.890 0.254 0.397 2.3e-26
POMBASE|SPAC19G12.10c1002 cpy1 "vacuolar carboxypeptidas 0.903 0.139 0.402 3e-26
CGD|CAL0001608550 PRC3 [Candida albicans (taxid: 0.916 0.258 0.390 5.1e-26
CGD|CAL0005673498 PRC2 [Candida albicans (taxid: 0.890 0.277 0.378 1.2e-25
UNIPROTKB|P52712 CBP31 "Serine carboxypeptidase-like" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
 Score = 612 (220.5 bits), Expect = 1.0e-59, P = 1.0e-59
 Identities = 112/151 (74%), Positives = 131/151 (86%)

Query:     1 MEKFLNDKSVREAIGVGDIEFVSCSPTVYQAMLVDWMRNLEVGIPGLLEDGVKLLVYAGE 60
             MEKFL  KSVRE++GVGDI+FVSCSPTVYQAML+DWMRNLEVGIP LLE+ +K+L+YAGE
Sbjct:   275 MEKFLQLKSVRESLGVGDIQFVSCSPTVYQAMLLDWMRNLEVGIPELLENDIKVLIYAGE 334

Query:    61 YDLICNWLGNSRWVHAMEWSGQKDFVASPEIPFEVDGSEAGVLKTNGPLSFLKVHDSGHM 120
             YDLICNWLGNSRWV++MEWSG++ FV+S E PF VDG EAG+LK+ GPLSFLKVHD+GHM
Sbjct:   335 YDLICNWLGNSRWVNSMEWSGKEAFVSSSEEPFTVDGKEAGILKSYGPLSFLKVHDAGHM 394

Query:   121 VPMDQPKAALEMLRRWMEGSLSEVPAGSGKL 151
             VPMDQPK ALEML RW  G+LS   +   +L
Sbjct:   395 VPMDQPKVALEMLMRWTSGNLSNASSSFQRL 425
GO:0005777 "peroxisome" evidence=ISS
GO:0005789 "endoplasmic reticulum membrane" evidence=ISS
TAIR|locus:2075929 scpl48 "serine carboxypeptidase-like 48" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075845 SCPL49 "SERINE CARBOXYPEPTIDASE-LIKE 49" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172711 scpl47 "serine carboxypeptidase-like 47" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000030746 cpyA [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|Q96VC4 cpyA "Carboxypeptidase Y homolog A" [Aspergillus nidulans FGSC A4 (taxid:227321)] Back     alignment and assigned GO terms
UNIPROTKB|Q2TYA1 cpyA "Carboxypeptidase Y homolog A" [Aspergillus oryzae RIB40 (taxid:510516)] Back     alignment and assigned GO terms
POMBASE|SPAC19G12.10c cpy1 "vacuolar carboxypeptidase Y" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
CGD|CAL0001608 PRC3 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
CGD|CAL0005673 PRC2 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P37891CBP3_ORYSJ3, ., 4, ., 1, 6, ., 50.79720.92250.286yesno
Q56WF8SCP48_ARATH3, ., 4, ., 1, 6, ., -0.74820.94190.2862yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.16LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pm.C_LG_VIII0105
hypothetical protein (513 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query155
PTZ00472462 PTZ00472, PTZ00472, serine carboxypeptidase (CBP1) 1e-50
pfam00450415 pfam00450, Peptidase_S10, Serine carboxypeptidase 2e-50
COG2939498 COG2939, COG2939, Carboxypeptidase C (cathepsin A) 3e-16
PLN02213319 PLN02213, PLN02213, sinapoylglucose-malate O-sinap 5e-06
PLN03016433 PLN03016, PLN03016, sinapoylglucose-malate O-sinap 2e-05
PLN02209437 PLN02209, PLN02209, serine carboxypeptidase 3e-04
>gnl|CDD|240429 PTZ00472, PTZ00472, serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information 
 Score =  167 bits (425), Expect = 1e-50
 Identities = 60/145 (41%), Positives = 94/145 (64%), Gaps = 6/145 (4%)

Query: 3   KFLNDKSVREAIGVGDIEFVSCSPTVYQAMLVDWMRNLEVGIPGLLEDGVKLLVYAGEYD 62
            F+N + V+ ++GV    + SC+  V     +DWM+N    +PGLLEDGV++++YAG+ D
Sbjct: 316 AFMNREDVQSSLGVKPATWQSCNMEVNLMFEMDWMKNFNYTVPGLLEDGVRVMIYAGDMD 375

Query: 63  LICNWLGNSRWVHAMEWSGQKDFVASPEIPFE-VDGSEAGVLKTNGP-----LSFLKVHD 116
            ICNW+GN  W  A++W G  +F A+P++PF  VDG  AG++++         SF++V++
Sbjct: 376 FICNWIGNKAWTLALQWPGNAEFNAAPDVPFSAVDGRWAGLVRSAASNTSSGFSFVQVYN 435

Query: 117 SGHMVPMDQPKAALEMLRRWMEGSL 141
           +GHMVPMDQP  AL M+ R++    
Sbjct: 436 AGHMVPMDQPAVALTMINRFLRNRP 460

Length = 462
>gnl|CDD|215926 pfam00450, Peptidase_S10, Serine carboxypeptidase Back     alignment and domain information
>gnl|CDD|225490 COG2939, COG2939, Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|165857 PLN02213, PLN02213, sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information
>gnl|CDD|178590 PLN03016, PLN03016, sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>gnl|CDD|177859 PLN02209, PLN02209, serine carboxypeptidase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 155
PTZ00472462 serine carboxypeptidase (CBP1); Provisional 100.0
KOG1282454 consensus Serine carboxypeptidases (lysosomal cath 100.0
PF00450415 Peptidase_S10: Serine carboxypeptidase; InterPro: 100.0
PLN02213319 sinapoylglucose-malate O-sinapoyltransferase/ carb 100.0
PLN03016433 sinapoylglucose-malate O-sinapoyltransferase 100.0
PLN02209437 serine carboxypeptidase 100.0
KOG1283414 consensus Serine carboxypeptidases [Posttranslatio 99.93
COG2939498 Carboxypeptidase C (cathepsin A) [Amino acid trans 99.79
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 98.1
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 97.95
PRK10349256 carboxylesterase BioH; Provisional 97.95
TIGR03611257 RutD pyrimidine utilization protein D. This protei 97.94
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 97.92
PRK03204286 haloalkane dehalogenase; Provisional 97.91
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 97.91
PLN02679360 hydrolase, alpha/beta fold family protein 97.85
PRK10673255 acyl-CoA esterase; Provisional 97.84
PRK03592295 haloalkane dehalogenase; Provisional 97.8
PRK00870302 haloalkane dehalogenase; Provisional 97.78
PLN02824294 hydrolase, alpha/beta fold family protein 97.78
PRK07581339 hypothetical protein; Validated 97.76
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 97.73
PLN02965255 Probable pheophorbidase 97.7
PHA02857276 monoglyceride lipase; Provisional 97.68
PRK08775343 homoserine O-acetyltransferase; Provisional 97.67
PLN03084383 alpha/beta hydrolase fold protein; Provisional 97.64
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 97.64
KOG1454326 consensus Predicted hydrolase/acyltransferase (alp 97.6
PLN02385349 hydrolase; alpha/beta fold family protein 97.57
PLN02298330 hydrolase, alpha/beta fold family protein 97.53
PLN02578354 hydrolase 97.48
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 97.39
PRK00175379 metX homoserine O-acetyltransferase; Provisional 97.34
KOG4178322 consensus Soluble epoxide hydrolase [Lipid transpo 97.33
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 97.29
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 97.23
PF08386103 Abhydrolase_4: TAP-like protein; InterPro: IPR0135 97.17
PRK06489360 hypothetical protein; Provisional 97.15
PRK06765389 homoserine O-acetyltransferase; Provisional 97.12
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 97.12
PLN02894402 hydrolase, alpha/beta fold family protein 97.02
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 97.0
PRK10749330 lysophospholipase L2; Provisional 96.99
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 96.94
PLN02652395 hydrolase; alpha/beta fold family protein 96.88
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 96.75
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 96.75
PRK11460232 putative hydrolase; Provisional 96.55
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 96.47
PRK05855 582 short chain dehydrogenase; Validated 96.25
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 96.16
PRK10566249 esterase; Provisional 96.01
PLN02511388 hydrolase 95.99
PLN02211273 methyl indole-3-acetate methyltransferase 95.79
PLN02872395 triacylglycerol lipase 95.43
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 95.42
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 95.29
KOG4409365 consensus Predicted hydrolase/acyltransferase (alp 95.27
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 95.22
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 95.2
COG0400207 Predicted esterase [General function prediction on 95.09
PF03583290 LIP: Secretory lipase ; InterPro: IPR005152 This e 95.09
KOG2382315 consensus Predicted alpha/beta hydrolase [General 94.76
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 94.5
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 94.46
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 94.39
PF07519474 Tannase: Tannase and feruloyl esterase; InterPro: 94.3
PRK10985324 putative hydrolase; Provisional 93.66
PRK13604307 luxD acyl transferase; Provisional 92.89
COG2267298 PldB Lysophospholipase [Lipid metabolism] 92.71
TIGR01838532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 92.55
PF08840213 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term 92.29
PRK05077414 frsA fermentation/respiration switch protein; Revi 91.61
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 89.62
PRK07868 994 acyl-CoA synthetase; Validated 88.9
PRK11071190 esterase YqiA; Provisional 87.72
KOG1552258 consensus Predicted alpha/beta hydrolase [General 87.46
PLN02442283 S-formylglutathione hydrolase 84.34
PF01738218 DLH: Dienelactone hydrolase family; InterPro: IPR0 81.44
KOG2551230 consensus Phospholipase/carboxyhydrolase [Amino ac 81.43
COG1073299 Hydrolases of the alpha/beta superfamily [General 80.96
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information 
Probab=100.00  E-value=4.6e-41  Score=286.55  Aligned_cols=142  Identities=42%  Similarity=0.917  Sum_probs=135.8

Q ss_pred             CccccCcHHHHHHhCCCCCCceecchhHhhhhhcccccchhchHHHHhhcCceEEEEecCCCccCchhhHHHHHhccccc
Q 031655            1 MEKFLNDKSVREAIGVGDIEFVSCSPTVYQAMLVDWMRNLEVGIPGLLEDGVKLLVYAGEYDLICNWLGNSRWVHAMEWS   80 (155)
Q Consensus         1 l~~ylN~~~V~~aL~v~~~~w~~c~~~V~~~~~~d~~~~~~~~l~~LL~~~irVLiY~Gd~D~i~n~~g~~~~i~~l~w~   80 (155)
                      +++|||+|+||+||||++.+|+.|+..|+.++..|+++++.+.+++||++|+|||||+||.|++||+.|+++|+++|+|+
T Consensus       314 ~~~yLN~~~Vq~AL~v~~~~w~~c~~~V~~~~~~D~~~~~~~~l~~LL~~gikVLiYnGd~D~icn~~Gt~~wi~~L~w~  393 (462)
T PTZ00472        314 TIAFMNREDVQSSLGVKPATWQSCNMEVNLMFEMDWMKNFNYTVPGLLEDGVRVMIYAGDMDFICNWIGNKAWTLALQWP  393 (462)
T ss_pred             HHHHhCCHHHHHHhCCCCCCceeCCHHHHHHhhhccccchHHHHHHHHhcCceEEEEECCcCeecCcHhHHHHHHhCCCC
Confidence            35799999999999998778999999999999999998888899999999999999999999999999999999999999


Q ss_pred             cccccccCCCeee-eeCCEeeeEEEEeC-----ceeEEEEcCccccCcCCCcHHHHHHHHHHHcCCCC
Q 031655           81 GQKDFVASPEIPF-EVDGSEAGVLKTNG-----PLSFLKVHDSGHMVPMDQPKAALEMLRRWMEGSLS  142 (155)
Q Consensus        81 g~~~f~~~~~~~w-~~~g~~~G~~~~~~-----~ltf~~V~~AGHmvP~dqP~~~~~~~~~fl~~~~~  142 (155)
                      |+++|++++|++| .++++++||+|+++     ||+|++|++||||||.|||+++++|+++|+.|+++
T Consensus       394 g~~~f~~a~~~~w~~~~~~v~G~vk~~~~~~~~~l~~~~V~~AGH~vp~d~P~~~~~~i~~fl~~~~~  461 (462)
T PTZ00472        394 GNAEFNAAPDVPFSAVDGRWAGLVRSAASNTSSGFSFVQVYNAGHMVPMDQPAVALTMINRFLRNRPL  461 (462)
T ss_pred             CccchhhcCccccEecCCEeceEEEEEecccCCCeEEEEECCCCccChhhHHHHHHHHHHHHHcCCCC
Confidence            9999999999999 57899999999999     99999999999999999999999999999999864

>KOG1282 consensus Serine carboxypeptidases (lysosomal cathepsin A) [Posttranslational modification, protein turnover, chaperones; Amino acid transport and metabolism] Back     alignment and domain information
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PLN02213 sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information
>PLN03016 sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>PLN02209 serine carboxypeptidase Back     alignment and domain information
>KOG1283 consensus Serine carboxypeptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2939 Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PF08386 Abhydrolase_4: TAP-like protein; InterPro: IPR013595 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>PF07519 Tannase: Tannase and feruloyl esterase; InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ] Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>KOG2551 consensus Phospholipase/carboxyhydrolase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1073 Hydrolases of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query155
1wpx_A421 Crystal Structure Of Carboxypeptidase Y Inhibitor C 1e-21
1cpy_A421 Site-Directed Mutagenesis On (Serine) Carboxypeptid 1e-21
1ac5_A483 Crystal Structure Of Kex1(delta)p, A Prohormone-pro 6e-09
1ivy_A452 Physiological Dimer Hpp Precursor Length = 452 3e-07
4az0_B155 Crystal Structure Of Cathepsin A, Complexed With 8a 3e-07
>pdb|1WPX|A Chain A, Crystal Structure Of Carboxypeptidase Y Inhibitor Complexed With The Cognate Proteinase Length = 421 Back     alignment and structure 
Iteration: 1

 Score = 98.6 bits (244), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 79/150 (52%), Gaps = 12/150 (8%)
Query: 1   MEKFLNDKSVREAIGVGDIEFVSCSPTVYQAMLV--DWMRNLEVGIPGLLEDGVKLLVYA 58
           ++ +LN   V+EA+G     + SC+  + +  L   DWM+     +  LL   + +LVYA
Sbjct: 275 IDDYLNQDYVKEAVGAEVDHYESCNFDINRNFLFAGDWMKPYHTAVTDLLNQDLPILVYA 334
Query: 59  GEYDLICNWLGNSRWVHAMEWSGQKDFVA------SPEIPFEVDGSEAGVLKTNGPLSFL 112
           G+ D ICNWLGN  W   + W   ++F +      +  I  EV    AG +K+    ++L
Sbjct: 335 GDKDFICNWLGNKAWTDVLPWKYDEEFASQKVRNWTASITDEV----AGEVKSYKHFTYL 390
Query: 113 KVHDSGHMVPMDQPKAALEMLRRWMEGSLS 142
           +V + GHMVP D P+ AL M+  W+ G  S
Sbjct: 391 RVFNGGHMVPFDVPENALSMVNEWIHGGFS 420
>pdb|1CPY|A Chain A, Site-Directed Mutagenesis On (Serine) Carboxypeptidase Y From Yeast. The Significance Of Thr 60 And Met 398 In Hydrolysis And Aminolysis Reactions Length = 421 Back     alignment and structure
>pdb|1AC5|A Chain A, Crystal Structure Of Kex1(delta)p, A Prohormone-processing Carboxypeptidase From Saccharomyces Cerevisiae Length = 483 Back     alignment and structure
>pdb|1IVY|A Chain A, Physiological Dimer Hpp Precursor Length = 452 Back     alignment and structure
>pdb|4AZ0|B Chain B, Crystal Structure Of Cathepsin A, Complexed With 8a. Length = 155 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query155
1cpy_A421 Serine carboxypeptidase; hydrolase (carboxypeptida 3e-62
1ac5_A483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 9e-57
1gxs_B158 P-(S)-hydroxymandelonitrIle lyase chain B; inhibit 2e-52
1ivy_A452 Human protective protein; carboxypeptidase, serine 5e-51
1whs_B153 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 5e-48
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Length = 421 Back     alignment and structure
 Score =  195 bits (499), Expect = 3e-62
 Identities = 48/146 (32%), Positives = 77/146 (52%), Gaps = 4/146 (2%)

Query: 1   MEKFLNDKSVREAIGVGDIEFVSCSPTVYQAMLV--DWMRNLEVGIPGLLEDGVKLLVYA 58
           ++ +LN   V+EA+G     + SC+  + +  L   DWM+     +  LL   + +LVYA
Sbjct: 275 IDDYLNQDYVKEAVGAEVDHYESCNFDINRNFLFAGDWMKPYHTAVTDLLNQDLPILVYA 334

Query: 59  GEYDLICNWLGNSRWVHAMEWSGQKDFVASPEIPF--EVDGSEAGVLKTNGPLSFLKVHD 116
           G+ D ICNWLGN  W   + W   ++F +     +   +    AG +K+    ++L+V +
Sbjct: 335 GDKDFICNWLGNKAWTDVLPWKYDEEFASQKVRNWTASITDEVAGEVKSYKHFTYLRVFN 394

Query: 117 SGHMVPMDQPKAALEMLRRWMEGSLS 142
            GHMVP D P+ AL M+  W+ G  S
Sbjct: 395 GGHMVPFDVPENALSMVNEWIHGGFS 420
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Length = 483 Back     alignment and structure
>1gxs_B P-(S)-hydroxymandelonitrIle lyase chain B; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Length = 158 Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Length = 452 Back     alignment and structure
>1whs_B Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1wht_B* 1bcs_B* 1bcr_B* 3sc2_B* Length = 153 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query155
1whs_B153 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 100.0
1gxs_B158 P-(S)-hydroxymandelonitrIle lyase chain B; inhibit 100.0
4az3_B155 Lysosomal protective protein 20 kDa chain; hydrola 100.0
1cpy_A421 Serine carboxypeptidase; hydrolase (carboxypeptida 100.0
1ac5_A483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 100.0
1ivy_A452 Human protective protein; carboxypeptidase, serine 100.0
1iup_A282 META-cleavage product hydrolase; aromatic compound 98.42
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 98.17
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 98.13
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 98.09
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 98.04
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 98.04
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 98.01
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 98.01
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 98.0
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 97.99
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 97.99
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 97.98
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 97.97
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 97.96
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 97.96
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 97.95
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 97.95
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 97.95
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 97.94
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 97.94
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 97.92
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 97.91
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 97.91
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 97.91
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 97.9
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 97.9
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 97.9
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 97.9
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 97.89
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 97.88
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 97.88
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 97.88
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 97.88
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 97.87
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 97.87
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 97.87
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 97.87
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 97.86
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 97.85
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 97.84
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 97.84
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 97.84
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 97.83
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 97.83
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 97.82
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 97.82
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 97.81
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 97.81
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 97.8
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 97.79
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 97.79
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 97.78
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 97.78
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 97.77
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 97.77
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 97.76
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 97.76
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 97.76
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 97.75
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 97.74
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 97.73
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 97.73
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 97.7
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 97.66
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 97.66
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 97.65
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 97.6
3llc_A270 Putative hydrolase; structural genomics, joint cen 97.6
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 97.6
3h04_A275 Uncharacterized protein; protein with unknown func 97.59
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 97.59
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 97.58
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 97.58
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 97.58
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 97.56
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 97.54
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 97.53
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 97.48
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 97.47
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 97.43
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 97.41
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 97.41
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 97.41
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 97.41
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 97.37
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 97.36
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 97.32
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 97.32
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 96.43
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 97.3
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 97.26
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 97.22
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 97.21
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 97.2
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 97.2
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 97.17
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 97.16
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 97.15
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 97.12
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 97.1
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 97.1
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 97.09
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 97.08
1vkh_A273 Putative serine hydrolase; structural genomics, jo 97.07
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 97.04
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 97.02
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 96.97
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 96.96
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 96.87
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 96.86
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 96.83
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 96.81
1r3d_A264 Conserved hypothetical protein VC1974; structural 96.8
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 96.8
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 96.77
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 96.71
2d81_A 318 PHB depolymerase; alpha/beta hydrolase fold, circu 96.7
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 96.58
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 96.57
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 96.55
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 96.48
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 96.45
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 96.4
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 96.37
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 96.36
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 96.36
4f21_A246 Carboxylesterase/phospholipase family protein; str 96.35
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 96.35
3bjr_A283 Putative carboxylesterase; structural genomics, jo 96.31
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 96.29
4fle_A202 Esterase; structural genomics, PSI-biology, northe 96.24
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 96.2
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 96.17
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 96.13
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 96.1
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 96.08
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 95.99
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 95.97
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 95.91
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 95.8
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 95.77
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 95.71
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 95.71
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 95.65
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 95.63
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 95.58
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 95.46
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 95.45
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 95.33
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 95.28
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 95.26
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 95.16
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 95.1
1kez_A300 Erythronolide synthase; polyketide synthase, modul 95.0
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 94.55
3guu_A462 Lipase A; protein structure, hydrolase; HET: 1PE; 94.37
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 94.34
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 94.23
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 94.18
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 94.05
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 93.43
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 93.32
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 92.96
3ain_A323 303AA long hypothetical esterase; carboxylesterase 92.71
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 92.67
3pic_A375 CIP2; alpha/beta hydrolase fold, glucuronoyl ester 92.6
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 92.39
3lp5_A250 Putative cell surface hydrolase; structural genom 92.27
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 92.21
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 92.19
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 92.1
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 91.82
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 91.8
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 91.8
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 91.59
4g4g_A433 4-O-methyl-glucuronoyl methylesterase; alpha/beta 91.4
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 91.2
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 90.98
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 90.67
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 90.66
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 90.59
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 90.46
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 90.26
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 90.22
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 89.14
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 88.94
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 88.79
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 88.49
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 88.46
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 87.74
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 87.44
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 86.66
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 86.48
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 85.13
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 82.06
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 81.65
3tej_A329 Enterobactin synthase component F; nonribosomal pe 81.14
>1whs_B Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1wht_B* 1bcs_B* 1bcr_B* 3sc2_B* Back     alignment and structure
Probab=100.00  E-value=5.9e-49  Score=290.21  Aligned_cols=137  Identities=20%  Similarity=0.342  Sum_probs=128.5

Q ss_pred             ccccCcHHHHHHhCCCC-----CCceecchhHhhhhhcccccchhchHHHHhhcCceEEEEecCCCccCchhhHHHHHhc
Q 031655            2 EKFLNDKSVREAIGVGD-----IEFVSCSPTVYQAMLVDWMRNLEVGIPGLLEDGVKLLVYAGEYDLICNWLGNSRWVHA   76 (155)
Q Consensus         2 ~~ylN~~~V~~aL~v~~-----~~w~~c~~~V~~~~~~d~~~~~~~~l~~LL~~~irVLiY~Gd~D~i~n~~g~~~~i~~   76 (155)
                      +.|||+++||+||||+.     .+|+.||..|+.++ .|.++++.+.++.||++|+|||||+||.|++||+.|+++|+++
T Consensus        11 ~~ylN~~~V~~AL~v~~~~~~~~~w~~cs~~v~~~~-~d~~~s~~~~~~~Ll~~girvlIy~Gd~D~i~~~~Gt~~~i~~   89 (153)
T 1whs_B           11 TAYYNRRDVQMALHANVTGAMNYTWATCSDTINTHW-HDAPRSMLPIYRELIAAGLRIWVFSGDTDAVVPLTATRYSIGA   89 (153)
T ss_dssp             HHHHHCHHHHHHTTCSTTSCCCSCCCSBCHHHHHSC-CCCCSBCHHHHHHHHHTTCEEEEEEETTCSSSCHHHHHHHHHT
T ss_pred             HHHcCCHHHHHHhCCCCCCCCCCCcccCchHHHHhh-hhccccHHHHHHHHHhcCceEEEEecCcCcccccHhHHHHHHh
Confidence            57999999999999983     37999999998877 5777888899999999999999999999999999999999999


Q ss_pred             cccccccccccCCCeeeeeCCEeeeEEEEeCceeEEEEcCccccCcCCCcHHHHHHHHHHHcCCCCCC
Q 031655           77 MEWSGQKDFVASPEIPFEVDGSEAGVLKTNGPLSFLKVHDSGHMVPMDQPKAALEMLRRWMEGSLSEV  144 (155)
Q Consensus        77 l~w~g~~~f~~~~~~~w~~~g~~~G~~~~~~~ltf~~V~~AGHmvP~dqP~~~~~~~~~fl~~~~~~~  144 (155)
                      |+|++.+     +|+||+++|+++||+++++||||++|+|||||||+|||++|++||++||.|+++|.
T Consensus        90 L~w~~~~-----~~~~w~~~~~vaG~~~~~~~Ltf~~V~~AGHmVP~dqP~~a~~m~~~fl~~~~l~~  152 (153)
T 1whs_B           90 LGLPTTT-----SWYPWYDDQEVGGWSQVYKGLTLVSVRGAGHEVPLHRPRQALVLFQYFLQGKPMPG  152 (153)
T ss_dssp             TTCCEEE-----EEEEEEETTEEEEEEEEETTEEEEEETTCCSSHHHHSHHHHHHHHHHHHHTCCCCC
T ss_pred             CCCCCcc-----cccceeECCCccEEEEEeCeEEEEEECCCcccCcccCHHHHHHHHHHHHCCCCCCC
Confidence            9999864     57899999999999999999999999999999999999999999999999999875
>1gxs_B P-(S)-hydroxymandelonitrIle lyase chain B; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>4az3_B Lysosomal protective protein 20 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_B* Back     alignment and structure
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Back     alignment and structure
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>4g4g_A 4-O-methyl-glucuronoyl methylesterase; alpha/beta hydrolase, 3-layer alpha/beta/alpha sandwich, ROS fold, glucuronoyl esterase; 1.55A {Myceliophthora thermophila} PDB: 4g4i_A 4g4j_A* Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 155
d1wpxa1421 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Bak 2e-44
d1ac5a_483 c.69.1.5 (A:) Serine carboxypeptidase II {Baker's 3e-41
d1ivya_452 c.69.1.5 (A:) Human 'protective protein', HPP {Hum 5e-40
g1gxs.1425 c.69.1.5 (A:,B:) Hydroxynitrile lyase {Sorghum (So 2e-39
g1wht.1409 c.69.1.5 (A:,B:) Serine carboxypeptidase II {Wheat 4e-38
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 421 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Serine carboxypeptidase-like
domain: Serine carboxypeptidase II
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score =  148 bits (374), Expect = 2e-44
 Identities = 48/146 (32%), Positives = 77/146 (52%), Gaps = 4/146 (2%)

Query: 1   MEKFLNDKSVREAIGVGDIEFVSCSPTVYQAMLV--DWMRNLEVGIPGLLEDGVKLLVYA 58
           ++ +LN   V+EA+G     + SC+  + +  L   DWM+     +  LL   + +LVYA
Sbjct: 275 IDDYLNQDYVKEAVGAEVDHYESCNFDINRNFLFAGDWMKPYHTAVTDLLNQDLPILVYA 334

Query: 59  GEYDLICNWLGNSRWVHAMEWSGQKDFVASPEIPF--EVDGSEAGVLKTNGPLSFLKVHD 116
           G+ D ICNWLGN  W   + W   ++F +     +   +    AG +K+    ++L+V +
Sbjct: 335 GDKDFICNWLGNKAWTDVLPWKYDEEFASQKVRNWTASITDEVAGEVKSYKHFTYLRVFN 394

Query: 117 SGHMVPMDQPKAALEMLRRWMEGSLS 142
            GHMVP D P+ AL M+  W+ G  S
Sbjct: 395 GGHMVPFDVPENALSMVNEWIHGGFS 420
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Length = 483 Back     information, alignment and structure
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Length = 452 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query155
d1wpxa1421 Serine carboxypeptidase II {Baker's yeast (Sacchar 100.0
d1ac5a_483 Serine carboxypeptidase II {Baker's yeast (Sacchar 100.0
g1wht.1409 Serine carboxypeptidase II {Wheat (Triticum vulgar 100.0
g1gxs.1425 Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T 100.0
d1ivya_452 Human 'protective protein', HPP {Human (Homo sapie 100.0
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 98.32
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 98.3
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 98.28
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 98.26
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 98.22
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 98.2
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 98.19
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 98.18
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 98.16
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 98.12
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 98.11
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 98.1
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 98.08
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 98.08
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 98.01
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 98.01
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 97.98
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 97.97
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 97.89
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 97.78
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 97.76
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 97.6
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 97.53
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 97.51
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 97.37
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 97.36
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 97.35
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 97.23
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 97.17
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 96.97
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 96.66
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 96.53
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 96.42
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 96.26
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 96.17
d2d81a1 318 Polyhydroxybutyrate depolymerase {Penicillium funi 96.16
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 96.03
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 95.85
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 95.73
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 95.62
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 95.54
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 95.47
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 95.45
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 95.41
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 95.39
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 94.91
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 94.86
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 94.5
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 94.16
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 93.33
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 92.74
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 92.42
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 92.41
d2pl5a1362 Homoserine O-acetyltransferase {Leptospira interro 90.9
d2vata1376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 89.8
d2b61a1357 Homoserine O-acetyltransferase {Haemophilus influe 87.34
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 83.51
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Serine carboxypeptidase-like
domain: Serine carboxypeptidase II
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=100.00  E-value=4.6e-42  Score=284.92  Aligned_cols=140  Identities=34%  Similarity=0.762  Sum_probs=132.1

Q ss_pred             ccccCcHHHHHHhCCCCCCceecchhHhhhhh--cccccchhchHHHHhhcCceEEEEecCCCccCchhhHHHHHhcccc
Q 031655            2 EKFLNDKSVREAIGVGDIEFVSCSPTVYQAML--VDWMRNLEVGIPGLLEDGVKLLVYAGEYDLICNWLGNSRWVHAMEW   79 (155)
Q Consensus         2 ~~ylN~~~V~~aL~v~~~~w~~c~~~V~~~~~--~d~~~~~~~~l~~LL~~~irVLiY~Gd~D~i~n~~g~~~~i~~l~w   79 (155)
                      +.|||+++||+|||++...|..|+..+..++.  .|.+.++...+++||++++|||||+||.|++||+.|+++||++|+|
T Consensus       276 ~~ylN~~~Vq~aL~v~~~~~~~cs~~v~~~~~~~~d~~~~~~~~l~~LL~~~irVLIysGd~D~~~p~~Gte~~i~~L~w  355 (421)
T d1wpxa1         276 DDYLNQDYVKEAVGAEVDHYESCNFDINRNFLFAGDWMKPYHTAVTDLLNQDLPILVYAGDKDFICNWLGNKAWTDVLPW  355 (421)
T ss_dssp             HHHHTSHHHHHHHTCCSSSCCSBCHHHHHHHHTTTCTTCCTTHHHHHHHHTTCCEEEEEETTCSTTCHHHHHHHHHHCCS
T ss_pred             hhhhccHHHHHHhCCCCCcceecCchHhhhhhccCcccCcHHHHHHHHHhcCCeEEEEeCCcCccCCchhHHHHHHhCCC
Confidence            46999999999999997799999999988764  6888888889999999999999999999999999999999999999


Q ss_pred             ccccccccCCCeeeee--CCEeeeEEEEeCceeEEEEcCccccCcCCCcHHHHHHHHHHHcCCC
Q 031655           80 SGQKDFVASPEIPFEV--DGSEAGVLKTNGPLSFLKVHDSGHMVPMDQPKAALEMLRRWMEGSL  141 (155)
Q Consensus        80 ~g~~~f~~~~~~~w~~--~g~~~G~~~~~~~ltf~~V~~AGHmvP~dqP~~~~~~~~~fl~~~~  141 (155)
                      ++.++|+.+++++|+.  +++++||+++++||||++|+|||||||+|||++|++||++||.|..
T Consensus       356 ~~~~~f~~~~~~~w~~~~~~~~aG~~~~~~nltf~~V~~AGHmvP~d~P~~a~~m~~~fi~G~~  419 (421)
T d1wpxa1         356 KYDEEFASQKVRNWTASITDEVAGEVKSYKHFTYLRVFNGGHMVPFDVPENALSMVNEWIHGGF  419 (421)
T ss_dssp             TTHHHHHHSCCEEEECTTTCSEEEEEEEETTEEEEEETTCCSSHHHHCHHHHHHHHHHHHTTTS
T ss_pred             CcccchhcCcccceeecCCCeEEEEEEEECCeEEEEECCccccCcccCHHHHHHHHHHHhcCCC
Confidence            9999999999999975  6799999999999999999999999999999999999999999864
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Back     information, alignment and structure
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure