Citrus Sinensis ID: 031668

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-----
MKGQVSHELEVNVPAAQAWELYGTIKLAKLVEKESDTVEEIEIVEGDGGVGTILHLKFTPGTPGFAGYKEKFIEIDNERRVKVTDAVEGGYLDVGFTLFRVIFEIIEKGSDSCIIRSIIEYELKEEAAANASFVSTDAVAKIAEMAKNYLLNNKA
cccEEEEEEEEcccHHHHHHHHcccccccHHHHHcccEEEEEEEEcccccccEEEEEEEcccccccEEEEEEEEEEccccEEEEEEEEcccccccEEEEEEEEEEEEEccccEEEEEEEEEEEccccccccccccHHHHHHHHHHHHHHHHHccc
ccccEEEEEEEcccHHHHHHHHccccHHHHHHHccccEcEEEEEEccccccEEEEEEccccccccccEEEEEEEEcccccEEEEEEEEccccccccEEEEEEEEEEEcccccEEEEEEEEEEEccHHHcccccccHHHHHHHHHHHHHHHHHccc
MKGQVSHELEVNVPAAQAWELYGTIKLAKLVEKESDTVEEIEivegdggvgtilhlkftpgtpgfagykEKFIEIdnerrvkvtdaveggyldvGFTLFRVIFEIIEKGSDSCIIRSIIEYELKEeaaanasfVSTDAVAKIAEMAKNYLLNNKA
MKGQVSHELEVNVPAAQAWELYGTIKLAKLVEKESDTVEEIEivegdggvgtILHLKFtpgtpgfaGYKEKFIEIDNERRVKVTdaveggyldvGFTLFRVIFEIiekgsdscIIRSIIEYELKEEAAANASFVSTDAVAKIAEMAKnyllnnka
MKGQVSHELEVNVPAAQAWELYGTIKLAKLVEKESdtveeieivegdggvgtiLHLKFTPGTPGFAGYKEKFIEIDNERRVKVTDAVEGGYLDVGFTLFRVIFEIIEKGSDSCIIRSIIEYELKEEAAANASFVSTDAVAKIAEMAKNYLLNNKA
**********VNVPAAQAWELYGTIKLAKLVEKESDTVEEIEIVEGDGGVGTILHLKFTPGTPGFAGYKEKFIEIDNERRVKVTDAVEGGYLDVGFTLFRVIFEIIEKGSDSCIIRSIIEYELKEEAAANASFVSTDAVAKIAEMAKNYL*****
**GQVSHELEVNVPAAQAWELYGTIKLAKLVEKESDTVEEIEIVEGDGGVGTILHLKFTPGTPGFAGYKEKFIEIDNERRVKVTDAVEGGYLDVGFTLFRVIFEIIEKGSDSCIIRSIIEYELKEEA******VSTDAVAKIAEMAKNYLLNN**
********LEVNVPAAQAWELYGTIKLAKLVEKESDTVEEIEIVEGDGGVGTILHLKFTPGTPGFAGYKEKFIEIDNERRVKVTDAVEGGYLDVGFTLFRVIFEIIEKGSDSCIIRSIIEYELKEEAAANASFVSTDAVAKIAEMAKNYLLNNKA
***QVSHELEVNVPAAQAWELYGTIKLAKLVEKESDTVEEIEIVEGDGGVGTILHLKFTPGTPGFAGYKEKFIEIDNERRVKVTDAVEGGYLDVGFTLFRVIFEIIEKGSDSCIIRSIIEYELKEEAAANASFVSTDAVAKIAEMAKNYLLNN**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKGQVSHELEVNVPAAQAWELYGTIKLAKLVEKESDTVEEIEIVEGDGGVGTILHLKFTPGTPGFAGYKEKFIEIDNERRVKVTDAVEGGYLDVGFTLFRVIFEIIEKGSDSCIIRSIIEYELKEEAAANASFVSTDAVAKIAEMAKNYLLNNKA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query155 2.2.26 [Sep-21-2011]
Q67A25210 S-norcoclaurine synthase N/A no 0.954 0.704 0.402 2e-22
A2A1A1196 S-norcoclaurine synthase N/A no 0.935 0.739 0.328 3e-15
Q05736158 Pathogenesis-related prot N/A no 0.916 0.898 0.270 0.0008
>sp|Q67A25|NCS_THLFG S-norcoclaurine synthase OS=Thalictrum flavum subsp. glaucum PE=1 SV=1 Back     alignment and function desciption
 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 87/154 (56%), Gaps = 6/154 (3%)

Query: 5   VSHELEVNVPAAQAWELYGTIKLAK-LVEKESDTVEEIEIVEGDGGVGTILHLKFTPGTP 63
           + HELEV   A   W +Y    LAK L +      E++EI+ GDGGVGTIL + F PG  
Sbjct: 46  IHHELEVAASADDIWTVYSWPGLAKHLPDLLPGAFEKLEII-GDGGVGTILDMTFVPGE- 103

Query: 64  GFAG-YKEKFIEIDNERRVKVTDAVEGGYLDVGFTLFRVIFEIIEKGSDSCIIRSIIEYE 122
            F   YKEKFI +DNE R+K    +EGGYLD+G T +     ++  G DSC+I+S  EY 
Sbjct: 104 -FPHEYKEKFILVDNEHRLKKVQMIEGGYLDLGVTYYMDTIHVVPTGKDSCVIKSSTEYH 162

Query: 123 LKEEAAANA-SFVSTDAVAKIAEMAKNYLLNNKA 155
           +K E        ++T  +A +A+     +L +K+
Sbjct: 163 VKPEFVKIVEPLITTGPLAAMADAISKLVLEHKS 196
Involved in the biosynthesis of the common precursor of all benzylisoquinoline alkaloids such as morphine, sanguinarine, codeine or berberine. Condenses dopamine and 4-hydroxyphenylacetaldehyde.
Thalictrum flavum subsp. glaucum (taxid: 150095)
EC: 4EC: .EC: 2EC: .EC: 1EC: .EC: 7EC: 8
>sp|A2A1A1|NCS2_COPJA S-norcoclaurine synthase 2 OS=Coptis japonica GN=PR10A PE=2 SV=2 Back     alignment and function description
>sp|Q05736|PR1_ASPOF Pathogenesis-related protein 1 OS=Asparagus officinalis GN=PR1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query155
351727799161 uncharacterized protein LOC100305838 [Gl 1.0 0.962 0.608 3e-49
388508302162 unknown [Lotus japonicus] 1.0 0.956 0.564 7e-47
388519899162 unknown [Lotus japonicus] 1.0 0.956 0.557 1e-46
225454743164 PREDICTED: S-norcoclaurine synthase [Vit 0.987 0.932 0.563 9e-42
449460704157 PREDICTED: S-norcoclaurine synthase-like 0.987 0.974 0.529 2e-40
449460710156 PREDICTED: S-norcoclaurine synthase-like 0.974 0.967 0.496 7e-38
449484076164 PREDICTED: S-norcoclaurine synthase-like 0.980 0.926 0.470 1e-36
449460756 501 PREDICTED: uncharacterized protein LOC10 0.980 0.303 0.470 1e-36
326513769165 predicted protein [Hordeum vulgare subsp 1.0 0.939 0.5 8e-36
116311046161 OSIGBa0142I02-OSIGBa0101B20.20 [Oryza sa 0.993 0.956 0.464 7e-33
>gi|351727799|ref|NP_001237429.1| uncharacterized protein LOC100305838 [Glycine max] gi|255626741|gb|ACU13715.1| unknown [Glycine max] Back     alignment and taxonomy information
 Score =  199 bits (506), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 95/156 (60%), Positives = 125/156 (80%), Gaps = 1/156 (0%)

Query: 1   MKGQVSHELEVNVPAAQAWELYGTIKLAKLVEKE-SDTVEEIEIVEGDGGVGTILHLKFT 59
           M GQ+ HELE++VPA++AW+L+G +++ KLV +E  +  +++E+ EGDGGVGT+L L F 
Sbjct: 1   MFGQLEHELELHVPASEAWDLFGALEIGKLVAQELPELFQKVELTEGDGGVGTVLKLTFA 60

Query: 60  PGTPGFAGYKEKFIEIDNERRVKVTDAVEGGYLDVGFTLFRVIFEIIEKGSDSCIIRSII 119
           PG PG AGYKEKF +IDNE+R+K T+ VEGGYL++GFTLFRV  E+IEKG +S II+S +
Sbjct: 61  PGVPGPAGYKEKFTKIDNEKRIKETEVVEGGYLELGFTLFRVRLEVIEKGEESSIIKSTV 120

Query: 120 EYELKEEAAANASFVSTDAVAKIAEMAKNYLLNNKA 155
           EYE+KEE AANAS V+   VA IAE+AKNYL  NKA
Sbjct: 121 EYEVKEENAANASLVTIQPVATIAELAKNYLNKNKA 156

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|388508302|gb|AFK42217.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|388519899|gb|AFK48011.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|225454743|ref|XP_002273566.1| PREDICTED: S-norcoclaurine synthase [Vitis vinifera] gi|297737294|emb|CBI26495.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449460704|ref|XP_004148085.1| PREDICTED: S-norcoclaurine synthase-like [Cucumis sativus] gi|449529541|ref|XP_004171758.1| PREDICTED: S-norcoclaurine synthase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449460710|ref|XP_004148088.1| PREDICTED: S-norcoclaurine synthase-like isoform 1 [Cucumis sativus] gi|449460712|ref|XP_004148089.1| PREDICTED: S-norcoclaurine synthase-like isoform 2 [Cucumis sativus] gi|449483972|ref|XP_004156747.1| PREDICTED: S-norcoclaurine synthase-like isoform 1 [Cucumis sativus] gi|449483976|ref|XP_004156748.1| PREDICTED: S-norcoclaurine synthase-like isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449484076|ref|XP_004156777.1| PREDICTED: S-norcoclaurine synthase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449460756|ref|XP_004148111.1| PREDICTED: uncharacterized protein LOC101204313 [Cucumis sativus] Back     alignment and taxonomy information
>gi|326513769|dbj|BAJ87903.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|116311046|emb|CAH67977.1| OSIGBa0142I02-OSIGBa0101B20.20 [Oryza sativa Indica Group] gi|125591479|gb|EAZ31829.1| hypothetical protein OsJ_15989 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

No hits with e-value below 0.001 by BLAST

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer4.2.1.78LOW CONFIDENCE prediction!
3rd Layer4.2.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
4336835
pathogenesis-related Bet v I family protein, putative, expressed (161 aa)
(Oryza sativa Japonica)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query155
cd07816148 cd07816, Bet_v1-like, Ligand-binding bet_v_1 domai 4e-31
pfam00407150 pfam00407, Bet_v_1, Pathogenesis-related protein B 2e-09
cd07821140 cd07821, PYR_PYL_RCAR_like, Pyrabactin resistance 8e-06
>gnl|CDD|176858 cd07816, Bet_v1-like, Ligand-binding bet_v_1 domain of major pollen allergen of white birch (Betula verrucosa), Bet v 1, and related proteins Back     alignment and domain information 
 Score =  108 bits (273), Expect = 4e-31
 Identities = 42/149 (28%), Positives = 70/149 (46%), Gaps = 3/149 (2%)

Query: 3   GQVSHELEVNVPAAQAWELYGTIKLAKLVEKESDTVEEIEIVEGDGGVGTILHLKFTPGT 62
           G + HE+E+ VPA + W+ +       L  K    ++ +E++EGDGG G+I  + F PG 
Sbjct: 1   GTLEHEVELKVPAEKLWKAFVL-DSHLLPPKLPPVIKSVELLEGDGGPGSIKLITFGPGG 59

Query: 63  PGFAGYKEKFIEIDNERRVKVTDAVEGGYLDVGFTLFRVIFEIIEKGSDSCIIRSIIEYE 122
                 KE+   +D E +      +EG  L  G+  ++V  + + KG   C+++  IEYE
Sbjct: 60  K-VKYVKERIDAVDEENKTYKYTVIEGDVLKDGYKSYKVEIKFVPKGDGGCVVKWTIEYE 118

Query: 123 LKEEAAANASFVSTDAVAKIAEMAKNYLL 151
            K +A      +      K  +M K    
Sbjct: 119 KKGDAEPPEEEI-KAGKEKALKMFKAVEA 146

This family includes the ligand binding domain of Bet v 1 (the major pollen allergen of white birch, Betula verrucosa) and related proteins. In addition to birch Bet v 1, this family includes other plant intracellular pathogenesis-related class 10 (PR-10) proteins, norcoclaurine synthases (NCSs), cytokinin binding proteins (CSBPs), major latex proteins (MLPs), and ripening-related proteins. It belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. Members of this family binds a diverse range of ligands. Bet v 1 can bind brassinosteroids, cytokinins, flavonoids and fatty acids. Hyp-1, a PR-10 from Hypericum perforatum/St. John's wort, catalyzes the condensation of two molecules of emodin to the bioactive naphthodianthrone hypericin. NCSs catalyze the condensation of dopamine and 4-hydroxyphenylacetaldehyde to (S)-norcoclaurine, the first committed step in the biosynthesis of benzylisoquinoline alkaloids such as morphine. The role of MLPs is unclear; however, they are associated with fruit and flower development and in pathogen defense responses. A number of PR-10 proteins in this subgroup, including Bet v 1, have in vitro RNase activity, the biological significance of which is unclear. Bet v 1 family proteins have a conserved glycine-rich P (phosphate-binding)-loop proximal to the entrance of the ligand-binding pocket. However, its conformation differs from that of the canonical P-loop structure found in nucleotide-binding proteins. Several PR-10 members including Bet v1 are allergenic. Cross-reactivity of Bet v 1 with homologs from plant foods results in birch-fruit syndrome. Length = 148
>gnl|CDD|215904 pfam00407, Bet_v_1, Pathogenesis-related protein Bet v I family Back     alignment and domain information
>gnl|CDD|176863 cd07821, PYR_PYL_RCAR_like, Pyrabactin resistance 1 (PYR1), PYR1-like (PYL), regulatory component of abscisic acid receptors (RCARs), and related proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 155
PF00407151 Bet_v_1: Pathogenesis-related protein Bet v I fami 100.0
cd07816148 Bet_v1-like Ligand-binding bet_v_1 domain of major 100.0
cd07821140 PYR_PYL_RCAR_like Pyrabactin resistance 1 (PYR1), 99.76
PF10604139 Polyketide_cyc2: Polyketide cyclase / dehydrase an 99.66
cd08866144 SRPBCC_11 Ligand-binding SRPBCC domain of an uncha 99.52
cd08861142 OtcD1_ARO-CYC_like N-terminal and C-terminal aroma 99.43
cd08865140 SRPBCC_10 Ligand-binding SRPBCC domain of an uncha 99.42
cd07819140 SRPBCC_2 Ligand-binding SRPBCC domain of an unchar 99.42
cd07813138 COQ10p_like Coenzyme Q-binding protein COQ10p and 99.35
cd07822141 SRPBCC_4 Ligand-binding SRPBCC domain of an unchar 99.31
cd08862138 SRPBCC_Smu440-like Ligand-binding SRPBCC domain of 99.29
cd07825144 SRPBCC_7 Ligand-binding SRPBCC domain of an unchar 99.27
cd07812141 SRPBCC START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SR 99.25
cd07814139 SRPBCC_CalC_Aha1-like Putative hydrophobic ligand- 99.16
cd07818150 SRPBCC_1 Ligand-binding SRPBCC domain of an unchar 99.14
cd08860146 TcmN_ARO-CYC_like N-terminal aromatase/cyclase dom 99.13
cd05018144 CoxG Carbon monoxide dehydrogenase subunit G (CoxG 99.12
cd07824146 SRPBCC_6 Ligand-binding SRPBCC domain of an unchar 99.1
cd07820137 SRPBCC_3 Ligand-binding SRPBCC domain of an unchar 99.05
cd07817139 SRPBCC_8 Ligand-binding SRPBCC domain of an unchar 99.04
PF03364130 Polyketide_cyc: Polyketide cyclase / dehydrase and 98.95
cd07823146 SRPBCC_5 Ligand-binding SRPBCC domain of an unchar 98.86
PRK10724158 hypothetical protein; Provisional 98.79
COG3427146 Carbon monoxide dehydrogenase subunit G, CoxG [Ene 98.7
cd07826142 SRPBCC_CalC_Aha1-like_9 Putative hydrophobic ligan 98.54
cd08894139 SRPBCC_CalC_Aha1-like_1 Putative hydrophobic ligan 98.53
PF06240140 COXG: Carbon monoxide dehydrogenase subunit G (Cox 98.46
cd08898145 SRPBCC_CalC_Aha1-like_5 Putative hydrophobic ligan 98.45
cd08900143 SRPBCC_CalC_Aha1-like_7 Putative hydrophobic ligan 98.42
cd08896146 SRPBCC_CalC_Aha1-like_3 Putative hydrophobic ligan 98.42
cd08895146 SRPBCC_CalC_Aha1-like_2 Putative hydrophobic ligan 98.4
cd08899157 SRPBCC_CalC_Aha1-like_6 Putative hydrophobic ligan 98.33
cd08897133 SRPBCC_CalC_Aha1-like_4 Putative hydrophobic ligan 98.17
cd08891149 SRPBCC_CalC Ligand-binding SRPBCC domain of Microm 98.13
cd08893136 SRPBCC_CalC_Aha1-like_GntR-HTH Putative hydrophobi 98.12
COG5637217 Predicted integral membrane protein [Function unkn 98.09
cd08876195 START_1 Uncharacterized subgroup of the steroidoge 98.09
cd08901136 SRPBCC_CalC_Aha1-like_8 Putative hydrophobic ligan 97.79
COG3832149 Uncharacterized conserved protein [Function unknow 97.79
PF08327124 AHSA1: Activator of Hsp90 ATPase homolog 1-like pr 97.56
cd08892126 SRPBCC_Aha1 Putative hydrophobic ligand-binding SR 97.27
cd08873235 START_STARD14_15-like Lipid-binding START domain o 97.13
cd08863141 SRPBCC_DUF1857 DUF1857, an uncharacterized ligand- 97.04
COG2867146 Oligoketide cyclase/lipid transport protein [Lipid 97.04
PTZ00220132 Activator of HSP-90 ATPase; Provisional 97.03
PF08982149 DUF1857: Domain of unknown function (DUF1857); Int 96.94
PF10698159 DUF2505: Protein of unknown function (DUF2505); In 96.19
cd08874205 START_STARD9-like C-terminal START domain of mamma 95.82
cd00177193 START Lipid-binding START domain of mammalian STAR 94.95
cd08913240 START_STARD14-like Lipid-binding START domain of m 94.57
cd08905209 START_STARD1-like Cholesterol-binding START domain 94.41
cd08914236 START_STARD15-like Lipid-binding START domain of m 94.27
cd08903208 START_STARD5-like Lipid-binding START domain of ma 93.97
cd08877215 START_2 Uncharacterized subgroup of the steroidoge 93.2
COG4276153 Uncharacterized conserved protein [Function unknow 91.99
cd08868208 START_STARD1_3_like Cholesterol-binding START doma 91.88
cd08906209 START_STARD3-like Cholesterol-binding START domain 91.41
cd08870209 START_STARD2_7-like Lipid-binding START domain of 91.28
cd08911207 START_STARD7-like Lipid-binding START domain of ma 88.69
cd08869197 START_RhoGAP C-terminal lipid-binding START domain 88.39
cd08871222 START_STARD10-like Lipid-binding START domain of m 87.35
cd08867206 START_STARD4_5_6-like Lipid-binding START domain o 82.77
smart00234206 START in StAR and phosphatidylcholine transfer pro 80.84
>PF00407 Bet_v_1: Pathogenesis-related protein Bet v I family; InterPro: IPR000916 Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms Back     alignment and domain information 
Probab=100.00  E-value=8.9e-42  Score=254.40  Aligned_cols=148  Identities=32%  Similarity=0.524  Sum_probs=135.5

Q ss_pred             CcceEEEEEEecCCHHHHhhhhhcCccccccccc-CCceeeEEEEcCCCCcc-eEEEEEecCCCCCceeEEEEEEEeecC
Q 031668            1 MKGQVSHELEVNVPAAQAWELYGTIKLAKLVEKE-SDTVEEIEIVEGDGGVG-TILHLKFTPGTPGFAGYKEKFIEIDNE   78 (155)
Q Consensus         1 m~~~~~~e~~i~apa~kvW~~~~~~d~~~~~p~~-P~~v~s~~~~eGdg~~G-siR~~~~~~g~~~~~~~kErl~~iD~~   78 (155)
                      +.++++.|+++++||+++|++++  +.++++|++ |++|++++++||||++| |||.|+|..+ ++...+|||++.+|++
T Consensus         2 ~~~~~~~E~~~~~~a~k~~ka~~--~~~~llpki~P~~i~sve~~eGdgg~gGSIk~~~f~~~-~~~~~~Kekve~~D~~   78 (151)
T PF00407_consen    2 GVGKLEVEVEVKVSADKLWKAFK--SSPHLLPKILPHVIKSVEVVEGDGGPGGSIKKWTFGPG-GPFKYVKEKVEAIDEE   78 (151)
T ss_dssp             CEEEEEEEEEESS-HHHHHHHHT--THHHHHHHHSTTTEEEEEEEESSSSTTT-EEEEEEETT-SSEEEEEEEEEEEETT
T ss_pred             CcEEEEEEEEecCCHHHHHHHHh--cCccchhhhChhhceeEEEEccCCCCCCeEEEEEecCC-CCcceeEEEEEeecCC
Confidence            36889999999999999999998  688999999 99999999999998877 9999999998 7889999999999999


Q ss_pred             CCeEEEEEEeCCccCcCeeEEEEEEEEEeeCCCceEEEEEEEEEEcCCcccCCcchhHHHHHHHHHHHHHHHhhC
Q 031668           79 RRVKVTDAVEGGYLDVGFTLFRVIFEIIEKGSDSCIIRSIIEYELKEEAAANASFVSTDAVAKIAEMAKNYLLNN  153 (155)
Q Consensus        79 ~~~~~Y~v~eg~~~~~~~~~y~~t~~v~~~~~g~s~v~W~~~y~~~~~~~~~~~~~~~~~~~~~~k~~e~~l~~~  153 (155)
                      +|+++|+++||+++. .|++|.++++++|+++|+|+++|+++|++.+++. +++..+++++..|+|+||+||++|
T Consensus        79 ~~~~~y~viEGd~l~-~~~~~~~~~~~~~~~~g~~v~k~t~~Ye~~~~~~-~~p~~~~~~~~~~~K~ieayLlan  151 (151)
T PF00407_consen   79 NKTITYTVIEGDVLG-DYKSFKSTIQKIPKGDGGCVVKWTIEYEKKGEDV-PPPEKYLDFAVGMFKAIEAYLLAN  151 (151)
T ss_dssp             TTEEEEEEEEETTGT-TTEEEEEEEEEEEETTSCEEEEEEEEEEESSTSC-HHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             CcEEEEEEEeccccc-cEEEEEEEEEecCCCCCceEEEEEEEEEecCCCC-CCcHHHHHHHHHHHHHHHHHHhcC
Confidence            999999999999987 6999999999999999999999999999998864 333358899999999999999997

A nomenclature system has been established for antigens (allergens) that cause IgE-mediated atopic allergies in humans [WHO/IUIS Allergen Nomenclature Subcommittee King T.P., Hoffmann D., Loewenstein H., Marsh D.G., Platts-Mills T.A.E., Thomas W. Bull. World Health Organ. 72:797-806(1994)]. This nomenclature system is defined by a designation that is composed of the first three letters of the genus; a space; the first letter of the species name; a space and an arabic number. In the event that two species names have identical designations, they are discriminated from one another by adding one or more letters (as necessary) to each species designation. The allergens in this family include allergens with the following designations: Aln g 1, Api g 1, Bet v 1, Car b 1, Cor a 1, Dau c 1, Mal d 1 and Pru a 1. Trees within the order Fagales possess particularly potent allergens, e.g. Bet v1, the major White Birch (Betula verrucosa) pollen antigen. Bet v1 is the main cause of type I allergies observed in early spring. Type I, or immunoglobulin E-mediated (IgE-mediated) allergies affect 1 in 5 people in Europe and North America. Commonly-observed symptoms are hay fever, dermatitis, asthma and, in severe cases, anaphylactic shock. First contact with these allergens results in sensitisation; subsequent contact produces a cross-linking reaction of IgE on mast cells and concomitant release of histamine. The inevitable symptoms of an allergic reaction ensue. Recent NMR analysis [] has confirmed earlier predictions of the protein structure and site of the major T-cell epitope []. The Bet v1 protein comprises 6 anti-parallel beta-strands and 3 alpha-helices. Four of the strands dominate the global fold, and 2 of the helices form a C-terminal amphipathic helical motif. This motif is believed to be the T-cell epitope. Other proteins belonging to this family include the major pollen allergens: Aln g I from Alnus glutinosa (Alder); Api G I from Apium graveolens (Celery); Car b I from Carpinus betulus (European hornbeam); Cor a I from Corylus avellana (European hazel); Mal d I from Malus domestica (Apple). The motif is also found in: the wound-induced protein AoPR1 from Asparagus officinalis (Garden asparagus); pathogenesis-related proteins from Phaseolus vulgaris (Kidney bean) and Petroselinum crispum (Parsley) (PR1-1 and PR1-3); the disease resistance response proteins, STH-2 and STH-21, from Solanum tuberosum (Potato) and pI49, pI176 and DRRG49-C from Pisum sativum (Garden pea); the P. sativum abscisic acid-responsive proteins ABR17 and ABR18; and the stress-induced protein SAM22 from Glycine max (Soybean). ; GO: 0006952 defense response, 0009607 response to biotic stimulus; PDB: 1IFV_A 4A8V_A 4A8U_A 2K7H_A 2QIM_A 3E85_A 1H2O_A 1E09_A 1QMR_A 1FSK_D ....
>cd07816 Bet_v1-like Ligand-binding bet_v_1 domain of major pollen allergen of white birch (Betula verrucosa), Bet v 1, and related proteins Back     alignment and domain information
>cd07821 PYR_PYL_RCAR_like Pyrabactin resistance 1 (PYR1), PYR1-like (PYL), regulatory component of abscisic acid receptors (RCARs), and related proteins Back     alignment and domain information
>PF10604 Polyketide_cyc2: Polyketide cyclase / dehydrase and lipid transport; InterPro: IPR019587 This family contains polyketide cylcases/dehydrases which are enzymes involved in polyketide synthesis Back     alignment and domain information
>cd08866 SRPBCC_11 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd08861 OtcD1_ARO-CYC_like N-terminal and C-terminal aromatase/cyclase domains of Streptomyces rimosus OtcD1 and related domains Back     alignment and domain information
>cd08865 SRPBCC_10 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd07819 SRPBCC_2 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd07813 COQ10p_like Coenzyme Q-binding protein COQ10p and similar proteins Back     alignment and domain information
>cd07822 SRPBCC_4 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd08862 SRPBCC_Smu440-like Ligand-binding SRPBCC domain of Streptococcus mutans Smu Back     alignment and domain information
>cd07825 SRPBCC_7 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd07812 SRPBCC START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SRPBCC) ligand-binding domain superfamily Back     alignment and domain information
>cd07814 SRPBCC_CalC_Aha1-like Putative hydrophobic ligand-binding SRPBCC domain of Micromonospora echinospora CalC, human Aha1, and related proteins Back     alignment and domain information
>cd07818 SRPBCC_1 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd08860 TcmN_ARO-CYC_like N-terminal aromatase/cyclase domain of the multifunctional protein tetracenomycin (TcmN) and related domains Back     alignment and domain information
>cd05018 CoxG Carbon monoxide dehydrogenase subunit G (CoxG) Back     alignment and domain information
>cd07824 SRPBCC_6 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd07820 SRPBCC_3 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd07817 SRPBCC_8 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>PF03364 Polyketide_cyc: Polyketide cyclase / dehydrase and lipid transport; InterPro: IPR005031 Members of this family of enzymes from Streptomyces spp Back     alignment and domain information
>cd07823 SRPBCC_5 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>PRK10724 hypothetical protein; Provisional Back     alignment and domain information
>COG3427 Carbon monoxide dehydrogenase subunit G, CoxG [Energy production and conversion] Back     alignment and domain information
>cd07826 SRPBCC_CalC_Aha1-like_9 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>cd08894 SRPBCC_CalC_Aha1-like_1 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>PF06240 COXG: Carbon monoxide dehydrogenase subunit G (CoxG); InterPro: IPR010419 The CO dehydrogenase structural genes coxMSL are flanked by nine accessory genes arranged as the cox gene cluster Back     alignment and domain information
>cd08898 SRPBCC_CalC_Aha1-like_5 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>cd08900 SRPBCC_CalC_Aha1-like_7 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>cd08896 SRPBCC_CalC_Aha1-like_3 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>cd08895 SRPBCC_CalC_Aha1-like_2 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>cd08899 SRPBCC_CalC_Aha1-like_6 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>cd08897 SRPBCC_CalC_Aha1-like_4 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>cd08891 SRPBCC_CalC Ligand-binding SRPBCC domain of Micromonospora echinospora CalC and related proteins Back     alignment and domain information
>cd08893 SRPBCC_CalC_Aha1-like_GntR-HTH Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins; some contain an N-terminal GntR family winged HTH DNA-binding domain Back     alignment and domain information
>COG5637 Predicted integral membrane protein [Function unknown] Back     alignment and domain information
>cd08876 START_1 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family Back     alignment and domain information
>cd08901 SRPBCC_CalC_Aha1-like_8 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>COG3832 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08327 AHSA1: Activator of Hsp90 ATPase homolog 1-like protein; InterPro: IPR013538 This family includes eukaryotic, prokaryotic and archaeal proteins that bear similarity to a C-terminal region of human activator of 90 kDa heat shock protein ATPase homologue 1 (AHSA1/p38, O95433 from SWISSPROT) Back     alignment and domain information
>cd08892 SRPBCC_Aha1 Putative hydrophobic ligand-binding SRPBCC domain of the Hsp90 co-chaperone Aha1 and related proteins Back     alignment and domain information
>cd08873 START_STARD14_15-like Lipid-binding START domain of mammalian STARDT14, -15, and related proteins Back     alignment and domain information
>cd08863 SRPBCC_DUF1857 DUF1857, an uncharacterized ligand-binding domain of the SRPBCC domain superfamily Back     alignment and domain information
>COG2867 Oligoketide cyclase/lipid transport protein [Lipid metabolism] Back     alignment and domain information
>PTZ00220 Activator of HSP-90 ATPase; Provisional Back     alignment and domain information
>PF08982 DUF1857: Domain of unknown function (DUF1857); InterPro: IPR015075 This protein has no known function Back     alignment and domain information
>PF10698 DUF2505: Protein of unknown function (DUF2505); InterPro: IPR019639 This entry represents proteins found Actinobacteria and Proteobacteria Back     alignment and domain information
>cd08874 START_STARD9-like C-terminal START domain of mammalian STARD9, and related domains; lipid binding Back     alignment and domain information
>cd00177 START Lipid-binding START domain of mammalian STARD1-STARD15 and related proteins Back     alignment and domain information
>cd08913 START_STARD14-like Lipid-binding START domain of mammalian STARDT14 and related proteins Back     alignment and domain information
>cd08905 START_STARD1-like Cholesterol-binding START domain of mammalian STARD1 and related proteins Back     alignment and domain information
>cd08914 START_STARD15-like Lipid-binding START domain of mammalian STARD15 and related proteins Back     alignment and domain information
>cd08903 START_STARD5-like Lipid-binding START domain of mammalian STARD5 and related proteins Back     alignment and domain information
>cd08877 START_2 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family Back     alignment and domain information
>COG4276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd08868 START_STARD1_3_like Cholesterol-binding START domain of mammalian STARD1, -3 and related proteins Back     alignment and domain information
>cd08906 START_STARD3-like Cholesterol-binding START domain of mammalian STARD3 and related proteins Back     alignment and domain information
>cd08870 START_STARD2_7-like Lipid-binding START domain of mammalian STARD2, -7, and related proteins Back     alignment and domain information
>cd08911 START_STARD7-like Lipid-binding START domain of mammalian STARD7 and related proteins Back     alignment and domain information
>cd08869 START_RhoGAP C-terminal lipid-binding START domain of mammalian STARD8, -12, -13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain Back     alignment and domain information
>cd08871 START_STARD10-like Lipid-binding START domain of mammalian STARD10 and related proteins Back     alignment and domain information
>cd08867 START_STARD4_5_6-like Lipid-binding START domain of mammalian STARD4, -5, -6, and related proteins Back     alignment and domain information
>smart00234 START in StAR and phosphatidylcholine transfer protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query155
2vne_A201 The X-Ray Structure Of Norcoclaurine Synthase From 2e-15
>pdb|2VNE|A Chain A, The X-Ray Structure Of Norcoclaurine Synthase From Thalictrum Flavum Length = 201 Back     alignment and structure 
Iteration: 1

 Score = 77.8 bits (190), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 70/153 (45%), Gaps = 4/153 (2%)
Query: 5   VSHELEVNVPAAQAWELYGTIKLAKLVEKESXXXXXXXXXXXXXXXXXXLHLKFTPGTPG 64
           + HELEV   A   W +Y    LAK +                      L   F PG   
Sbjct: 31  IHHELEVAASADDIWTVYSWPGLAKHLPDLLPGAFEKLEIIGDGGVGTILDXTFVPGE-- 88
Query: 65  FAG-YKEKFIEIDNERRVKVTDAVEGGYLDVGFTLFRVIFEIIEKGSDSCIIRSIIEYEL 123
           F   YKEKFI +DNE R+K    +EGGYLD+G T +     ++  G DSC+I+S  EY +
Sbjct: 89  FPHEYKEKFILVDNEHRLKKVQXIEGGYLDLGVTYYXDTIHVVPTGKDSCVIKSSTEYHV 148
Query: 124 KEE-AAANASFVSTDAVAKIAEMAKNYLLNNKA 155
           K E        ++T  +A  A+     +L +K+
Sbjct: 149 KPEFVKIVEPLITTGPLAAXADAISKLVLEHKS 181

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query155
2vq5_A201 S-norcoclaurine synthase; lyase, S- norcoclaurine 1e-32
2flh_A155 Cytokinin-specific binding protein; zeatin, pathog 4e-30
1e09_A159 PRU AV 1; allergen, major cherry allergen, pathoge 1e-22
4a8u_A159 Major pollen allergen BET V 1-J; PR-10 protein; 1. 1e-21
2i9y_A166 Major latex protein-like protein 28 or MLP-like pr 2e-21
1icx_A155 Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, 2e-20
1tw0_A157 Pathogenesis-related class 10 protein SPE-16; seve 9e-20
2qim_A158 PR10.2B; trans-zeatin, cytokinin, plant hormones, 1e-19
3ie5_A165 Phenolic oxidative coupling protein HYP-1; hyperic 2e-19
3rws_A168 MTN13 protein; zeatin, cytokinin, hormone, lucerne 3e-19
2vjg_A154 Major allergen DAU C 1; major carrot allergen, pat 4e-19
3kl1_A190 PYL2, putative uncharacterized protein AT2G26040; 2e-14
2le1_A151 Uncharacterized protein; structural genomics, nort 1e-06
>2vq5_A S-norcoclaurine synthase; lyase, S- norcoclaurine biosynthesis, dopamine, hydroxybenzaldehyde; HET: MSE LDP HBA; 2.09A {Thalictrum flavum} PDB: 2vne_A* Length = 201 Back     alignment and structure
 Score =  113 bits (285), Expect = 1e-32
 Identities = 58/156 (37%), Positives = 82/156 (52%), Gaps = 2/156 (1%)

Query: 1   MKGQVSHELEVNVPAAQAWELYGTIKLAKLVEKESDTVEEIEIVEGDGGVGTILHLKFTP 60
           +   + HELEV   A   W +Y    LAK +        E   + GDGGVGTIL + F P
Sbjct: 27  VTKVIHHELEVAASADDIWTVYSWPGLAKHLPDLLPGAFEKLEIIGDGGVGTILDMTFVP 86

Query: 61  GTPGFAGYKEKFIEIDNERRVKVTDAVEGGYLDVGFTLFRVIFEIIEKGSDSCIIRSIIE 120
           G      YKEKFI +DNE R+K    +EGGYLD+G T +     ++  G DSC+I+S  E
Sbjct: 87  GEF-PHEYKEKFILVDNEHRLKKVQMIEGGYLDLGVTYYMDTIHVVPTGKDSCVIKSSTE 145

Query: 121 YELKEEAAA-NASFVSTDAVAKIAEMAKNYLLNNKA 155
           Y +K E        ++T  +A +A+     +L +K+
Sbjct: 146 YHVKPEFVKIVEPLITTGPLAAMADAISKLVLEHKS 181
>2flh_A Cytokinin-specific binding protein; zeatin, pathogenesis-related proteins, multiple- ligand binding, plant protein; HET: ZEA; 1.20A {Vigna radiata} PDB: 3c0v_A* Length = 155 Back     alignment and structure
>1e09_A PRU AV 1; allergen, major cherry allergen, pathogenesis-related protein, heteronuclear structure; NMR {Prunus avium} SCOP: d.129.3.1 PDB: 1h2o_A 2lpx_A Length = 159 Back     alignment and structure
>4a8u_A Major pollen allergen BET V 1-J; PR-10 protein; 1.16A {Betula pendula} PDB: 4a8v_A* 4a87_A* 4a81_A* 4a80_A* 4a83_A* 4a86_A* 4a85_A* 4a88_A 4a8g_A* 1b6f_A 1btv_A 1bv1_A 1fsk_A 4a84_A* 1llt_A 1fm4_A* 3k78_A 1qmr_A Length = 159 Back     alignment and structure
>2i9y_A Major latex protein-like protein 28 or MLP-like protein 28; AT1G70830, BET V1-like, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>1icx_A Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, C-terminal helix, allergen; 1.95A {Lupinus luteus} SCOP: d.129.3.1 PDB: 1ifv_A Length = 155 Back     alignment and structure
>1tw0_A Pathogenesis-related class 10 protein SPE-16; seven antiparallel beta-sheet, plant protein; 2.20A {Pachyrhizus erosus} SCOP: d.129.3.1 PDB: 1txc_A* Length = 157 Back     alignment and structure
>2qim_A PR10.2B; trans-zeatin, cytokinin, plant hormones, plant protein, PR-1 protein, pathogenesis-related protein, allergen; HET: ZEA; 1.35A {Lupinus luteus} PDB: 3e85_A* 1xdf_A* 2k7h_A Length = 158 Back     alignment and structure
>3ie5_A Phenolic oxidative coupling protein HYP-1; hypericin, ST JOHN'S WORT, depression, allergy, PR-10 protein, cytokinin, plant hormones; HET: PGE PG4 PE8 1PE; 1.69A {Hypericum perforatum} Length = 165 Back     alignment and structure
>3kl1_A PYL2, putative uncharacterized protein AT2G26040; abscisic acid receptor, crystal, high resolution, PP2C, HORM receptor; 1.55A {Arabidopsis thaliana} PDB: 3kdi_A* 3kdh_A 3nr4_A* 3ns2_A* 3nj0_A* 3nj1_A* 3nmh_A* 3kaz_A 3kb0_A* 3kb3_A* 3ujl_A* 3nmp_A* 3nmt_A* 3nmv_A* Length = 190 Back     alignment and structure
>2le1_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, unknown function; NMR {Thermobifida fusca} Length = 151 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query155
4a8u_A159 Major pollen allergen BET V 1-J; PR-10 protein; 1. 100.0
3ie5_A165 Phenolic oxidative coupling protein HYP-1; hyperic 100.0
2vjg_A154 Major allergen DAU C 1; major carrot allergen, pat 100.0
2flh_A155 Cytokinin-specific binding protein; zeatin, pathog 100.0
2wql_A154 Major allergen DAU C 1; pathogenesis-related prote 100.0
3rws_A168 MTN13 protein; zeatin, cytokinin, hormone, lucerne 100.0
2vq5_A201 S-norcoclaurine synthase; lyase, S- norcoclaurine 100.0
1e09_A159 PRU AV 1; allergen, major cherry allergen, pathoge 100.0
1tw0_A157 Pathogenesis-related class 10 protein SPE-16; seve 100.0
2qim_A158 PR10.2B; trans-zeatin, cytokinin, plant hormones, 100.0
1icx_A155 Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, 100.0
2i9y_A166 Major latex protein-like protein 28 or MLP-like pr 100.0
3rt2_A183 Abscisic acid receptor PYL10; ABA-independent PP2C 99.97
3kl1_A190 PYL2, putative uncharacterized protein AT2G26040; 99.97
1vjh_A122 BET V I allergen family; structural genomics, cent 99.97
3jrs_A208 PYL1, putative uncharacterized protein AT5G46790; 99.97
3oqu_A205 Abscisic acid receptor PYL9; RCAR1, hormone recept 99.97
3k3k_A211 Abscisic acid receptor PYR1; ABA receptor, plant h 99.97
3f08_A146 Uncharacterized protein Q6HG14; NESG Q6HG14_bachk 99.96
3p51_A160 Uncharacterized protein; structural genomics, PSI- 99.96
3oji_A189 Abscisic acid receptor PYL3; crystal, PP2C, pyraba 99.96
3qrz_A223 Abscisic acid receptor PYL5; crystal, hormone rece 99.95
2le1_A151 Uncharacterized protein; structural genomics, nort 99.93
3tl1_A159 WHIE ORF VI, polyketide cyclase; helix-GRIP fold, 99.65
3tvq_A169 Multifunctional cyclase-dehydratase-3-O-methyl TR 99.63
3ijt_A155 SMU.440, putative uncharacterized protein; hypothe 99.6
2d4r_A147 Hypothetical protein TTHA0849; start domain, struc 99.56
3tfz_A172 Cyclase; helix-GRIP, BET V1-like superfamily, bios 99.56
2pcs_A162 Conserved protein; structural genomics, unknown fu 99.33
2ns9_A157 Hypothetical protein APE2225; uncharacterized cons 99.27
1t17_A148 Conserved hypothetical protein; beta-alpha-beta-BE 99.26
3ggn_A155 Uncharacterized protein DR_A0006; structural genom 99.15
1z94_A147 Conserved hypothetical protein; NESG, CV1439, stru 99.02
3p9v_A161 Uncharacterized protein; structural genomics, PSI- 99.02
1xuv_A178 Hypothetical protein MM0500; alpha-beta protein, n 98.85
2il5_A171 Hypothetical protein; structural genomics, APC2365 98.85
1xn6_A143 Hypothetical protein BC4709; structural genomics, 98.82
2leq_A146 Uncharacterized protein; start domains, structural 98.77
2ldk_A172 Uncharacterized protein; structural genomics, nort 98.73
2lcg_A142 Uncharacterized protein; start domain, structural 98.7
3pu2_A164 Uncharacterized protein; SRPBCC superfamily, PSI-b 98.66
3put_A166 Hypothetical conserved protein; structural genomic 98.66
3rd6_A161 MLL3558 protein; structural genomics, PSI-biology, 98.64
3q64_A162 MLL3774 protein; structural genomics, PSI-biology, 98.61
3uid_A168 Putative uncharacterized protein; SRPBCC superfami 98.56
1xfs_A178 NC_840354, conserved hypothetical protein; structu 98.55
2l8o_A144 Uncharacterized protein; mixed alpha-beta protein, 98.53
2lf2_A175 Uncharacterized protein; NESG, structural genomics 98.51
3eli_A152 AHSA1, AHA1 domain protein; alpha-beta protein, st 98.47
3q6a_A135 Uncharacterized protein; structural genomics, PSI- 98.47
2lgh_A144 Uncharacterized protein; AHSA1, start domain, COG3 98.45
2l9p_A164 Uncharacterized protein; structural genomics, nort 98.43
2lak_A160 AHSA1-like protein RHE_CH02687; NESG, structural g 98.42
1xn5_A146 BH1534 unknown conserved protein; structural genom 98.41
3q63_A151 MLL2253 protein; structural genomics, PSI-biology, 98.28
2nn5_A184 Hypothetical protein EF_2215; structural genomics, 98.16
2kew_A152 Uncharacterized protein YNDB; start domain, resona 98.14
3qsz_A189 STAR-related lipid transfer protein; structural ge 97.99
3ni8_A158 PFC0360W protein; heat shock, malaria, ATPase, str 97.85
2k5g_A191 Uncharacterized protein; structural genomiccs, pro 97.83
2qpv_A156 Uncharacterized protein ATU1531; structural genomi 97.82
4fpw_A181 CALU16; structural genomics, PSI-biology, northeas 97.8
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 97.71
1x53_A145 Activator of 90 kDa heat shock protein ATPase homo 97.64
1ln1_A214 PC-TP, phosphatidylcholine transfer protein; start 97.58
1zxf_A155 CALC; SELF-sacrificing resistance protein, structu 97.26
2luz_A192 CALU16; structural genomics, northeast structural 97.18
2ffs_A157 Hypothetical protein PA1206; 7-stranded beta sheet 96.99
2lio_A136 Uncharacterized protein; structural genomics, nort 96.98
3p0l_A221 Steroidogenic acute regulatory protein, mitochond; 94.49
1jss_A224 Stard4, cholesterol-regulated start protein 4; sta 94.25
1em2_A229 MLN64 protein; beta barrel, lipid binding protein; 93.69
3fo5_A258 Thioesterase, adipose associated, isoform BFIT2; o 92.33
2pso_A237 STAR-related lipid transfer protein 13; alpha and 86.58
2r55_A231 STAR-related lipid transfer protein 5; alpha and b 83.93
2e3n_A255 Lipid-transfer protein CERT; ceramide transfer, li 80.32
>4a8u_A Major pollen allergen BET V 1-J; PR-10 protein; 1.16A {Betula pendula} PDB: 4a8v_A* 4a87_A* 4a81_A* 4a80_A* 4a83_A* 4a86_A* 4a85_A* 4a88_A 4a8g_A* 1b6f_A 1btv_A 1bv1_A 1fsk_A 4a84_A* 1llt_A 1fm4_A* 3k78_A 1qmr_A Back     alignment and structure
Probab=100.00  E-value=1.3e-45  Score=276.04  Aligned_cols=150  Identities=21%  Similarity=0.312  Sum_probs=138.3

Q ss_pred             ceEEEEEEecCCHHHHhhhh-hcCccccccccc-CCceeeEEEEcCCCCcceEEEEEecCCCCCceeEEEEEEEeecCCC
Q 031668            3 GQVSHELEVNVPAAQAWELY-GTIKLAKLVEKE-SDTVEEIEIVEGDGGVGTILHLKFTPGTPGFAGYKEKFIEIDNERR   80 (155)
Q Consensus         3 ~~~~~e~~i~apa~kvW~~~-~~~d~~~~~p~~-P~~v~s~~~~eGdg~~GsiR~~~~~~g~~~~~~~kErl~~iD~~~~   80 (155)
                      -+++.|++|++||++||+++ +  ||++++|+| |++|++|+++||||++|+||+|+|..| ++...+||||+++|+++|
T Consensus         3 ~~~~~ei~i~a~a~kvw~~~~~--d~~~l~pk~~P~~i~s~e~~eGdgg~Gsir~~~~~~g-~~~~~~kErl~~iD~~~~   79 (159)
T 4a8u_A            3 FNYETEATSVIPAARLFKAFIL--DGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEG-FPFKYVKDRVDEVDHTNF   79 (159)
T ss_dssp             EEEEEEEEESSCHHHHHHHHTT--THHHHHHHHCTTTCCEEEEEECSSSTTCEEEEECCTT-SSCSEEEEEEEEEETTTT
T ss_pred             EEEEEEEEecCCHHHHHHHHhc--CccccchhhCchhccEEEEEcCCCCCceEEEEEEecC-CCccEEEEEEEEEccccC
Confidence            36889999999999999999 7  999989999 999999999999999999999999988 778899999999999999


Q ss_pred             eEEEEEEeCCccCcCeeEEEEEEEEEeeCCCceEEEEEEEEEEcCCcccCCcc--hhHHHHHHHHHHHHHHHhhCCC
Q 031668           81 VKVTDAVEGGYLDVGFTLFRVIFEIIEKGSDSCIIRSIIEYELKEEAAANASF--VSTDAVAKIAEMAKNYLLNNKA  155 (155)
Q Consensus        81 ~~~Y~v~eg~~~~~~~~~y~~t~~v~~~~~g~s~v~W~~~y~~~~~~~~~~~~--~~~~~~~~~~k~~e~~l~~~~~  155 (155)
                      +|+|+++||+++..+|++|+++++|+|.++|+|+++|+++|++.++..++++.  .+++++.+|+|+||+||++||+
T Consensus        80 ~~~y~iiegd~l~~~~~~y~~ti~v~p~~~ggs~v~wt~~y~~~~~~~~~~~~~k~~~~~~~~~~k~ie~yll~np~  156 (159)
T 4a8u_A           80 KYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNKYHTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSD  156 (159)
T ss_dssp             EEEEEEEEETTCBTTEEEEEEEEEEEECTTSCEEEEEEEEEEESSSCCC-CHHHHHHHHHHHHHHHHHHHHHHHCTT
T ss_pred             EEEEEEeeCCCCccceEEEEEEEEEEECCCCceEEEEEEEEEECCCCcCCHHHHHHHHHHHHHHHHHHHHHHhhChh
Confidence            99999999998866799999999999998889999999999999987655553  2689999999999999999995
>3ie5_A Phenolic oxidative coupling protein HYP-1; hypericin, ST JOHN'S WORT, depression, allergy, PR-10 protein, cytokinin, plant hormones; HET: PGE PG4 PE8 1PE; 1.69A {Hypericum perforatum} SCOP: d.129.3.0 Back     alignment and structure
>2flh_A Cytokinin-specific binding protein; zeatin, pathogenesis-related proteins, multiple- ligand binding, plant protein; HET: ZEA; 1.20A {Vigna radiata} PDB: 3c0v_A* Back     alignment and structure
>2wql_A Major allergen DAU C 1; pathogenesis-related protein, plant defense; HET: P4C; 2.70A {Daucus carota} PDB: 2bk0_A Back     alignment and structure
>2vq5_A S-norcoclaurine synthase; lyase, S- norcoclaurine biosynthesis, dopamine, hydroxybenzaldehyde; HET: MSE LDP HBA; 2.09A {Thalictrum flavum} PDB: 2vne_A* Back     alignment and structure
>1e09_A PRU AV 1; allergen, major cherry allergen, pathogenesis-related protein, heteronuclear structure; NMR {Prunus avium} SCOP: d.129.3.1 PDB: 1h2o_A 2lpx_A Back     alignment and structure
>1tw0_A Pathogenesis-related class 10 protein SPE-16; seven antiparallel beta-sheet, plant protein; 2.20A {Pachyrhizus erosus} SCOP: d.129.3.1 PDB: 1txc_A* Back     alignment and structure
>2qim_A PR10.2B; trans-zeatin, cytokinin, plant hormones, plant protein, PR-1 protein, pathogenesis-related protein, allergen; HET: ZEA; 1.35A {Lupinus luteus} PDB: 3e85_A* 1xdf_A* 2k7h_A Back     alignment and structure
>1icx_A Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, C-terminal helix, allergen; 1.95A {Lupinus luteus} SCOP: d.129.3.1 PDB: 1ifv_A Back     alignment and structure
>2i9y_A Major latex protein-like protein 28 or MLP-like protein 28; AT1G70830, BET V1-like, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>3rt2_A Abscisic acid receptor PYL10; ABA-independent PP2C inhibitor, PP2CS, hydrolase inhibitor; 1.50A {Arabidopsis thaliana} PDB: 3r6p_A* 3qtj_A* 3uqh_A 3rt0_C Back     alignment and structure
>3kl1_A PYL2, putative uncharacterized protein AT2G26040; abscisic acid receptor, crystal, high resolution, PP2C, HORM receptor; 1.55A {Arabidopsis thaliana} PDB: 3kdi_A* 3kdh_A 3nr4_A* 3ns2_A* 3nj0_A* 3nj1_A* 3nmh_A* 3kaz_A 3kb0_A* 3kb3_A* 3ujl_A* 3nmp_A* 3nmt_A* 3nmv_A* Back     alignment and structure
>1vjh_A BET V I allergen family; structural genomics, center for eukaryotic structural genomics, protein structure initiative, CESG, plant protein; 2.10A {Arabidopsis thaliana} SCOP: d.129.3.1 PDB: 2q3q_A Back     alignment and structure
>3jrs_A PYL1, putative uncharacterized protein AT5G46790; plant hormone receptor, abscisic acid, hormone recepto; HET: A8S; 2.05A {Arabidopsis thaliana} Back     alignment and structure
>3oqu_A Abscisic acid receptor PYL9; RCAR1, hormone receptor; HET: A8S; 2.68A {Arabidopsis thaliana} Back     alignment and structure
>3k3k_A Abscisic acid receptor PYR1; ABA receptor, plant hormone receptor, A sensor, drought tolerance, plant development; HET: A8S; 1.70A {Arabidopsis thaliana} PDB: 3njo_A* 3qn1_A* 3k90_A* 3zvu_A* 3jrq_B* 3kdj_A* 3nef_A* 3neg_A* 3nmn_A* 3kay_A* Back     alignment and structure
>3f08_A Uncharacterized protein Q6HG14; NESG Q6HG14_bachk Q6HG14 BUR153, structural genomics, PSI-2; 2.20A {Bacillus thuringiensis serovar konkukiorganism_taxid} SCOP: d.129.3.8 PDB: 3cnw_A Back     alignment and structure
>3p51_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 2.06A {Nitrosospira multiformis} Back     alignment and structure
>3oji_A Abscisic acid receptor PYL3; crystal, PP2C, pyrabactin, HOR receptor; HET: PYV; 1.84A {Arabidopsis thaliana} PDB: 4ds8_A* 3klx_A* 4dsb_A* 4dsc_A* Back     alignment and structure
>2le1_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, unknown function; NMR {Thermobifida fusca} Back     alignment and structure
>3tl1_A WHIE ORF VI, polyketide cyclase; helix-GRIP fold, polyketide C9-C14 aromatase/cyclase, linear beta-ketone intermediate; HET: JRO; 1.80A {Streptomyces coelicolor} PDB: 3tvr_A 2kf2_A Back     alignment and structure
>3tvq_A Multifunctional cyclase-dehydratase-3-O-methyl TR TCMN; tetracenomycin, aromatase, taxifolin, dihyroquercet helix-GRIP fold; HET: DQH; 1.67A {Streptomyces glaucescens} PDB: 2rer_A 2res_A 2rez_A Back     alignment and structure
>3ijt_A SMU.440, putative uncharacterized protein; hypothetical protein, unknown function; 2.38A {Streptococcus mutans} SCOP: d.129.3.9 PDB: 2b79_A Back     alignment and structure
>2d4r_A Hypothetical protein TTHA0849; start domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 2.40A {Thermus thermophilus} SCOP: d.129.3.6 Back     alignment and structure
>3tfz_A Cyclase; helix-GRIP, BET V1-like superfamily, biosynthetic protein; HET: CXS; 2.39A {Streptomyces SP} Back     alignment and structure
>2pcs_A Conserved protein; structural genomics, unknown function, ligand binding, PSI-2 structure initiative; HET: UNL; 2.40A {Geobacillus kaustophilus} SCOP: d.129.3.10 Back     alignment and structure
>2ns9_A Hypothetical protein APE2225; uncharacterized conserved protein, structural genomics, PSI, structure initiative; 1.80A {Aeropyrum pernix} SCOP: d.129.3.10 Back     alignment and structure
>1t17_A Conserved hypothetical protein; beta-alpha-beta-BETA-beta-BETA-beta-BETA-helix, structural G protein structure initiative, PSI, NESG; NMR {Caulobacter crescentus} SCOP: d.129.3.6 Back     alignment and structure
>3ggn_A Uncharacterized protein DR_A0006; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Deinococcus radiodurans R1} PDB: 2kcz_A Back     alignment and structure
>1z94_A Conserved hypothetical protein; NESG, CV1439, structural genomics, PSI structure initiative; 2.10A {Chromobacterium violaceum} SCOP: d.129.3.5 Back     alignment and structure
>3p9v_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.78A {Marinobacter aquaeolei} Back     alignment and structure
>1xuv_A Hypothetical protein MM0500; alpha-beta protein, northeast structural genomics consortium, NESG, structural genomics; 2.10A {Methanosarcina mazei GO1} SCOP: d.129.3.5 Back     alignment and structure
>2il5_A Hypothetical protein; structural genomics, APC23650, PSI-2, structure initiative; 2.30A {Staphylococcus aureus subsp} SCOP: d.129.3.5 Back     alignment and structure
>1xn6_A Hypothetical protein BC4709; structural genomics, protein structure initiative, PSI, NESG target protein BCR68, alpha + beta; NMR {Bacillus cereus} SCOP: d.129.3.5 Back     alignment and structure
>2leq_A Uncharacterized protein; start domains, structural genomics, PSI-biology, protein STR initiative; NMR {Cytophaga hutchinsonii} Back     alignment and structure
>2ldk_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Arthrobacter aurescens} Back     alignment and structure
>2lcg_A Uncharacterized protein; start domain, structural genomics, northeast structural GENO consortium, NESG, unknown function, AHSA1; NMR {Ralstonia metallidurans} Back     alignment and structure
>3pu2_A Uncharacterized protein; SRPBCC superfamily, PSI-biology, NESG, RHR263, structural GE protein structure initiative; HET: MSE; 2.61A {Rhodobacter sphaeroides} Back     alignment and structure
>3put_A Hypothetical conserved protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.83A {Rhizobium etli cfn 42} PDB: 3otl_A* Back     alignment and structure
>3rd6_A MLL3558 protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 2.80A {Mesorhizobium loti} Back     alignment and structure
>3q64_A MLL3774 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.50A {Mesorhizobium loti} Back     alignment and structure
>3uid_A Putative uncharacterized protein; SRPBCC superfamily, beta sandwich, function, structural genomics, TB structural genomics conso TBSGC; 1.57A {Mycobacterium smegmatis} SCOP: d.129.3.0 Back     alignment and structure
>1xfs_A NC_840354, conserved hypothetical protein; structural genomics, protein structure initiative, NESG, ALP protein, PSI; 1.70A {Nitrosomonas europaea} SCOP: d.129.3.5 Back     alignment and structure
>2l8o_A Uncharacterized protein; mixed alpha-beta protein, PSI-biology, structural genomics, structure initiative; NMR {Cytophaga hutchinsonii} Back     alignment and structure
>2lf2_A Uncharacterized protein; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics consortium; NMR {Cytophaga hutchinsonii} Back     alignment and structure
>3eli_A AHSA1, AHA1 domain protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} SCOP: d.129.3.5 Back     alignment and structure
>3q6a_A Uncharacterized protein; structural genomics, PSI-biology; 1.80A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>2lgh_A Uncharacterized protein; AHSA1, start domain, COG3832, PF08327, HSP90, heat shock, ST genomics, PSI-biology; NMR {Aeromonas hydrophila subsp} Back     alignment and structure
>2l9p_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Staphylococcus epidermidis} Back     alignment and structure
>2lak_A AHSA1-like protein RHE_CH02687; NESG, structural genomics, northeast structural genomics CON PSI-biology, structure genomics, unknown function; NMR {Rhizobium etli} Back     alignment and structure
>1xn5_A BH1534 unknown conserved protein; structural genomics, protein structure initiative, PSI, BACI halodurans protein BH1534, alpha + beta; NMR {Bacillus halodurans} SCOP: d.129.3.5 Back     alignment and structure
>3q63_A MLL2253 protein; structural genomics, PSI-biology, protein structure initiati alpha-beta protein, unknown, structure genomics; 2.00A {Mesorhizobium loti} Back     alignment and structure
>2nn5_A Hypothetical protein EF_2215; structural genomics, APC29336, PSI-2, structure initiative; HET: MSE; 1.45A {Enterococcus faecalis} SCOP: d.129.3.5 Back     alignment and structure
>2kew_A Uncharacterized protein YNDB; start domain, resonance assignments, lipid binding, structural genomics, unknown FU PSI-2; NMR {Bacillus subtilis subsp} PDB: 2kte_A Back     alignment and structure
>3qsz_A STAR-related lipid transfer protein; structural genomics, PSI-biology; 2.39A {Xanthomonas axonopodis PV} Back     alignment and structure
>3ni8_A PFC0360W protein; heat shock, malaria, ATPase, structural genomics consortium, unknown function; 2.50A {Plasmodium falciparum} Back     alignment and structure
>2k5g_A Uncharacterized protein; structural genomiccs, protein structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} SCOP: d.129.3.5 Back     alignment and structure
>2qpv_A Uncharacterized protein ATU1531; structural genomics, PSI protein structure initiative, midwest center for structural genomics; 2.35A {Agrobacterium tumefaciens str} SCOP: d.129.3.8 Back     alignment and structure
>4fpw_A CALU16; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 2.50A {Micromonospora echinospora} PDB: 2luz_A Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>1x53_A Activator of 90 kDa heat shock protein ATPase homolog 1; AHA1, HSP90,DUF704, C-terminal domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.129.3.5 Back     alignment and structure
>1ln1_A PC-TP, phosphatidylcholine transfer protein; start domain, lipid binding protein; HET: DLP; 2.40A {Homo sapiens} SCOP: d.129.3.2 PDB: 1ln2_A* 1ln3_A* Back     alignment and structure
>1zxf_A CALC; SELF-sacrificing resistance protein, structural genomics, PSI, protein structure initiative; NMR {Micromonospora echinospora} SCOP: d.129.3.5 PDB: 2gkc_A* 2gkd_A 2l65_A* Back     alignment and structure
>2luz_A CALU16; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Micromonospora echinospora} Back     alignment and structure
>2ffs_A Hypothetical protein PA1206; 7-stranded beta sheet, C-terminal helix, structural genomics protein structure initiative; HET: MSE; 2.50A {Pseudomonas aeruginosa} SCOP: d.129.3.7 Back     alignment and structure
>2lio_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3p0l_A Steroidogenic acute regulatory protein, mitochond; structural genomics consortium, SGC, start domain, cholester transport, cholesterol; 3.40A {Homo sapiens} Back     alignment and structure
>1jss_A Stard4, cholesterol-regulated start protein 4; start domain, structural genomics, PSI, protein structure initiative; 2.20A {Mus musculus} SCOP: d.129.3.2 Back     alignment and structure
>1em2_A MLN64 protein; beta barrel, lipid binding protein; HET: TAR; 2.20A {Homo sapiens} SCOP: d.129.3.2 Back     alignment and structure
>3fo5_A Thioesterase, adipose associated, isoform BFIT2; orthogonal bundle, consortium, lipid transport; HET: 1PE TCE; 2.00A {Homo sapiens} Back     alignment and structure
>2pso_A STAR-related lipid transfer protein 13; alpha and beta protein, lipid binding, helix swapping, struc genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} SCOP: d.129.3.2 Back     alignment and structure
>2r55_A STAR-related lipid transfer protein 5; alpha and beta protein, cholesterol binding, structural GENO structural genomics consortium, SGC; 2.50A {Homo sapiens} Back     alignment and structure
>2e3n_A Lipid-transfer protein CERT; ceramide transfer, lipid transport; HET: 6CM; 1.40A {Homo sapiens} PDB: 2e3m_A* 2e3o_A* 2e3p_A* 2e3q_A* 2e3r_A* 2e3s_A 2z9y_A* 3h3q_A* 3h3r_A* 3h3s_A* 3h3t_A* 2z9z_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 155
d1fm4a_159 d.129.3.1 (A:) Major tree pollen allergen {Europea 2e-21
d2bk0a1153 d.129.3.1 (A:2-154) Major allergen api g 1 {Celery 3e-21
d1xdfa1157 d.129.3.1 (A:1-157) Plant pathogenesis-related pro 1e-19
d1e09a_159 d.129.3.1 (A:) Major tree pollen allergen {Sweet c 1e-19
d1icxa_155 d.129.3.1 (A:) Plant pathogenesis-related protein 2e-17
d1txca1147 d.129.3.1 (A:1-147) Plant pathogenesis-related pro 9e-14
>d1fm4a_ d.129.3.1 (A:) Major tree pollen allergen {European white birch (Betula pendula), Bet v 1-l [TaxId: 3505]} Length = 159 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: TBP-like
superfamily: Bet v1-like
family: Pathogenesis-related protein 10 (PR10)-like
domain: Major tree pollen allergen
species: European white birch (Betula pendula), Bet v 1-l [TaxId: 3505]

 Score = 82.2 bits (203), Expect = 2e-21
 Identities = 34/155 (21%), Positives = 65/155 (41%), Gaps = 5/155 (3%)

Query: 3   GQVSHELEV--NVPAAQAWELYGTIKLAKLVEKESDTVEEIEIVEGDGGVGTILHLKFTP 60
           G  ++E E    +PAA+ ++ +       + +     +  +E +EG+GG GTI  + F  
Sbjct: 1   GVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFPE 60

Query: 61  GTPGFAGYKEKFIEIDNERRVKVTDAVEGGYLDVGFTLFRVIFEIIEKGSDSCIIRSIIE 120
           G P F   K++  E+D+         +EGG +           +I+      C+++   +
Sbjct: 61  GFP-FKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNK 119

Query: 121 YELKEEAAANASFV--STDAVAKIAEMAKNYLLNN 153
           Y  K      A  V  S +    +    ++YLL +
Sbjct: 120 YHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 154
>d2bk0a1 d.129.3.1 (A:2-154) Major allergen api g 1 {Celery (Apium graveolens) [TaxId: 4045]} Length = 153 Back     information, alignment and structure
>d1xdfa1 d.129.3.1 (A:1-157) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]} Length = 157 Back     information, alignment and structure
>d1e09a_ d.129.3.1 (A:) Major tree pollen allergen {Sweet cherry (Prunus avium), pru av 1 [TaxId: 42229]} Length = 159 Back     information, alignment and structure
>d1icxa_ d.129.3.1 (A:) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]} Length = 155 Back     information, alignment and structure
>d1txca1 d.129.3.1 (A:1-147) Plant pathogenesis-related protein PR10 {Jicama (Pachyrhizus erosus), SPE-16 [TaxId: 109171]} Length = 147 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query155
d1fm4a_159 Major tree pollen allergen {European white birch ( 100.0
d1e09a_159 Major tree pollen allergen {Sweet cherry (Prunus a 100.0
d1xdfa1157 Plant pathogenesis-related protein PR10 {Yellow lu 100.0
d2bk0a1153 Major allergen api g 1 {Celery (Apium graveolens) 100.0
d1icxa_155 Plant pathogenesis-related protein PR10 {Yellow lu 100.0
d1txca1147 Plant pathogenesis-related protein PR10 {Jicama (P 100.0
d1vjha_120 Hypothetical protein At1G24000 {Thale cress (Arabi 99.96
d3cnwa1138 Uncharacterized protein XoxI {Bacillus cereus [Tax 99.94
d2rera1155 Multifunctional enzyme TcmN, cyclase/aromatase dom 99.57
d2b79a1137 Hypothetical protein SMU440 {Streptococcus mutans 99.54
d2d4ra1146 Hypothetical protein TTHA0849 {Thermus thermophilu 99.51
d2ns9a1147 Hypothetical protein APE2225 {Aeropyrum pernix [Ta 99.35
d1xuva_163 Hypothetical protein MM0500 {Methanosarcina mazei 99.04
d2pcsa1147 Hypothetical protein GKP20 {Geobacillus kaustophil 98.99
d2qpva1133 Uncharacterized protein Atu1531 {Agrobacterium tum 98.93
d2il5a1164 Hypothetical protein SA2116 {Staphylococcus aureus 98.75
d1xfsa_165 Hypothetical protein NE0264 {Nitrosomonas europaea 98.67
d1t17a_148 Hypothetical protein CC1736 {Caulobacter crescentu 98.64
d1z94a1143 Hypothetical protein CV1439 {Chromobacterium viola 98.42
d3elia1143 Uncharacterized protein SPO3351 {Silicibacter pome 98.24
d1xn5a_138 Hypothetical protein BH1534 {Bacillus halodurans [ 98.06
d1xn6a_143 Hypothetical protein BC4709 {Bacillus cereus [TaxI 97.8
d2nn5a1160 Hypothetical protein EF2215 {Enterococcus faecalis 97.69
d1zxfa1155 Calicheamicin gene cluster protein CalC {Micromono 97.5
d2ffsa1151 Hypothetical protein PA1206 {Pseudomonas aeruginos 97.39
d1x53a1132 Activator of 90 kda heat shock protein ATPase homo 97.11
d2k5ga1183 Uncharacterized protein BPP1335 {Bordetella parape 97.08
d1jssa_199 Cholesterol-regulated Start protein 4 (Stard4). {M 96.39
d1ln1a_203 Phosphatidylcholine transfer protein {Human (Homo 94.19
d1em2a_214 Lipid transport domain of Mln64 {Human (Homo sapie 94.11
d2psoa1197 Star-related lipid transfer protein 13 {Human (Hom 85.06
>d1fm4a_ d.129.3.1 (A:) Major tree pollen allergen {European white birch (Betula pendula), Bet v 1-l [TaxId: 3505]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: TBP-like
superfamily: Bet v1-like
family: Pathogenesis-related protein 10 (PR10)-like
domain: Major tree pollen allergen
species: European white birch (Betula pendula), Bet v 1-l [TaxId: 3505]

Probab=100.00  E-value=1.1e-44  Score=269.20  Aligned_cols=151  Identities=23%  Similarity=0.357  Sum_probs=138.8

Q ss_pred             ceEEEEEEecCCHHHHhhhhhcCccccccccc-CCceeeEEEEcCCCCcceEEEEEecCCCCCceeEEEEEEEeecCCCe
Q 031668            3 GQVSHELEVNVPAAQAWELYGTIKLAKLVEKE-SDTVEEIEIVEGDGGVGTILHLKFTPGTPGFAGYKEKFIEIDNERRV   81 (155)
Q Consensus         3 ~~~~~e~~i~apa~kvW~~~~~~d~~~~~p~~-P~~v~s~~~~eGdg~~GsiR~~~~~~g~~~~~~~kErl~~iD~~~~~   81 (155)
                      .+++.|+++++||+|+|+++ ..|+++++|+| |+++++|++++|||++||||.|+|..+ ++...+||||+++|+++|+
T Consensus         3 ~~~e~E~~~~v~a~k~~k~~-~~d~~~l~pk~~p~~i~~ie~~eGdg~~GsIr~~~~~~~-~~~~~~Kerve~iD~~~~~   80 (159)
T d1fm4a_           3 FNYETEATSVIPAARMFKAF-ILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFPEG-FPFKYVKDRVDEVDHTNFK   80 (159)
T ss_dssp             EEEEEEEEESSCHHHHHHHH-TTTHHHHHHHHCTTTCCEEEEEECSSSTTCEEEEECCTT-SSSSEEEEEEEEEETTTTE
T ss_pred             eEEEEEeeccCCHHHHHHHH-HhCcccccccccCcceEEEEEECCCCCCCCEEEEEecCC-CCceEEEEEEEEEcccccE
Confidence            35677888999999999987 35999999999 999999999999999999999999988 7889999999999999999


Q ss_pred             EEEEEEeCCccCcCeeEEEEEEEEEeeCCCceEEEEEEEEEEcCCcccCCcc--hhHHHHHHHHHHHHHHHhhCCC
Q 031668           82 KVTDAVEGGYLDVGFTLFRVIFEIIEKGSDSCIIRSIIEYELKEEAAANASF--VSTDAVAKIAEMAKNYLLNNKA  155 (155)
Q Consensus        82 ~~Y~v~eg~~~~~~~~~y~~t~~v~~~~~g~s~v~W~~~y~~~~~~~~~~~~--~~~~~~~~~~k~~e~~l~~~~~  155 (155)
                      ++|+++||+.+..+|++|+++++|+|+++|+|+++|+++|++.++.+.+++.  .+++.+.+|+|++|+||++||+
T Consensus        81 ~~y~viEGd~l~~~~~s~~~~~k~~~~~~gg~v~kwt~eYe~~~~~~~~~e~~k~~ke~~~~~~K~iE~YLlanp~  156 (159)
T d1fm4a_          81 YNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSD  156 (159)
T ss_dssp             EEEEEEEBTTBTTTEEEEEEEEEEEECTTSCEEEEEEEEEEESTTCCCCTTTTHHHHHHHHHHHHHHHHHHHHCTT
T ss_pred             EEEEEEeccccccceEEEEEEEEEecCCCCceEEEEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHhhChh
Confidence            9999999998777899999999999999999999999999999987665554  4689999999999999999996
>d1e09a_ d.129.3.1 (A:) Major tree pollen allergen {Sweet cherry (Prunus avium), pru av 1 [TaxId: 42229]} Back     information, alignment and structure
>d1xdfa1 d.129.3.1 (A:1-157) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]} Back     information, alignment and structure
>d2bk0a1 d.129.3.1 (A:2-154) Major allergen api g 1 {Celery (Apium graveolens) [TaxId: 4045]} Back     information, alignment and structure
>d1icxa_ d.129.3.1 (A:) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]} Back     information, alignment and structure
>d1txca1 d.129.3.1 (A:1-147) Plant pathogenesis-related protein PR10 {Jicama (Pachyrhizus erosus), SPE-16 [TaxId: 109171]} Back     information, alignment and structure
>d1vjha_ d.129.3.1 (A:) Hypothetical protein At1G24000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3cnwa1 d.129.3.8 (A:3-140) Uncharacterized protein XoxI {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2rera1 d.129.3.6 (A:1-155) Multifunctional enzyme TcmN, cyclase/aromatase domain {Streptomyces glaucescens [TaxId: 1907]} Back     information, alignment and structure
>d2b79a1 d.129.3.9 (A:1-137) Hypothetical protein SMU440 {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2d4ra1 d.129.3.6 (A:2-147) Hypothetical protein TTHA0849 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ns9a1 d.129.3.10 (A:10-156) Hypothetical protein APE2225 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1xuva_ d.129.3.5 (A:) Hypothetical protein MM0500 {Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2pcsa1 d.129.3.10 (A:1-147) Hypothetical protein GKP20 {Geobacillus kaustophilus [TaxId: 1462]} Back     information, alignment and structure
>d2qpva1 d.129.3.8 (A:1-133) Uncharacterized protein Atu1531 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2il5a1 d.129.3.5 (A:5-168) Hypothetical protein SA2116 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xfsa_ d.129.3.5 (A:) Hypothetical protein NE0264 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1t17a_ d.129.3.6 (A:) Hypothetical protein CC1736 {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1z94a1 d.129.3.5 (A:2-144) Hypothetical protein CV1439 {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure
>d3elia1 d.129.3.5 (A:2-144) Uncharacterized protein SPO3351 {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d1xn5a_ d.129.3.5 (A:) Hypothetical protein BH1534 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1xn6a_ d.129.3.5 (A:) Hypothetical protein BC4709 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2nn5a1 d.129.3.5 (A:1-160) Hypothetical protein EF2215 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1zxfa1 d.129.3.5 (A:1-155) Calicheamicin gene cluster protein CalC {Micromonospora echinospora [TaxId: 1877]} Back     information, alignment and structure
>d2ffsa1 d.129.3.7 (A:1-151) Hypothetical protein PA1206 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1x53a1 d.129.3.5 (A:8-139) Activator of 90 kda heat shock protein ATPase homolog 1, AHSA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2k5ga1 d.129.3.5 (A:1-183) Uncharacterized protein BPP1335 {Bordetella parapertussis [TaxId: 519]} Back     information, alignment and structure
>d1jssa_ d.129.3.2 (A:) Cholesterol-regulated Start protein 4 (Stard4). {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ln1a_ d.129.3.2 (A:) Phosphatidylcholine transfer protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1em2a_ d.129.3.2 (A:) Lipid transport domain of Mln64 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2psoa1 d.129.3.2 (A:908-1104) Star-related lipid transfer protein 13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure