Citrus Sinensis ID: 031674

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-----
MNDTLSATQIYHFLRKWLIVHSDFLANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRMNLKGYMLGNPVTDDKIDQNSKIQFAYLNALITYEIYKSAKKNCKGDYVNVDPGNYLCKADLQNISAVRKGVTIILFICLLFLNTISSTPNYLTDA
ccHHHHHHHHHHHHHHHHHHccccccccEEEEccccccccHHHHHHHHHHHHHccccccccccEEEcccccccccccccHHHHHHHHcccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccc
cccHHHHHHHHHHHHHHHHHcccHccccEEEEEccccccHHHHHHHHHHHccccccccEEEEEEEEEEcccccccccccccEEcHccccEEcHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccEEEccccccccccccccccccc
MNDTLSATQIYHFLRKWLIVHSdflanplyiagdsysgkiVPIVVQEIsdgidaghkprmnlkgymlgnpvtddkidqnSKIQFAYLNALITYEIYKSAKknckgdyvnvdpgnylckaDLQNISAVRKGVTIILFICLLFLNtisstpnyltda
MNDTLSATQIYHFLRKWLIVHSDFLANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRMNLKGYMLGNPVTDDKIDQNSKIQFAYLNALITYEIYKSAKKNCKGDYVNVDPGNYLCKADLQNISAVRKGVTIILFICLLflntisstpnyltda
MNDTLSATQIYHFLRKWLIVHSDFLANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRMNLKGYMLGNPVTDDKIDQNSKIQFAYLNALITYEIYKSAKKNCKGDYVNVDPGNYLCKADLQNISAVRKGVTIILFICLLFLNTISSTPNYLTDA
******ATQIYHFLRKWLIVHSDFLANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRMNLKGYMLGNPVTDDKIDQNSKIQFAYLNALITYEIYKSAKKNCKGDYVNVDPGNYLCKADLQNISAVRKGVTIILFICLLFLNTISS********
MNDTLSATQIYHFLRKWLIVHSDFLANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRMNLKGYMLGNPVTDDKIDQNSKIQFAYLNALITYEIYKSAKKNCKGDYVNVDPGNYLCKADLQNISAVRKGVTIILFICLLFL*************
MNDTLSATQIYHFLRKWLIVHSDFLANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRMNLKGYMLGNPVTDDKIDQNSKIQFAYLNALITYEIYKSAKKNCKGDYVNVDPGNYLCKADLQNISAVRKGVTIILFICLLFLNTISSTPNYLTDA
MNDTLSATQIYHFLRKWLIVHSDFLANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRMNLKGYMLGNPVTDDKIDQNSKIQFAYLNALITYEIYKSAKKNCKGDYVNVDPGNYLCKADLQNISAVRKGVTIILFICLLFLNT***********
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNDTLSATQIYHFLRKWLIVHSDFLANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRMNLKGYMLGNPVTDDKIDQNSKIQFAYLNALITYEIYKSAKKNCKGDYVNVDPGNYLCKADLQNISAVRKGVTIILFICLLFLNTISSTPNYLTDA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query155 2.2.26 [Sep-21-2011]
Q9C7Z9 464 Serine carboxypeptidase-l yes no 0.935 0.312 0.449 3e-32
Q9C7D6 437 Serine carboxypeptidase-l no no 0.941 0.334 0.425 3e-31
Q9C7D4 435 Serine carboxypeptidase-l no no 0.748 0.266 0.525 9e-31
Q9CAU0 452 Serine carboxypeptidase-l no no 0.748 0.256 0.551 1e-30
Q9CAU3 441 Serine carboxypeptidase-l no no 0.748 0.263 0.543 2e-30
Q8VZU3 465 Serine carboxypeptidase-l no no 0.780 0.260 0.479 3e-30
Q9CAU2 438 Serine carboxypeptidase-l no no 0.929 0.328 0.456 2e-29
Q9CAU1 441 Serine carboxypeptidase-l no no 0.748 0.263 0.525 7e-29
O81009 435 Serine carboxypeptidase-l no no 0.748 0.266 0.517 1e-28
Q8RWJ6 441 Serine carboxypeptidase-l no no 0.748 0.263 0.525 1e-28
>sp|Q9C7Z9|SCP18_ARATH Serine carboxypeptidase-like 18 OS=Arabidopsis thaliana GN=SCPL18 PE=2 SV=2 Back     alignment and function desciption
 Score =  137 bits (344), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 67/149 (44%), Positives = 100/149 (67%), Gaps = 4/149 (2%)

Query: 2   NDTLSATQIYHFLRKWLIVHSDFLANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRMN 61
           +DT  A Q Y FL+KWL+ +  F++NP+Y+ GDSY+G +VP +VQ+IS G + G+KP++N
Sbjct: 147 SDTGEAKQTYEFLQKWLVENPQFVSNPIYVGGDSYAGIVVPAIVQQISIGNEHGYKPQIN 206

Query: 62  LKGYMLGNPVTDDKIDQNSKIQFAYLNALITYEIYKSAKKNCKGDYVNVDPGNYLCKADL 121
           LKGY+LGNP TD   D NSKI +A+   LI+ E+Y+S K+ C+G+YV VDP N  C   +
Sbjct: 207 LKGYILGNPSTDLDSDHNSKIPYAHRMGLISDELYESLKRTCQGNYVKVDPTNTKCLKLM 266

Query: 122 QN----ISAVRKGVTIILFICLLFLNTIS 146
           ++    +S + +G+ +I    L   N  S
Sbjct: 267 EDYGKCVSRINEGLILIALCDLASPNPYS 295
Probable carboxypeptidase.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 1EC: 6EC: .EC: -
>sp|Q9C7D6|SCP17_ARATH Serine carboxypeptidase-like 17 OS=Arabidopsis thaliana GN=SCPL17 PE=2 SV=1 Back     alignment and function description
>sp|Q9C7D4|SCP16_ARATH Serine carboxypeptidase-like 16 OS=Arabidopsis thaliana GN=SCPL16 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAU0|SCP6_ARATH Serine carboxypeptidase-like 6 OS=Arabidopsis thaliana GN=SCPL6 PE=2 SV=2 Back     alignment and function description
>sp|Q9CAU3|SCP2_ARATH Serine carboxypeptidase-like 2 OS=Arabidopsis thaliana GN=SCPL2 PE=2 SV=1 Back     alignment and function description
>sp|Q8VZU3|SCP19_ARATH Serine carboxypeptidase-like 19 OS=Arabidopsis thaliana GN=SCPL19 PE=1 SV=1 Back     alignment and function description
>sp|Q9CAU2|SCP5_ARATH Serine carboxypeptidase-like 5 OS=Arabidopsis thaliana GN=SCPL5 PE=2 SV=2 Back     alignment and function description
>sp|Q9CAU1|SCP3_ARATH Serine carboxypeptidase-like 3 OS=Arabidopsis thaliana GN=SCPL3 PE=2 SV=1 Back     alignment and function description
>sp|O81009|SCP12_ARATH Serine carboxypeptidase-like 12 OS=Arabidopsis thaliana GN=SCPL12 PE=2 SV=1 Back     alignment and function description
>sp|Q8RWJ6|SCP1_ARATH Serine carboxypeptidase-like 1 OS=Arabidopsis thaliana GN=SCPL1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query155
255568639 596 serine carboxypeptidase, putative [Ricin 0.793 0.206 0.593 2e-36
224056272 469 predicted protein [Populus trichocarpa] 0.8 0.264 0.588 2e-36
255562254 478 serine carboxypeptidase, putative [Ricin 0.832 0.269 0.581 3e-36
224060867 460 predicted protein [Populus trichocarpa] 0.819 0.276 0.562 2e-34
296083016 503 unnamed protein product [Vitis vinifera] 0.787 0.242 0.557 4e-34
359475474 468 PREDICTED: serine carboxypeptidase-like 0.787 0.260 0.557 4e-34
255562256 421 serine carboxypeptidase, putative [Ricin 0.793 0.292 0.528 1e-32
145370792 452 serine carboxypeptitase-like protein 1 [ 0.793 0.272 0.560 2e-32
4101703 464 glucose acyltransferase [Solanum berthau 0.838 0.280 0.523 2e-32
4101707 461 glucose acyltransferase [Solanum berthau 0.954 0.321 0.48 2e-32
>gi|255568639|ref|XP_002525293.1| serine carboxypeptidase, putative [Ricinus communis] gi|223535451|gb|EEF37121.1| serine carboxypeptidase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 95/123 (77%)

Query: 3   DTLSATQIYHFLRKWLIVHSDFLANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRMNL 62
           DT+ ATQ   FL+KWL+ H  F+  PLYIAGDSYSG IVPI+ +E+S+GI+ G +P++NL
Sbjct: 161 DTIYATQTSTFLKKWLLCHPQFIKIPLYIAGDSYSGIIVPIITKELSEGIELGEQPQINL 220

Query: 63  KGYMLGNPVTDDKIDQNSKIQFAYLNALITYEIYKSAKKNCKGDYVNVDPGNYLCKADLQ 122
           +GY+LGNP TD K D NSKI FA+  A+I+ E+YKSAK+NCKG+YV V+P N  C  DL+
Sbjct: 221 EGYLLGNPGTDSKFDGNSKIPFAHRMAIISDELYKSAKRNCKGEYVKVNPNNTKCLDDLE 280

Query: 123 NIS 125
            IS
Sbjct: 281 AIS 283

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224056272|ref|XP_002298786.1| predicted protein [Populus trichocarpa] gi|222846044|gb|EEE83591.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255562254|ref|XP_002522135.1| serine carboxypeptidase, putative [Ricinus communis] gi|223538734|gb|EEF40335.1| serine carboxypeptidase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224060867|ref|XP_002300280.1| predicted protein [Populus trichocarpa] gi|222847538|gb|EEE85085.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296083016|emb|CBI22420.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359475474|ref|XP_002266354.2| PREDICTED: serine carboxypeptidase-like 18-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255562256|ref|XP_002522136.1| serine carboxypeptidase, putative [Ricinus communis] gi|223538735|gb|EEF40336.1| serine carboxypeptidase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|145370792|dbj|BAF56655.1| serine carboxypeptitase-like protein 1 [Diospyros kaki] Back     alignment and taxonomy information
>gi|4101703|gb|AAD01263.1| glucose acyltransferase [Solanum berthaultii] Back     alignment and taxonomy information
>gi|4101707|gb|AAD01265.1| glucose acyltransferase [Solanum berthaultii] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query155
TAIR|locus:2082249 437 scpl17 "serine carboxypeptidas 0.845 0.299 0.473 7.9e-30
TAIR|locus:2082239 435 scpl16 "serine carboxypeptidas 0.748 0.266 0.525 2.1e-29
TAIR|locus:2197309 452 scpl6 "serine carboxypeptidase 0.748 0.256 0.551 2.7e-29
TAIR|locus:2197294 441 scpl2 "serine carboxypeptidase 0.748 0.263 0.543 3.4e-29
TAIR|locus:2144751 465 SCPL19 "serine carboxypeptidas 0.980 0.326 0.423 4.4e-29
TAIR|locus:2197299 438 scpl5 "serine carboxypeptidase 0.929 0.328 0.456 5e-28
TAIR|locus:2059175 435 SCPL12 "serine carboxypeptidas 0.748 0.266 0.517 5e-28
TAIR|locus:2197304 441 scpl3 "serine carboxypeptidase 0.748 0.263 0.525 1e-27
TAIR|locus:2045389 437 SCPL9 "serine carboxypeptidase 0.748 0.265 0.5 1.3e-27
TAIR|locus:2158946 441 scpl1 "serine carboxypeptidase 0.748 0.263 0.525 2.2e-27
TAIR|locus:2082249 scpl17 "serine carboxypeptidase-like 17" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 330 (121.2 bits), Expect = 7.9e-30, P = 7.9e-30
 Identities = 62/131 (47%), Positives = 92/131 (70%)

Query:     2 NDTLSATQIYHFLRKWLIVHSDFLANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRMN 61
             +DT  A  +  FL KWL  H +FL+NPLY+AG+SYSG ++P +VQEIS+G     KP++N
Sbjct:   148 SDTGVAKPVNEFLHKWLDKHPEFLSNPLYVAGNSYSGIVIPTIVQEISNGNHLDSKPQIN 207

Query:    62 LKGYMLGNPVTDDKIDQNSKIQFAYLNALITYEIYKSAKKNCKGDYVNVDPGNYLCKADL 121
             L+G++LGNP TD  ID NS+I FA+  ALI+ E Y+S K++C+G+Y++V+P N  C   L
Sbjct:   208 LQGFVLGNPATDTDIDLNSRIPFAHGKALISDEHYESLKRSCQGNYISVNPRNTKCLKLL 267

Query:   122 QNISAVRKGVT 132
             ++      G++
Sbjct:   268 EDFKKCVSGIS 278
GO:0004185 "serine-type carboxypeptidase activity" evidence=IEA;ISS
GO:0005576 "extracellular region" evidence=ISM
GO:0006508 "proteolysis" evidence=IEA;ISS
TAIR|locus:2082239 scpl16 "serine carboxypeptidase-like 16" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197309 scpl6 "serine carboxypeptidase-like 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197294 scpl2 "serine carboxypeptidase-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144751 SCPL19 "serine carboxypeptidase-like 19" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197299 scpl5 "serine carboxypeptidase-like 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2059175 SCPL12 "serine carboxypeptidase-like 12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197304 scpl3 "serine carboxypeptidase-like 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045389 SCPL9 "serine carboxypeptidase-like 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158946 scpl1 "serine carboxypeptidase-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.16LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pg.C_LG_I002690
hypothetical protein (469 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query155
pfam00450 415 pfam00450, Peptidase_S10, Serine carboxypeptidase 2e-37
PLN02209 437 PLN02209, PLN02209, serine carboxypeptidase 1e-35
PLN02213 319 PLN02213, PLN02213, sinapoylglucose-malate O-sinap 4e-33
PLN03016 433 PLN03016, PLN03016, sinapoylglucose-malate O-sinap 4e-33
PTZ00472 462 PTZ00472, PTZ00472, serine carboxypeptidase (CBP1) 4e-11
>gnl|CDD|215926 pfam00450, Peptidase_S10, Serine carboxypeptidase Back     alignment and domain information 
 Score =  132 bits (333), Expect = 2e-37
 Identities = 54/126 (42%), Positives = 74/126 (58%)

Query: 2   NDTLSATQIYHFLRKWLIVHSDFLANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRMN 61
           +D  +A   Y FL+K+     ++  NP YIAG+SY+G  VP + QEI DG   G  P +N
Sbjct: 109 DDEETAKDNYEFLQKFFEKFPEYKNNPFYIAGESYAGHYVPALAQEILDGNKKGTGPNIN 168

Query: 62  LKGYMLGNPVTDDKIDQNSKIQFAYLNALITYEIYKSAKKNCKGDYVNVDPGNYLCKADL 121
           LKG ++GN +TD  I  NS I FAY + LI+ E+Y+S KK C G Y + DP N  C   +
Sbjct: 169 LKGVLIGNGLTDPAIQYNSYIPFAYYHGLISDELYESLKKACCGKYPDCDPANTKCLNLV 228

Query: 122 QNISAV 127
           +  S  
Sbjct: 229 EEASGC 234

Length = 415
>gnl|CDD|177859 PLN02209, PLN02209, serine carboxypeptidase Back     alignment and domain information
>gnl|CDD|165857 PLN02213, PLN02213, sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information
>gnl|CDD|178590 PLN03016, PLN03016, sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>gnl|CDD|240429 PTZ00472, PTZ00472, serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 155
KOG1282 454 consensus Serine carboxypeptidases (lysosomal cath 100.0
PLN02213 319 sinapoylglucose-malate O-sinapoyltransferase/ carb 100.0
PLN03016 433 sinapoylglucose-malate O-sinapoyltransferase 100.0
PF00450 415 Peptidase_S10: Serine carboxypeptidase; InterPro: 100.0
PLN02209 437 serine carboxypeptidase 100.0
PTZ00472 462 serine carboxypeptidase (CBP1); Provisional 99.97
KOG1283 414 consensus Serine carboxypeptidases [Posttranslatio 99.89
COG2939 498 Carboxypeptidase C (cathepsin A) [Amino acid trans 99.86
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 93.79
TIGR03611257 RutD pyrimidine utilization protein D. This protei 93.73
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 93.7
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 93.65
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 93.64
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 93.43
PLN02454414 triacylglycerol lipase 93.05
PHA02857276 monoglyceride lipase; Provisional 92.92
PF11144 403 DUF2920: Protein of unknown function (DUF2920); In 92.76
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 92.54
PLN02385349 hydrolase; alpha/beta fold family protein 92.35
KOG1515336 consensus Arylacetamide deacetylase [Defense mecha 91.93
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 91.7
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 91.62
PLN02298330 hydrolase, alpha/beta fold family protein 91.42
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 91.35
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 91.31
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 90.9
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 90.76
PRK05077414 frsA fermentation/respiration switch protein; Revi 90.1
PRK10749330 lysophospholipase L2; Provisional 89.87
PLN02571413 triacylglycerol lipase 89.52
PLN02211273 methyl indole-3-acetate methyltransferase 89.36
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 89.22
PLN02652395 hydrolase; alpha/beta fold family protein 88.74
PRK10162318 acetyl esterase; Provisional 88.58
PF05577 434 Peptidase_S28: Serine carboxypeptidase S28; InterP 88.22
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 88.15
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 87.81
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 87.78
PLN02753531 triacylglycerol lipase 87.42
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 87.35
PLN02719518 triacylglycerol lipase 86.92
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 86.73
PLN00021313 chlorophyllase 86.31
PLN02965255 Probable pheophorbidase 85.7
PLN02578354 hydrolase 85.65
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 85.09
PF10340374 DUF2424: Protein of unknown function (DUF2424); In 85.06
PLN02894 402 hydrolase, alpha/beta fold family protein 84.98
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 84.94
PRK03204286 haloalkane dehalogenase; Provisional 84.88
PRK03592295 haloalkane dehalogenase; Provisional 84.43
PRK10566249 esterase; Provisional 84.4
KOG1455313 consensus Lysophospholipase [Lipid transport and m 84.36
PLN02442283 S-formylglutathione hydrolase 83.73
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 83.7
TIGR03230 442 lipo_lipase lipoprotein lipase. Members of this pr 83.6
PF11288207 DUF3089: Protein of unknown function (DUF3089); In 83.16
PLN02824294 hydrolase, alpha/beta fold family protein 82.56
PRK10673255 acyl-CoA esterase; Provisional 82.19
PRK00870302 haloalkane dehalogenase; Provisional 82.06
COG2267298 PldB Lysophospholipase [Lipid metabolism] 81.25
PLN02324415 triacylglycerol lipase 80.61
COG0657312 Aes Esterase/lipase [Lipid metabolism] 80.27
>KOG1282 consensus Serine carboxypeptidases (lysosomal cathepsin A) [Posttranslational modification, protein turnover, chaperones; Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=9.4e-40  Score=276.06  Aligned_cols=143  Identities=36%  Similarity=0.645  Sum_probs=131.9

Q ss_pred             CChHHHHHHHHHHHHHHHHHccccCCCCeEEEeeccCccchhHHHHHHHhcccCCCCCccccceeEecCCCCChhhhhHH
Q 031674            1 MNDTLSATQIYHFLRKWLIVHSDFLANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRMNLKGYMLGNPVTDDKIDQNS   80 (155)
Q Consensus         1 ~~d~~~a~d~~~fL~~f~~~fp~~~~~~~yi~GESYgG~yvP~~a~~i~~~n~~~~~~~inLkGi~iGng~~d~~~~~~~   80 (155)
                      ++|+.+|+|++.||++||++||||++|||||+||||||||||+||++|+++|+....+.|||||++||||++|+..|..+
T Consensus       142 ~~D~~~A~d~~~FL~~wf~kfPey~~~~fyI~GESYAG~YVP~La~~I~~~N~~~~~~~iNLkG~~IGNg~td~~~~~~~  221 (454)
T KOG1282|consen  142 TGDDGTAKDNYEFLQKWFEKFPEYKSNDFYIAGESYAGHYVPALAQEILKGNKKCCKPNINLKGYAIGNGLTDPEIDYNG  221 (454)
T ss_pred             CCcHHHHHHHHHHHHHHHHhChhhcCCCeEEecccccceehHHHHHHHHhccccccCCcccceEEEecCcccCccccccc
Confidence            47999999999999999999999999999999999999999999999999998655678999999999999999999999


Q ss_pred             HHHHhhhccccCHHHHHHHHhhccc---ccCCCCCChhhHHHHHHHHH-HhcCCCcccccCCCCCCC
Q 031674           81 KIQFAYLNALITYEIYKSAKKNCKG---DYVNVDPGNYLCKADLQNIS-AVRKGVTIILFICLLFLN  143 (155)
Q Consensus        81 ~~~~~~~~gli~~~~~~~~~~~C~~---~~~~~~~~~~~C~~~~~~~~-~~~~~in~Ydi~~~~c~~  143 (155)
                      +.+|++.||||++++++.+++.|..   ++.++.+.+..|..+++.+. ...++++.|+|+.+.|..
T Consensus       222 ~~~~a~~h~liSde~~~~l~~~C~~~~~~~~~~~~~~~~C~~~~~~~~~~~~~~i~~y~i~~~~C~~  288 (454)
T KOG1282|consen  222 RIPFAWGHGLISDELYESLKRACDFSSDNYANVDPSNTKCNKAVEEFDSKTTGDIDNYYILTPDCYP  288 (454)
T ss_pred             hhhhhhhcccCCHHHHHHHHHHhccCcccccccCCchhHHHHHHHHHHHHHhccCchhhhcchhhcc
Confidence            9999999999999999999999987   34444566789999999998 666899999999998985

>PLN02213 sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information
>PLN03016 sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PLN02209 serine carboxypeptidase Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>KOG1283 consensus Serine carboxypeptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2939 Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>KOG1515 consensus Arylacetamide deacetylase [Defense mechanisms] Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PLN02753 triacylglycerol lipase Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PLN02719 triacylglycerol lipase Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PLN02324 triacylglycerol lipase Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query155
1whs_A255 Structure Of The Complex Of L-Benzylsuccinate With 8e-11
1wht_A256 Structure Of The Complex Of L-Benzylsuccinate With 9e-11
1bcr_A263 Complex Of The Wheat Serine Carboxypeptidase, Cpdw- 1e-10
3sc2_A259 Refined Atomic Model Of Wheat Serine Carboxypeptida 1e-10
1ivy_A 452 Physiological Dimer Hpp Precursor Length = 452 3e-07
4az0_A300 Crystal Structure Of Cathepsin A, Complexed With 8a 3e-07
1gxs_A270 Crystal Structure Of Hydroxynitrile Lyase From Sorg 1e-04
>pdb|1WHS|A Chain A, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 255 Back     alignment and structure 
Iteration: 1

 Score = 62.8 bits (151), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 53/105 (50%), Gaps = 4/105 (3%)
Query: 2   NDTLSATQIYHFLRKWLIVHSDFLANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRMN 61
            D  +A   Y FL KW      +     YIAG+SY+G  VP    E+S  +     P +N
Sbjct: 120 GDNRTAHDSYAFLAKWFERFPHYKYRDFYIAGESYAGHYVP----ELSQLVHRSKNPVIN 175
Query: 62  LKGYMLGNPVTDDKIDQNSKIQFAYLNALITYEIYKSAKKNCKGD 106
           LKG+M+GN + DD  D     +F + + +++ + Y+  K+ C  D
Sbjct: 176 LKGFMVGNGLIDDYHDYVGTFEFWWNHGIVSDDTYRRLKEACLHD 220
>pdb|1WHT|A Chain A, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 256 Back     alignment and structure
>pdb|1BCR|A Chain A, Complex Of The Wheat Serine Carboxypeptidase, Cpdw-Ii, With The Microbial Peptide Aldehyde Inhibitor, Antipain, And Arginine At Room Temperature Length = 263 Back     alignment and structure
>pdb|3SC2|A Chain A, Refined Atomic Model Of Wheat Serine Carboxypeptidase Ii At 2.2- Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|1IVY|A Chain A, Physiological Dimer Hpp Precursor Length = 452 Back     alignment and structure
>pdb|4AZ0|A Chain A, Crystal Structure Of Cathepsin A, Complexed With 8a. Length = 300 Back     alignment and structure
>pdb|1GXS|A Chain A, Crystal Structure Of Hydroxynitrile Lyase From Sorghum Bicolor In Complex With Inhibitor Benzoic Acid: A Novel Cyanogenic Enzyme Length = 270 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query155
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 7e-41
1gxs_A270 P-(S)-hydroxymandelonitrIle lyase chain A; inhibit 1e-38
1ivy_A 452 Human protective protein; carboxypeptidase, serine 5e-37
1cpy_A 421 Serine carboxypeptidase; hydrolase (carboxypeptida 3e-24
1ac5_A 483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 5e-23
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Length = 255 Back     alignment and structure
 Score =  136 bits (345), Expect = 7e-41
 Identities = 36/131 (27%), Positives = 59/131 (45%), Gaps = 6/131 (4%)

Query: 1   MNDTLSATQIYHFLRKWLIVHSDFLANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRM 60
             D  +A   Y FL KW      +     YIAG+SY+G  VP + Q +         P +
Sbjct: 119 SGDNRTAHDSYAFLAKWFERFPHYKYRDFYIAGESYAGHYVPELSQLVHRS----KNPVI 174

Query: 61  NLKGYMLGNPVTDDKIDQNSKIQFAYLNALITYEIYKSAKKNCKGDYVNVDPGNYLCKAD 120
           NLKG+M+GN + DD  D     +F + + +++ + Y+  K+ C  D       +  C A 
Sbjct: 175 NLKGFMVGNGLIDDYHDYVGTFEFWWNHGIVSDDTYRRLKEACLHDS--FIHPSPACDAA 232

Query: 121 LQNISAVRKGV 131
               +A +  +
Sbjct: 233 TDVATAEQGNI 243
>1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Length = 270 Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Length = 452 Back     alignment and structure
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Length = 421 Back     alignment and structure
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Length = 483 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query155
4az3_A300 Lysosomal protective protein 32 kDa chain; hydrola 100.0
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 100.0
1gxs_A270 P-(S)-hydroxymandelonitrIle lyase chain A; inhibit 100.0
1cpy_A 421 Serine carboxypeptidase; hydrolase (carboxypeptida 99.97
1ivy_A 452 Human protective protein; carboxypeptidase, serine 99.97
1ac5_A 483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 99.97
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 95.2
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 94.61
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 94.45
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 94.3
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 94.08
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 94.06
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 94.01
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 93.93
3h04_A275 Uncharacterized protein; protein with unknown func 93.91
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 93.85
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 93.64
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 93.57
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 93.47
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 93.43
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 93.34
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 93.23
3llc_A270 Putative hydrolase; structural genomics, joint cen 93.2
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 93.1
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 93.01
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 92.93
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 92.92
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 92.72
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 92.7
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 92.67
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 92.59
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 92.54
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 92.54
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 92.4
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 92.38
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 92.34
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 92.33
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 92.2
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 92.2
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 92.11
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 92.03
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 92.01
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 91.97
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 91.93
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 91.93
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 91.91
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 91.85
3ain_A323 303AA long hypothetical esterase; carboxylesterase 91.64
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 91.54
3h2g_A 397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 91.5
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 91.4
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 91.35
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 91.12
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 91.05
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 91.04
1vkh_A273 Putative serine hydrolase; structural genomics, jo 90.89
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 90.87
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 90.81
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 90.63
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 90.61
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 90.58
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 90.55
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 90.51
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 90.43
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 90.4
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 90.38
3uue_A279 LIP1, secretory lipase (family 3); LID-domain, hyd 90.35
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 90.31
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 90.27
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 90.24
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 90.2
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 90.09
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 90.05
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 89.97
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 89.97
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 89.89
3ngm_A319 Extracellular lipase; secret lipase, hydrolase; 2. 89.84
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 89.52
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 89.49
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 89.48
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 89.47
2y6u_A 398 Peroxisomal membrane protein LPX1; hydrolase, puta 89.44
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 89.41
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 89.4
1k8q_A 377 Triacylglycerol lipase, gastric; APHA beta hydrola 89.38
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 89.35
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 89.25
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 89.22
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 89.21
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 88.98
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 88.96
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 88.78
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 88.74
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 88.68
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 88.5
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 88.42
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 88.22
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 88.2
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 88.17
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 88.16
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 88.0
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 87.93
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 87.92
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 87.66
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 87.57
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 87.43
3o0d_A301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 87.24
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 87.16
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 87.14
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 87.09
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 87.08
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 87.08
1iup_A282 META-cleavage product hydrolase; aromatic compound 87.07
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 87.06
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 87.02
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 86.99
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 86.44
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 86.22
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 86.19
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 86.14
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 86.06
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 86.03
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 85.92
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 85.9
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 85.88
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 85.87
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 85.66
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 85.61
1w52_X 452 Pancreatic lipase related protein 2; detergent, cl 85.34
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 85.22
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 85.18
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 84.93
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 84.88
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 84.86
2cjp_A 328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 84.85
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 84.81
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 84.81
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 84.66
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 84.64
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 84.59
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 84.51
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 84.32
3tej_A329 Enterobactin synthase component F; nonribosomal pe 84.29
3iii_A 560 COCE/NOND family hydrolase; structural genomics, c 84.25
2pl5_A 366 Homoserine O-acetyltransferase; alpha/beta hydrola 84.07
3bjr_A283 Putative carboxylesterase; structural genomics, jo 83.92
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 83.83
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 83.73
3d59_A383 Platelet-activating factor acetylhydrolase; secret 83.68
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 83.59
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 83.51
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 83.43
1bu8_A 452 Protein (pancreatic lipase related protein 2); hyd 83.34
4fle_A202 Esterase; structural genomics, PSI-biology, northe 83.08
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 83.66
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 83.03
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 82.98
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 82.8
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 82.71
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 82.51
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 82.51
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 82.48
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 82.47
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 82.37
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 82.15
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 82.06
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 82.05
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 81.9
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 81.37
3guu_A 462 Lipase A; protein structure, hydrolase; HET: 1PE; 81.35
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 81.11
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 81.07
2b61_A 377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 80.9
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 80.82
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 80.6
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 80.58
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 80.57
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 80.46
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 80.26
4ebb_A 472 Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2 80.21
>4az3_A Lysosomal protective protein 32 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_A* Back     alignment and structure
Probab=100.00  E-value=2.8e-38  Score=254.88  Aligned_cols=147  Identities=24%  Similarity=0.442  Sum_probs=122.9

Q ss_pred             CChHHHHHHHHHHHHHHHHHccccCCCCeEEEeeccCccchhHHHHHHHhcccCCCCCccccceeEecCCCCChhhhhHH
Q 031674            1 MNDTLSATQIYHFLRKWLIVHSDFLANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRMNLKGYMLGNPVTDDKIDQNS   80 (155)
Q Consensus         1 ~~d~~~a~d~~~fL~~f~~~fp~~~~~~~yi~GESYgG~yvP~~a~~i~~~n~~~~~~~inLkGi~iGng~~d~~~~~~~   80 (155)
                      ++++++|+|++.||+.||++||+|+++||||+||||||||||.+|++|++++      +||||||+||||+|||..|..+
T Consensus       118 ~~~~~~a~d~~~fl~~f~~~fp~~~~~~~yi~GESY~G~yvP~~a~~i~~~~------~inLkG~~iGNg~~d~~~~~~~  191 (300)
T 4az3_A          118 TNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAVLVMQDP------SMNLQGLAVGNGLSSYEQNDNS  191 (300)
T ss_dssp             CBHHHHHHHHHHHHHHHHHHCGGGTTSCEEEEEETTHHHHHHHHHHHHTTCT------TSCEEEEEEESCCSBHHHHHHH
T ss_pred             ccchhhHHHHHHHHHHHHHhChhhcCCceEEEecCCceeeHHHHHHHHHhCC------CcccccceecCCccCHHHhcch
Confidence            3688999999999999999999999999999999999999999999999865      6999999999999999999999


Q ss_pred             HHHHhhhccccCHHHHHHHHhhcccccC--CCCCChhhHHHHHHHHHHhc--CCCcccccCCCCCCCCCCCccccccC
Q 031674           81 KIQFAYLNALITYEIYKSAKKNCKGDYV--NVDPGNYLCKADLQNISAVR--KGVTIILFICLLFLNTISSTPNYLTD  154 (155)
Q Consensus        81 ~~~~~~~~gli~~~~~~~~~~~C~~~~~--~~~~~~~~C~~~~~~~~~~~--~~in~Ydi~~~~c~~~~~~~~~~l~~  154 (155)
                      +.+|+|.||||++++++.+++.|.....  .....+..|..+++.+....  .++|+|||+.+ |.......-+|++|
T Consensus       192 ~~~fa~~~gli~~~~~~~~~~~c~~~~~~~~~~~~~~~C~~~~~~~~~~~~~~~~N~YdI~~~-C~~~~~~~~~y~~~  268 (300)
T 4az3_A          192 LVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAP-CAGGVPSHFRYEKD  268 (300)
T ss_dssp             HHHHHHHTTSSCHHHHHHHHHHTEETTEECCSSCCCHHHHHHHHHHHHHHHSSSCCTTCTTSC-CTTCCC--------
T ss_pred             hHHHHhhcCcCCHHHHHHHHHHHHHhhccCcCCCCcHHHHHHHHHHHHHhccCCCChhhccCc-CCCCCCccccccCC
Confidence            9999999999999999999999964221  11345678999999888765  67999999998 76554444566665
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Back     alignment and structure
>1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>4ebb_A Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2.00A {Homo sapiens} PDB: 3jyh_A* 3n0t_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 155
d1ac5a_ 483 c.69.1.5 (A:) Serine carboxypeptidase II {Baker's 1e-19
g1wht.1 409 c.69.1.5 (A:,B:) Serine carboxypeptidase II {Wheat 3e-19
d1ivya_ 452 c.69.1.5 (A:) Human 'protective protein', HPP {Hum 4e-19
g1gxs.1 425 c.69.1.5 (A:,B:) Hydroxynitrile lyase {Sorghum (So 6e-15
d1wpxa1 421 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Bak 3e-13
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Length = 483 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Serine carboxypeptidase-like
domain: Serine carboxypeptidase II
species: Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]

 Score = 82.2 bits (202), Expect = 1e-19
 Identities = 25/132 (18%), Positives = 51/132 (38%), Gaps = 9/132 (6%)

Query: 2   NDTLSATQIYHFLRKWLIVHSDFLANPLYIAGDSYSGKIVPIVVQEISDGIDAGH--KPR 59
           +          FL  +  +  + L   + ++G+SY+G+ +P     I +           
Sbjct: 143 DLEDVTKHFMDFLENYFKIFPEDLTRKIILSGESYAGQYIPFFANAILNHNKFSKIDGDT 202

Query: 60  MNLKGYMLGNPVTDDKIDQNSKIQFAYLNALI-----TYEIYKSAKKNCKG--DYVNVDP 112
            +LK  ++GN   D      S + FA    LI      ++   +A +NC+   +  + D 
Sbjct: 203 YDLKALLIGNGWIDPNTQSLSYLPFAMEKKLIDESNPNFKHLTNAHENCQNLINSASTDE 262

Query: 113 GNYLCKADLQNI 124
             +    + +NI
Sbjct: 263 AAHFSYQECENI 274
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Length = 452 Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 421 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query155
g1wht.1 409 Serine carboxypeptidase II {Wheat (Triticum vulgar 100.0
d1ivya_ 452 Human 'protective protein', HPP {Human (Homo sapie 99.97
d1ac5a_ 483 Serine carboxypeptidase II {Baker's yeast (Sacchar 99.96
d1wpxa1 421 Serine carboxypeptidase II {Baker's yeast (Sacchar 99.95
g1gxs.1 425 Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T 99.94
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 93.44
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 93.06
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 92.64
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 91.91
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 91.63
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 91.04
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 90.71
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 90.47
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 90.43
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 90.37
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 90.11
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 89.91
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 89.84
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 88.07
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 87.87
d1zd3a2 322 Mammalian epoxide hydrolase, C-terminal domain {Hu 87.21
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 87.16
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 86.56
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 86.45
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 85.9
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 84.64
d1mpxa2 381 Alpha-amino acid ester hydrolase {Xanthomonas citr 84.64
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 84.39
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 84.31
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 83.62
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 82.81
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 82.65
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 82.6
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 81.66
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 81.11
d2b9va2 385 Alpha-amino acid ester hydrolase {Acetobacter past 81.08
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 80.7
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure