Citrus Sinensis ID: 031781

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150---
MSFNSVLNIAAAISFLLVLSTLVSANKSGDVTELQIGVKYKPKTCDIQAHKGDKIKVHYRGKLTDGTVFDSSFERGDPIEFELGSGHVIKGWDQGLLGMCVGEKRKLKIPAKLGYGAQGSPPTIPGGATLIFDTELVTVNGKPASGEKTEDEL
cccccccHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEccccccccccccEEEEEEEEEccccccccccccccccEEEEcccccEEccHHHHHcccccccEEEEEEccccccccccccccccccccEEEEEEEEEEEccccccccccccc
ccccccccHHHHHHHHHHHHHHHHcccccccEEEEcEEEEEEcccccccccccEEEEEEEEEEccccEEEEcccccccEEEEcccccccHHHHHHHHHcccccEEEEEEcHHHccccccEcccEcccccEEEEEEEEEEccccccHcccHHcc
MSFNSVLNIAAAISFLLVLSTLVSanksgdvtelqigvkykpktcdiqahkgdkikvhyrgkltdgtvfdssfergdpiefelgsghvikgwdqgllgmcvgekrklkipaklgygaqgspptipggatlifdtelvtvngkpasgektedel
MSFNSVLNIAAAISFLLVLSTLVSANksgdvtelqigvkykpktcdiqahkgdkikvhyrgkltdgtvfdssfeRGDPIEFELGSGHVIKGWDQGLLGMCVGEKRKLKIPAKLGYGAQGSPPTIPGGATLIFDTElvtvngkpasgektedel
MSFNSVLNIAAAISFLLVLSTLVSANKSGDVTELQIGVKYKPKTCDIQAHKGDKIKVHYRGKLTDGTVFDSSFERGDPIEFELGSGHVIKGWDQGLLGMCVGEKRKLKIPAKLGYGAQGSPPTIPGGATLIFDTELVTVNGKPASGEKTEDEL
****SVLNIAAAISFLLVLSTLVSANKSGDVTELQIGVKYKPKTCDIQAHKGDKIKVHYRGKLTDGTVFDSSFERGDPIEFELGSGHVIKGWDQGLLGMCVGEKRKLKIPAKLGYGAQGSPPTIPGGATLIFDTELVTV**************
*******NIAAAISFLLVLSTLVSAN******ELQIGVKYKPK****QAHKGDKIKVHYRGKLTDGTVFDSSFERGDPIEFELGSGHVIKGWDQGLLGMCVGEKRKLKIPAKLGYGAQGSPPTIPGGATLIFDTELVTVN*************
MSFNSVLNIAAAISFLLVLSTLVSANKSGDVTELQIGVKYKPKTCDIQAHKGDKIKVHYRGKLTDGTVFDSSFERGDPIEFELGSGHVIKGWDQGLLGMCVGEKRKLKIPAKLGYGAQGSPPTIPGGATLIFDTELVTVNGK***********
****SVLNIAAAISFLLVLSTLVSANKSGDVTELQIGVKYKPKTCDIQAHKGDKIKVHYRGKLTDGTVFDSSFERGDPIEFELGSGHVIKGWDQGLLGMCVGEKRKLKIPAKLGYGAQGSPPTIPGGATLIFDTELVTVNGK***********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFNSVLNIAAAISFLLVLSTLVSANKSGDVTELQIGVKYKPKTCDIQAHKGDKIKVHYRGKLTDGTVFDSSFERGDPIEFELGSGHVIKGWDQGLLGMCVGEKRKLKIPAKLGYGAQGSPPTIPGGATLIFDTELVTVNGKPASGEKTEDEL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query153 2.2.26 [Sep-21-2011]
Q38936163 Peptidyl-prolyl cis-trans yes no 0.921 0.865 0.765 2e-60
Q38935153 Peptidyl-prolyl cis-trans no no 0.843 0.843 0.844 3e-60
Q41649151 FK506-binding protein 2 O N/A no 0.849 0.860 0.815 2e-58
Q32PA9140 Peptidyl-prolyl cis-trans no no 0.895 0.978 0.521 4e-36
P45878140 Peptidyl-prolyl cis-trans yes no 0.895 0.978 0.514 1e-35
P26885142 Peptidyl-prolyl cis-trans yes no 0.895 0.964 0.507 3e-35
P0CP97141 FK506-binding protein 2 O N/A no 0.849 0.921 0.522 1e-34
Q54SR7133 FK506-binding protein 2 O yes no 0.784 0.902 0.581 1e-34
Q6CGG3144 FK506-binding protein 2 O yes no 0.849 0.902 0.529 2e-34
P0CP96141 FK506-binding protein 2 O yes no 0.849 0.921 0.522 2e-34
>sp|Q38936|FK152_ARATH Peptidyl-prolyl cis-trans isomerase FKBP15-2 OS=Arabidopsis thaliana GN=FKBP15-2 PE=2 SV=2 Back     alignment and function desciption
 Score =  231 bits (588), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 111/145 (76%), Positives = 124/145 (85%), Gaps = 4/145 (2%)

Query: 8   NIAAAISFLLVLSTLVS----ANKSGDVTELQIGVKYKPKTCDIQAHKGDKIKVHYRGKL 63
            ++   S  L+  +L+S    A K+GDV+ELQIGVK+KPKTC++QAHKGD IKVHYRGKL
Sbjct: 4   KMSLRYSLFLIFFSLISLQGFAKKTGDVSELQIGVKFKPKTCEVQAHKGDTIKVHYRGKL 63

Query: 64  TDGTVFDSSFERGDPIEFELGSGHVIKGWDQGLLGMCVGEKRKLKIPAKLGYGAQGSPPT 123
           TDGTVFDSSFERGDP EF+LGSG VIKGWDQGLLG CVGEKRKLKIPAKLGYG QGSPPT
Sbjct: 64  TDGTVFDSSFERGDPFEFKLGSGQVIKGWDQGLLGACVGEKRKLKIPAKLGYGEQGSPPT 123

Query: 124 IPGGATLIFDTELVTVNGKPASGEK 148
           IPGGATLIFDTEL+ VN KPA GE+
Sbjct: 124 IPGGATLIFDTELIAVNEKPAGGEE 148
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Arabidopsis thaliana (taxid: 3702)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|Q38935|FK151_ARATH Peptidyl-prolyl cis-trans isomerase FKBP15-1 OS=Arabidopsis thaliana GN=FKBP15-1 PE=1 SV=2 Back     alignment and function description
>sp|Q41649|FKB15_VICFA FK506-binding protein 2 OS=Vicia faba GN=FKBP15 PE=1 SV=1 Back     alignment and function description
>sp|Q32PA9|FKBP2_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP2 OS=Bos taurus GN=FKBP2 PE=2 SV=1 Back     alignment and function description
>sp|P45878|FKBP2_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP2 OS=Mus musculus GN=Fkbp2 PE=1 SV=1 Back     alignment and function description
>sp|P26885|FKBP2_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP2 OS=Homo sapiens GN=FKBP2 PE=1 SV=2 Back     alignment and function description
>sp|P0CP97|FKBP2_CRYNB FK506-binding protein 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=FPR2 PE=3 SV=1 Back     alignment and function description
>sp|Q54SR7|FKBP2_DICDI FK506-binding protein 2 OS=Dictyostelium discoideum GN=fkbp2 PE=3 SV=1 Back     alignment and function description
>sp|Q6CGG3|FKBP2_YARLI FK506-binding protein 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FPR2 PE=3 SV=1 Back     alignment and function description
>sp|P0CP96|FKBP2_CRYNJ FK506-binding protein 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=FPR2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query153
225469328148 PREDICTED: FK506-binding protein 2-1 [Vi 0.928 0.959 0.845 1e-64
255587693149 fk506-binding protein, putative [Ricinus 0.928 0.953 0.830 7e-63
118489502153 unknown [Populus trichocarpa x Populus d 0.980 0.980 0.807 7e-63
224065419153 predicted protein [Populus trichocarpa] 0.980 0.980 0.807 1e-62
449463206150 PREDICTED: peptidyl-prolyl cis-trans iso 0.934 0.953 0.798 3e-60
357513317151 FK506-binding protein [Medicago truncatu 0.921 0.933 0.794 1e-59
217071518151 unknown [Medicago truncatula] 0.921 0.933 0.794 2e-59
388504402154 unknown [Lotus japonicus] 0.993 0.987 0.730 3e-59
226531265148 LOC100282031 precursor [Zea mays] gi|195 0.901 0.932 0.784 5e-59
125564261154 hypothetical protein OsI_31925 [Oryza sa 0.797 0.792 0.885 5e-59
>gi|225469328|ref|XP_002271056.1| PREDICTED: FK506-binding protein 2-1 [Vitis vinifera] gi|296090582|emb|CBI40945.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  250 bits (638), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 120/142 (84%), Positives = 129/142 (90%)

Query: 10  AAAISFLLVLSTLVSANKSGDVTELQIGVKYKPKTCDIQAHKGDKIKVHYRGKLTDGTVF 69
           AA +  LL+L+  V A KSGDVT+LQIGVKYKP++CDIQAHKGDK+KVHYRGKLTDGTVF
Sbjct: 4   AAFVLLLLILTASVFAKKSGDVTDLQIGVKYKPESCDIQAHKGDKVKVHYRGKLTDGTVF 63

Query: 70  DSSFERGDPIEFELGSGHVIKGWDQGLLGMCVGEKRKLKIPAKLGYGAQGSPPTIPGGAT 129
           DSSFERGDPIEFELGSG VIKGWDQGLLGMCVGEKRKLKIPAKLGYGAQGSPP IPGGAT
Sbjct: 64  DSSFERGDPIEFELGSGQVIKGWDQGLLGMCVGEKRKLKIPAKLGYGAQGSPPKIPGGAT 123

Query: 130 LIFDTELVTVNGKPASGEKTED 151
           LIFDTELV VNGK +SG K +D
Sbjct: 124 LIFDTELVAVNGKASSGAKADD 145

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255587693|ref|XP_002534360.1| fk506-binding protein, putative [Ricinus communis] gi|223525435|gb|EEF28025.1| fk506-binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|118489502|gb|ABK96553.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
>gi|224065419|ref|XP_002301808.1| predicted protein [Populus trichocarpa] gi|118487662|gb|ABK95656.1| unknown [Populus trichocarpa] gi|222843534|gb|EEE81081.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449463206|ref|XP_004149325.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP15-2-like [Cucumis sativus] gi|449515127|ref|XP_004164601.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP15-2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357513317|ref|XP_003626947.1| FK506-binding protein [Medicago truncatula] gi|355520969|gb|AET01423.1| FK506-binding protein [Medicago truncatula] gi|388496094|gb|AFK36113.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|217071518|gb|ACJ84119.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|388504402|gb|AFK40267.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|226531265|ref|NP_001148416.1| LOC100282031 precursor [Zea mays] gi|195616116|gb|ACG29888.1| FK506-binding protein 2-1 precursor [Zea mays] gi|195619114|gb|ACG31387.1| FK506-binding protein 2-1 precursor [Zea mays] gi|414886193|tpg|DAA62207.1| TPA: putative FKBP-type peptidyl-prolyl cis-trans isomerase family protein [Zea mays] Back     alignment and taxonomy information
>gi|125564261|gb|EAZ09641.1| hypothetical protein OsI_31925 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query153
TAIR|locus:2090235153 FKBP15-1 "AT3G25220" [Arabidop 0.928 0.928 0.805 3.5e-59
TAIR|locus:2152506163 FKBP15-2 "AT5G48580" [Arabidop 0.882 0.828 0.798 3.6e-57
UNIPROTKB|Q5N801158 P0004D12.26 "Peptidyl-prolyl c 0.934 0.905 0.734 3.7e-55
UNIPROTKB|A8J746143 FKB15-1 "Peptidyl-prolyl cis-t 0.810 0.867 0.637 3.3e-40
ZFIN|ZDB-GENE-040912-126138 fkbp2 "FK506 binding protein 2 0.849 0.942 0.541 4e-35
DICTYBASE|DDB_G0282267133 DDB_G0282267 "FKBP-type peptid 0.816 0.939 0.563 8.3e-35
UNIPROTKB|G1K1P8162 FKBP2 "Peptidyl-prolyl cis-tra 0.803 0.759 0.577 8.3e-35
UNIPROTKB|Q32PA9140 FKBP2 "Peptidyl-prolyl cis-tra 0.803 0.878 0.577 8.3e-35
UNIPROTKB|F1RQ06140 FKBP2 "Peptidyl-prolyl cis-tra 0.803 0.878 0.577 8.3e-35
RGD|1560660140 Fkbp2 "FK506 binding protein 2 0.803 0.878 0.577 8.3e-35
TAIR|locus:2090235 FKBP15-1 "AT3G25220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 607 (218.7 bits), Expect = 3.5e-59, P = 3.5e-59
 Identities = 116/144 (80%), Positives = 128/144 (88%)

Query:    12 AISFLLVLS--TLVSANKSGDVTELQIGVKYKPKTCDIQAHKGDKIKVHYRGKLTDGTVF 69
             A+ FLL+L+  TL  A KSGDVTELQIGVKYKP+ CD+QAHKGDKIKVHYRGKLTDGTVF
Sbjct:    10 AVGFLLLLTILTLAYAKKSGDVTELQIGVKYKPQKCDLQAHKGDKIKVHYRGKLTDGTVF 69

Query:    70 DSSFERGDPIEFELGSGHVIKGWDQGLLGMCVGEKRKLKIPAKLGYGAQGSPPTIPGGAT 129
             DSSFERGDPIEFELG+G VI GWDQGLLG CVGEKRKLKIP+KLGYG  GSPP IPGGAT
Sbjct:    70 DSSFERGDPIEFELGTGQVIPGWDQGLLGACVGEKRKLKIPSKLGYGDNGSPPKIPGGAT 129

Query:   130 LIFDTELVTVNGKPASGEKTEDEL 153
             LIFDTELV VNG+P+S  K+++EL
Sbjct:   130 LIFDTELVAVNGEPSSEAKSKNEL 153
GO:0000413 "protein peptidyl-prolyl isomerization" evidence=IBA
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=ISS;IBA
GO:0005528 "FK506 binding" evidence=ISS;IBA
GO:0006457 "protein folding" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0016020 "membrane" evidence=IBA
GO:0018208 "peptidyl-proline modification" evidence=IBA
GO:0005783 "endoplasmic reticulum" evidence=IDA
TAIR|locus:2152506 FKBP15-2 "AT5G48580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5N801 P0004D12.26 "Peptidyl-prolyl cis-trans isomerase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|A8J746 FKB15-1 "Peptidyl-prolyl cis-trans isomerase" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040912-126 fkbp2 "FK506 binding protein 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0282267 DDB_G0282267 "FKBP-type peptidylprolyl cis-trans isomerase (PPIase)" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|G1K1P8 FKBP2 "Peptidyl-prolyl cis-trans isomerase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q32PA9 FKBP2 "Peptidyl-prolyl cis-trans isomerase FKBP2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RQ06 FKBP2 "Peptidyl-prolyl cis-trans isomerase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1560660 Fkbp2 "FK506 binding protein 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q2UPT7FKBP2_ASPOR5, ., 2, ., 1, ., 80.49230.83000.9477yesno
P32472FKBP2_YEAST5, ., 2, ., 1, ., 80.53900.81690.9259yesno
Q54SR7FKBP2_DICDI5, ., 2, ., 1, ., 80.58190.78430.9022yesno
Q4WHX4FKBP2_ASPFU5, ., 2, ., 1, ., 80.60200.62740.7164yesno
Q6CUZ8FKBP2_KLULA5, ., 2, ., 1, ., 80.49320.90840.9928yesno
P0CP96FKBP2_CRYNJ5, ., 2, ., 1, ., 80.52230.84960.9219yesno
P0CP97FKBP2_CRYNB5, ., 2, ., 1, ., 80.52230.84960.9219N/Ano
Q5ATN7FKBP2_EMENI5, ., 2, ., 1, ., 80.60.64050.7259yesno
P26885FKBP2_HUMAN5, ., 2, ., 1, ., 80.50700.89540.9647yesno
Q6CGG3FKBP2_YARLI5, ., 2, ., 1, ., 80.52980.84960.9027yesno
Q41649FKB15_VICFA5, ., 2, ., 1, ., 80.81530.84960.8609N/Ano
P45878FKBP2_MOUSE5, ., 2, ., 1, ., 80.51400.89540.9785yesno
P0A0W2FKBP_NEIMB5, ., 2, ., 1, ., 80.55430.60130.8440yesno
Q6BP84FKBP2_DEBHA5, ., 2, ., 1, ., 80.55080.75160.8518yesno
Q6FSC1FKBP2_CANGA5, ., 2, ., 1, ., 80.46090.82350.9264yesno
Q38936FK152_ARATH5, ., 2, ., 1, ., 80.76550.92150.8650yesno
Q38935FK151_ARATH5, ., 2, ., 1, ., 80.84490.84310.8431nono
P56989FKBP_NEIMA5, ., 2, ., 1, ., 80.55430.60130.8440yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.10.983
4th Layer5.2.1.80.979

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query153
pfam0025494 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t 8e-45
COG0545205 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans 4e-43
PRK11570206 PRK11570, PRK11570, peptidyl-prolyl cis-trans isom 1e-25
PRK10902269 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis- 4e-21
COG1047174 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans 5e-18
PRK15095156 PRK15095, PRK15095, FKBP-type peptidyl-prolyl cis- 1e-07
TIGR00115 408 TIGR00115, tig, trigger factor 2e-05
PRK01490 435 PRK01490, tig, trigger factor; Provisional 4e-04
COG0544 441 COG0544, Tig, FKBP-type peptidyl-prolyl cis-trans 0.003
>gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase Back     alignment and domain information 
 Score =  141 bits (359), Expect = 8e-45
 Identities = 58/94 (61%), Positives = 67/94 (71%), Gaps = 1/94 (1%)

Query: 45  CDIQAHKGDKIKVHYRGKLTDGTVFDSSFERGDPIEFELGSGHVIKGWDQGLLGMCVGEK 104
              +A KGD + VHY GKL DGTVFDSS +RG P EF LGSG VI GWD+GLLGM VGEK
Sbjct: 1   GPEKAKKGDTVTVHYTGKLEDGTVFDSSKDRGKPFEFTLGSGQVIPGWDEGLLGMKVGEK 60

Query: 105 RKLKIPAKLGYGAQGS-PPTIPGGATLIFDTELV 137
           RKL IP +L YG +G     IP  ATL+F+ EL+
Sbjct: 61  RKLTIPPELAYGEEGLAGGVIPPNATLVFEVELL 94

Length = 94
>gnl|CDD|223619 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|183207 PRK11570, PRK11570, peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|236791 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|223976 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237908 PRK15095, PRK15095, FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|232831 TIGR00115, tig, trigger factor Back     alignment and domain information
>gnl|CDD|234956 PRK01490, tig, trigger factor; Provisional Back     alignment and domain information
>gnl|CDD|223618 COG0544, Tig, FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 153
COG0545205 FkpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.98
KOG0549188 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.96
PRK11570206 peptidyl-prolyl cis-trans isomerase; Provisional 99.96
KOG0544108 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.95
PRK10902269 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.94
TIGR03516177 ppisom_GldI peptidyl-prolyl isomerase, gliding mot 99.94
PF0025494 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer 99.91
KOG0552226 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.9
PRK15095156 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.81
COG1047174 SlpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.75
PRK10737196 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.74
KOG0543 397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.69
TIGR00115 408 tig trigger factor. Trigger factor is a ribosome-a 99.4
PRK01490 435 tig trigger factor; Provisional 99.36
COG0544 441 Tig FKBP-type peptidyl-prolyl cis-trans isomerase 99.35
KOG0543 397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.13
KOG0545 329 consensus Aryl-hydrocarbon receptor-interacting pr 98.44
KOG0549 188 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.22
PF01346124 FKBP_N: Domain amino terminal to FKBP-type peptidy 92.04
>COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.98  E-value=1.1e-31  Score=195.03  Aligned_cols=119  Identities=50%  Similarity=0.874  Sum_probs=112.2

Q ss_pred             hhhHHhccCCCceeeecceEEee--CCCccccCCCCEEEEEEEEEeCCCCEEecccCCCccEEEEeCCCchhHHHHHHHc
Q 031781           20 STLVSANKSGDVTELQIGVKYKP--KTCDIQAHKGDKIKVHYRGKLTDGTVFDSSFERGDPIEFELGSGHVIKGWDQGLL   97 (153)
Q Consensus        20 ~~~~~~~~~~~~~~~~~g~~~~~--~~~~~~~~~gd~V~v~y~~~~~dg~~~~st~~~~~~~~~~lg~~~~~~g~~~al~   97 (153)
                      .+++.+++.+.+.++++|++|++  .+.|..++.+|.|++||++++.||++||+++.+++|+.|.++  .+|+||.++|.
T Consensus        85 ~f~~~~~k~~~v~~~~sgl~y~~~~~G~G~~~~~~~~V~vhY~G~l~~G~vFDsS~~rg~p~~f~l~--~vI~Gw~egl~  162 (205)
T COG0545          85 AFLEKNAKEKGVKTLPSGLQYKVLKAGDGAAPKKGDTVTVHYTGTLIDGTVFDSSYDRGQPAEFPLG--GVIPGWDEGLQ  162 (205)
T ss_pred             HHHhhhcccCCceECCCCcEEEEEeccCCCCCCCCCEEEEEEEEecCCCCccccccccCCCceeecC--CeeehHHHHHh
Confidence            46678888999999999999987  567899999999999999999999999999999999999999  99999999999


Q ss_pred             CCCCCcEEEEEeeCCCCCCCCCCCCCCCCCCeEEEEEEEEeec
Q 031781           98 GMCVGEKRKLKIPAKLGYGAQGSPPTIPGGATLIFDTELVTVN  140 (153)
Q Consensus        98 ~mk~G~~~~~~vp~~~ayg~~g~~~~ip~~~~l~~~v~l~~i~  140 (153)
                      +|++|++++++|||++|||..+.++.||||++|+|+|+|++|.
T Consensus       163 ~M~vG~k~~l~IP~~laYG~~g~~g~Ippns~LvFeVeLl~v~  205 (205)
T COG0545         163 GMKVGGKRKLTIPPELAYGERGVPGVIPPNSTLVFEVELLDVK  205 (205)
T ss_pred             hCCCCceEEEEeCchhccCcCCCCCCCCCCCeEEEEEEEEecC
Confidence            9999999999999999999999876799999999999999874

>KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0544 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated Back     alignment and domain information
>PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 Back     alignment and domain information
>KOG0552 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00115 tig trigger factor Back     alignment and domain information
>PRK01490 tig trigger factor; Provisional Back     alignment and domain information
>COG0544 Tig FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01346 FKBP_N: Domain amino terminal to FKBP-type peptidyl-prolyl isomerase; InterPro: IPR000774 Peptidyl-prolyl cis-trans isomerase (PPIase) catalyses the cis-trans isomerisation of proline imidic peptide bonds in oligopeptides [, ] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query153
2pbc_A102 Fk506-Binding Protein 2 Length = 102 4e-31
4dz3_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 7e-25
3uqa_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 2e-24
3uf8_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 5e-24
2ke0_A117 Solution Structure Of Peptidyl-Prolyl Cis-Trans Iso 8e-24
2y78_A133 Crystal Structure Of Bpss1823, A Mip-Like Chaperone 9e-24
4ggq_C209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 9e-24
3vaw_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 1e-23
2lgo_A130 Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prol 1e-23
3jxv_A 356 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 4e-23
3jym_A 377 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 5e-23
3uqb_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 8e-23
1r9h_A135 Structural Genomics Of C.Elegans: Fkbp-Type Peptidy 1e-21
4dip_A125 Crystal Structure Of Human Peptidyl-Prolyl Cis-Tran 2e-20
1yat_A113 Improved Calcineurin Inhibition By Yeast Fkbp12-Dru 3e-20
4dz2_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 9e-20
1u79_A129 Crystal Structure Of Atfkbp13 Length = 129 1e-19
1rot_A149 Structure Of Fkbp59-I, The N-Terminal Domain Of A 5 2e-19
1n1a_A140 Crystal Structure Of The N-Terminal Domain Of Human 2e-19
3uqi_A108 Crystallographic Structure Of Fkbp12 From Aedes Aeg 2e-19
1q1c_A 280 Crystal Structure Of N(1-260) Of Human Fkbp52 Lengt 3e-19
4drj_A144 O-crystal Structure Of The Ppiase Domain Of Fkbp52, 3e-19
1kt0_A 457 Structure Of The Large Fkbp-like Protein, Fkbp51, I 5e-19
3o5e_A144 Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 9e-19
4drh_A144 Co-crystal Structure Of The Ppiase Domain Of Fkbp51 1e-18
3o5g_A128 Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 1e-18
3o5l_A128 Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Le 1e-18
1kt1_A 457 Structure Of The Large Fkbp-Like Protein, Fkbp51, I 2e-18
3o5d_A 264 Crystal Structure Of A Fragment Of Fkbp51 Comprisin 2e-18
2ki3_A126 Structural And Biochemical Characterization Of Fk50 2e-18
1fkk_A107 Atomic Structure Of Fkbp12, An Immunophilin Binding 4e-18
1fkb_A107 Atomic Structure Of The Rapamycin Human Immunophili 6e-18
3h9r_B109 Crystal Structure Of The Kinase Domain Of Type I Ac 7e-18
2fap_A107 The Structure Of The Immunophilin-Immunosuppressant 8e-18
2ppp_A107 Crystal Structure Of E60q Mutant Of Fkbp12 Length = 1e-17
1tco_C107 Ternary Complex Of A Calcineurin A Fragment, Calcin 1e-17
2ppo_A107 Crystal Structure Of E60a Mutant Of Fkbp12 Length = 2e-17
1bkf_A107 Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX 3e-17
1eym_A107 Fk506 Binding Protein Mutant, Homodimeric Complex L 4e-17
1bl4_A107 Fkbp Mutant F36v Complexed With Remodeled Synthetic 5e-17
2dg4_A107 Fk506-Binding Protein Mutant Wf59 Complexed With Ra 1e-16
2vn1_A129 Crystal Structure Of The Fk506-Binding Domain Of Pl 1e-16
2ofn_A135 Solution Structure Of Fk506-Binding Domain (Fkbd)of 1e-16
2dg9_A107 Fk506-Binding Protein Mutant Wl59 Complexed With Ra 2e-16
1c9h_A107 Crystal Structure Of Fkbp12.6 In Complex With Rapam 3e-16
1jvw_A167 Trypanosoma Cruzi Macrophage Infectivity Potentiato 9e-16
1pbk_A116 Homologous Domain Of Human Fkbp25 Length = 116 1e-15
3kz7_A119 C-Terminal Domain Of Murine Fkbp25 Rapamycin Comple 1e-15
1q6u_A245 Crystal Structure Of Fkpa From Escherichia Coli Len 3e-14
1q6h_A224 Crystal Structure Of A Truncated Form Of Fkpa From 3e-13
2uz5_A137 Solution Structure Of The Fkbp-Domain Of Legionella 3e-11
1fd9_A213 Crystal Structure Of The Macrophage Infectivity Pot 3e-11
1ix5_A151 Solution Structure Of The Methanococcus Thermolitho 6e-11
3oe2_A219 1.6 A Crystal Structure Of Peptidyl-Prolyl Cis-Tran 3e-10
3b7x_A134 Crystal Structure Of Human Fk506-Binding Protein 6 2e-06
4dt4_A169 Crystal Structure Of The Ppiase-Chaperone Slpa With 3e-05
2f2d_A121 Solution Structure Of The Fk506-Binding Domain Of H 5e-05
2awg_A118 Structure Of The Ppiase Domain Of The Human Fk506-B 6e-05
3prb_A 231 Structural Analysis Of Protein Folding By The Metha 1e-04
2d9f_A135 Solution Structure Of Ruh-047, An Fkbp Domain From 2e-04
3pr9_A157 Structural Analysis Of Protein Folding By The Metha 3e-04
2jwx_A157 Solution Structure Of The N-Terminal Domain Of Huma 4e-04
>pdb|2PBC|A Chain A, Fk506-Binding Protein 2 Length = 102 Back     alignment and structure 
Iteration: 1

 Score =  130 bits (326), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 59/94 (62%), Positives = 73/94 (77%)
Query: 47  IQAHKGDKIKVHYRGKLTDGTVFDSSFERGDPIEFELGSGHVIKGWDQGLLGMCVGEKRK 106
           I++ KGD + +HY GKL DGT FDSS  +  P  F LG+G VIKGWDQGLLGMC GEKRK
Sbjct: 4   IKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRK 63
Query: 107 LKIPAKLGYGAQGSPPTIPGGATLIFDTELVTVN 140
           L IP++LGYG +G+PP IPGGATL+F+ EL+ + 
Sbjct: 64  LVIPSELGYGERGAPPKIPGGATLVFEVELLKIE 97
>pdb|4DZ3|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation M61h From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|3UQA|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation A54e From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|3UF8|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With A G95a Surface Mutation From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|2KE0|A Chain A, Solution Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 117 Back     alignment and structure
>pdb|2Y78|A Chain A, Crystal Structure Of Bpss1823, A Mip-Like Chaperone From Burkholderia Pseudomallei Length = 133 Back     alignment and structure
>pdb|4GGQ|C Chain C, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Complexed With Cj40 Length = 209 Back     alignment and structure
>pdb|3VAW|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation V3i From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|2LGO|A Chain A, Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prolyl Cis-Trans Isomerase From Giardia Lamblia, Seattle Structural Genomics Center For Infectious Disease Target Gilaa.00840.A Length = 130 Back     alignment and structure
>pdb|3JXV|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 356 Back     alignment and structure
>pdb|3JYM|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 377 Back     alignment and structure
>pdb|3UQB|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation D44g From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|1R9H|A Chain A, Structural Genomics Of C.Elegans: Fkbp-Type Peptidylprolyl Isomerase Length = 135 Back     alignment and structure
>pdb|4DIP|A Chain A, Crystal Structure Of Human Peptidyl-Prolyl Cis-Trans Isomerase Fkbp14 Length = 125 Back     alignment and structure
>pdb|1YAT|A Chain A, Improved Calcineurin Inhibition By Yeast Fkbp12-Drug Complexes. Crystallographic And Functional Analysis Length = 113 Back     alignment and structure
>pdb|4DZ2|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation R92g From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|1U79|A Chain A, Crystal Structure Of Atfkbp13 Length = 129 Back     alignment and structure
>pdb|1ROT|A Chain A, Structure Of Fkbp59-I, The N-Terminal Domain Of A 59 Kda Fk506-Binding Protein, Nmr, Minimized Average Structure Length = 149 Back     alignment and structure
>pdb|1N1A|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Fkbp52 Length = 140 Back     alignment and structure
>pdb|3UQI|A Chain A, Crystallographic Structure Of Fkbp12 From Aedes Aegypti Length = 108 Back     alignment and structure
>pdb|1Q1C|A Chain A, Crystal Structure Of N(1-260) Of Human Fkbp52 Length = 280 Back     alignment and structure
>pdb|4DRJ|A Chain A, O-crystal Structure Of The Ppiase Domain Of Fkbp52, Rapamycin And The Frb Fragment Of Mtor Length = 144 Back     alignment and structure
>pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|3O5E|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 Back     alignment and structure
>pdb|4DRH|A Chain A, Co-crystal Structure Of The Ppiase Domain Of Fkbp51, Rapamycin And The Frb Fragment Of Mtor At Low Ph Length = 144 Back     alignment and structure
>pdb|3O5G|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 Back     alignment and structure
>pdb|3O5L|A Chain A, Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Length = 128 Back     alignment and structure
>pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|3O5D|A Chain A, Crystal Structure Of A Fragment Of Fkbp51 Comprising The Fk1 And Fk2 Domains Length = 264 Back     alignment and structure
>pdb|2KI3|A Chain A, Structural And Biochemical Characterization Of Fk506 Binding Domain From Plasmodium Vivax Length = 126 Back     alignment and structure
>pdb|1FKK|A Chain A, Atomic Structure Of Fkbp12, An Immunophilin Binding Protein Length = 107 Back     alignment and structure
>pdb|1FKB|A Chain A, Atomic Structure Of The Rapamycin Human Immunophilin Fkbp- 12 Complex Length = 107 Back     alignment and structure
>pdb|3H9R|B Chain B, Crystal Structure Of The Kinase Domain Of Type I Activin Receptor (Acvr1) In Complex With Fkbp12 And Dorsomorphin Length = 109 Back     alignment and structure
>pdb|2FAP|A Chain A, The Structure Of The Immunophilin-Immunosuppressant Fkbp12- (C16)-Ethoxy Rapamycin Complex Interacting With Huma Length = 107 Back     alignment and structure
>pdb|2PPP|A Chain A, Crystal Structure Of E60q Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|1TCO|C Chain C, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 107 Back     alignment and structure
>pdb|2PPO|A Chain A, Crystal Structure Of E60a Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|1BKF|A Chain A, Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX WITH Immunosuppressant Fk506 Length = 107 Back     alignment and structure
>pdb|1EYM|A Chain A, Fk506 Binding Protein Mutant, Homodimeric Complex Length = 107 Back     alignment and structure
>pdb|1BL4|A Chain A, Fkbp Mutant F36v Complexed With Remodeled Synthetic Ligand Length = 107 Back     alignment and structure
>pdb|2DG4|A Chain A, Fk506-Binding Protein Mutant Wf59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|2VN1|A Chain A, Crystal Structure Of The Fk506-Binding Domain Of Plasmodium Falciparum Fkbp35 In Complex With Fk506 Length = 129 Back     alignment and structure
>pdb|2OFN|A Chain A, Solution Structure Of Fk506-Binding Domain (Fkbd)of Fkbp35 From Plasmodium Falciparum Length = 135 Back     alignment and structure
>pdb|2DG9|A Chain A, Fk506-Binding Protein Mutant Wl59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|1C9H|A Chain A, Crystal Structure Of Fkbp12.6 In Complex With Rapamycin Length = 107 Back     alignment and structure
>pdb|1JVW|A Chain A, Trypanosoma Cruzi Macrophage Infectivity Potentiator (Tcmip) Length = 167 Back     alignment and structure
>pdb|1PBK|A Chain A, Homologous Domain Of Human Fkbp25 Length = 116 Back     alignment and structure
>pdb|3KZ7|A Chain A, C-Terminal Domain Of Murine Fkbp25 Rapamycin Complex Length = 119 Back     alignment and structure
>pdb|1Q6U|A Chain A, Crystal Structure Of Fkpa From Escherichia Coli Length = 245 Back     alignment and structure
>pdb|1Q6H|A Chain A, Crystal Structure Of A Truncated Form Of Fkpa From Escherichia Coli Length = 224 Back     alignment and structure
>pdb|2UZ5|A Chain A, Solution Structure Of The Fkbp-Domain Of Legionella Pneumophila Mip Length = 137 Back     alignment and structure
>pdb|1FD9|A Chain A, Crystal Structure Of The Macrophage Infectivity Potentiator Protein (Mip) A Major Virulence Factor From Legionella Pneumophila Length = 213 Back     alignment and structure
>pdb|1IX5|A Chain A, Solution Structure Of The Methanococcus Thermolithotrophicus Fkbp Length = 151 Back     alignment and structure
>pdb|3OE2|A Chain A, 1.6 A Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isomerase Ppiase From Pseudomonas Syringae Pv. Tomato Str. Dc3000 (Pspto Dc3000) Length = 219 Back     alignment and structure
>pdb|3B7X|A Chain A, Crystal Structure Of Human Fk506-Binding Protein 6 Length = 134 Back     alignment and structure
>pdb|4DT4|A Chain A, Crystal Structure Of The Ppiase-Chaperone Slpa With The Chaperone Binding Site Occupied By The Linker Of The Purification Tag Length = 169 Back     alignment and structure
>pdb|2F2D|A Chain A, Solution Structure Of The Fk506-Binding Domain Of Human Fkbp38 Length = 121 Back     alignment and structure
>pdb|2AWG|A Chain A, Structure Of The Ppiase Domain Of The Human Fk506-Binding Protein 8 Length = 118 Back     alignment and structure
>pdb|3PRB|A Chain A, Structural Analysis Of Protein Folding By The Methanococcus Jannaschii Chaperone Fkbp26 Length = 231 Back     alignment and structure
>pdb|2D9F|A Chain A, Solution Structure Of Ruh-047, An Fkbp Domain From Human Cdna Length = 135 Back     alignment and structure
>pdb|3PR9|A Chain A, Structural Analysis Of Protein Folding By The Methanococcus Jannaschii Chaperone Fkbp26 Length = 157 Back     alignment and structure
>pdb|2JWX|A Chain A, Solution Structure Of The N-Terminal Domain Of Human Fkbp38 (Fkbp38ntd) Length = 157 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query153
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 8e-58
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 7e-57
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 2e-56
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 3e-56
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 4e-56
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 3e-55
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 5e-55
2ppn_A107 FK506-binding protein 1A; high resolution protein 8e-55
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 1e-54
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 3e-53
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 1e-50
1q1c_A 280 FK506-binding protein 4; rotamase, TPR repeat, nuc 2e-50
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 5e-33
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 5e-50
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 2e-41
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 1e-35
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 5e-49
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 7e-49
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 2e-48
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 6e-46
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 6e-45
1jvw_A167 Macrophage infectivity potentiator; chagas disease 3e-44
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 1e-42
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 1e-42
1fd9_A213 Protein (macrophage infectivity potentiator prote; 6e-41
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 4e-39
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 2e-27
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 1e-38
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 1e-38
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 1e-25
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 1e-23
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 2e-20
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 7e-20
2kfw_A196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 9e-19
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 2e-18
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 7e-18
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 2e-17
3prb_A 231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 1e-16
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 7e-16
1w26_A 432 Trigger factor, TF; chaperone, protein folding, ri 8e-07
1t11_A 392 Trigger factor, TF; helix-turn-helix, four-helix-b 2e-06
1hxv_A113 Trigger factor; FKBP fold, ppiase, chaperone; NMR 1e-05
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 Back     alignment and structure
 Score =  175 bits (446), Expect = 8e-58
 Identities = 55/129 (42%), Positives = 71/129 (55%), Gaps = 3/129 (2%)

Query: 23  VSANKSGDVTELQIGVKY---KPKTCDIQAHKGDKIKVHYRGKLTDGTVFDSSFERGDPI 79
           +S  K     +   GV     K     ++   G  +KVHY G L +GT FDSS +RGD  
Sbjct: 1   MSGEKIDITPKKDGGVLKLIKKEGQGVVKPTTGTTVKVHYVGTLENGTKFDSSRDRGDQF 60

Query: 80  EFELGSGHVIKGWDQGLLGMCVGEKRKLKIPAKLGYGAQGSPPTIPGGATLIFDTELVTV 139
            F LG G+VIKGWD G+  M  GE  +  I +  GYG  GSPP IPGGATLIF+ EL   
Sbjct: 61  SFNLGRGNVIKGWDLGVATMTKGEVAEFTIRSDYGYGDAGSPPKIPGGATLIFEVELFEW 120

Query: 140 NGKPASGEK 148
           + +  S ++
Sbjct: 121 SAEDISPDR 129
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 102 Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Length = 125 Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Length = 133 Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Length = 129 Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Length = 167 Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Length = 213 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Length = 224 Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} Length = 219 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Length = 169 Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Length = 151 Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Length = 171 Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Length = 196 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Length = 151 Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} PDB: 3pra_A Length = 157 Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Length = 231 Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Length = 158 Back     alignment and structure
>1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 Length = 432 Back     alignment and structure
>1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A Length = 392 Back     alignment and structure
>1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 Length = 113 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query153
1jvw_A167 Macrophage infectivity potentiator; chagas disease 99.96
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 99.96
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 99.96
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 99.96
1fd9_A213 Protein (macrophage infectivity potentiator prote; 99.96
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 99.96
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 99.95
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.95
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 99.95
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 99.95
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 99.95
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 99.94
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.94
2ppn_A107 FK506-binding protein 1A; high resolution protein 99.94
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 99.94
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 99.94
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 99.94
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 99.94
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 99.94
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 99.94
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 99.93
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 99.92
2lkn_A165 AH receptor-interacting protein; FKBP-type domain, 99.92
1q1c_A 280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.9
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.88
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.88
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 99.87
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 99.86
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.84
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 99.83
1hxv_A113 Trigger factor; FKBP fold, ppiase, chaperone; NMR 99.8
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 99.79
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 99.79
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 99.78
2kfw_A196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 99.78
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 99.76
3prb_A231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 99.75
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 99.71
1w26_A 432 Trigger factor, TF; chaperone, protein folding, ri 99.64
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.62
1t11_A 392 Trigger factor, TF; helix-turn-helix, four-helix-b 99.55
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.3
3gty_X 433 Trigger factor, TF; chaperone-client complex, cell 98.87
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Back     alignment and structure
Probab=99.96  E-value=1.2e-29  Score=181.97  Aligned_cols=125  Identities=36%  Similarity=0.581  Sum_probs=113.5

Q ss_pred             HHHhhhHHhccCCCceeeecceEEee--CCCccc-cCCCCEEEEEEEEEeCCCCEEecccCCCccEEEEeCCCchhHHHH
Q 031781           17 LVLSTLVSANKSGDVTELQIGVKYKP--KTCDIQ-AHKGDKIKVHYRGKLTDGTVFDSSFERGDPIEFELGSGHVIKGWD   93 (153)
Q Consensus        17 ~~~~~~~~~~~~~~~~~~~~g~~~~~--~~~~~~-~~~gd~V~v~y~~~~~dg~~~~st~~~~~~~~~~lg~~~~~~g~~   93 (153)
                      ..-.|++++++.+.+.++++|++|++  .+.|.. ++.||.|++||++++.||++|++++..+.|+.|.+|  ++++||+
T Consensus        18 ~~~~~l~~~~~~~~~~~~~sGl~~~vl~~G~G~~~~~~gd~V~v~Y~g~l~dG~~fdss~~~g~p~~f~lg--~vI~G~e   95 (167)
T 1jvw_A           18 VGRLFMEQKAAQPDAVKLPSGLVFQRIARGSGKRAPAIDDKCEVHYTGRLRDGTVFDSSRERGKPTTFRPN--EVIKGWT   95 (167)
T ss_dssp             HHHHHHHHHHHSTTEEECTTSCEEEEEECCCCSBCCCTTCCEEEEEEEECTTSCEEEEHHHHTSCEEECGG--GSCHHHH
T ss_pred             HHHHHHHhcccCCCcEECCCCEEEEEEEcCCCCcCCCCCCEEEEEEEEEECCCCEEeeccccCCCEEEEeC--chhHHHH
Confidence            34567778888899999999999987  456777 999999999999998899999999877789999995  8999999


Q ss_pred             HHHcCCCCCcEEEEEeeCCCCCCCCCCCCCCCCCCeEEEEEEEEeecCCC
Q 031781           94 QGLLGMCVGEKRKLKIPAKLGYGAQGSPPTIPGGATLIFDTELVTVNGKP  143 (153)
Q Consensus        94 ~al~~mk~G~~~~~~vp~~~ayg~~g~~~~ip~~~~l~~~v~l~~i~~~~  143 (153)
                      ++|.+|++|+++++.|||+++||..+.++.||||++|+|+|+|++|++.+
T Consensus        96 eaL~gMk~Ge~~~~~Ip~~laYG~~g~~~~Ipp~s~LiF~VeL~~i~~~~  145 (167)
T 1jvw_A           96 EALQLMREGDRWRLFIPYDLAYGVTGGGGMIPPYSPLEFDVELISIKDGG  145 (167)
T ss_dssp             HHHTTCCTTCEEEEEECGGGTTTTTCSSSSSCTTCCEEEEEEEEEEGGGC
T ss_pred             HHHcCCCCCCEEEEEECchhhCCCCCCCCCcCCCCeEEEEEEEEEEEcCC
Confidence            99999999999999999999999999877899999999999999998643
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} SCOP: d.26.1.0 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Back     alignment and structure
>1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Back     alignment and structure
>1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3gty_X Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chapero isomerase, rotamase, ribonucleoprotein, binding; 3.40A {Thermotoga maritima} PDB: 3gu0_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 153
d1fd9a_204 d.26.1.1 (A:) Macrophage infectivity potentiator p 1e-28
d1q6ha_210 d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 2e-28
d1r9ha_118 d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd 8e-27
d1yata_113 d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeas 2e-25
d1q1ca1120 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu 3e-25
d1kt1a2111 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Mo 1e-23
d1pbka_116 d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 1e-23
d2ppna1107 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12) 5e-23
d1jvwa_160 d.26.1.1 (A:) Macrophage infectivity potentiator p 1e-22
d1kt1a3115 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {M 3e-22
d1hxva_85 d.26.1.1 (A:) Trigger factor PPIase domain {Mycopl 2e-19
d1u79a_125 d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis tha 4e-19
d1q1ca2117 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {H 4e-19
d1ix5a_151 d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcu 2e-18
d1t11a3113 d.26.1.1 (A:135-247) Trigger factor PPIase domain 4e-06
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Length = 204 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: Macrophage infectivity potentiator protein (MIP)
species: Legionella pneumophila [TaxId: 446]

 Score =  102 bits (255), Expect = 1e-28
 Identities = 40/120 (33%), Positives = 56/120 (46%), Gaps = 4/120 (3%)

Query: 22  LVSANKSGDVTELQIGVKYKPKTCD--IQAHKGDKIKVHYRGKLTDGTVFDSSFERGDPI 79
           L        V  L  G++YK       ++  K D + V Y G+L DGTVFDS+ + G P 
Sbjct: 84  LTENKNKPGVVVLPSGLQYKVINSGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPA 143

Query: 80  EFELGSGHVIKGWDQGLLGMCVGEKRKLKIPAKLGYGAQGSPPTIPGGATLIFDTELVTV 139
            F      VI GW + L  M  G   ++ +P+ L YG +     I    TLIF   L++V
Sbjct: 144 TF--QVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISV 201
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 113 Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 111 Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Length = 160 Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 115 Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Length = 85 Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 125 Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Length = 151 Back     information, alignment and structure
>d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} Length = 113 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query153
d1fd9a_204 Macrophage infectivity potentiator protein (MIP) { 99.97
d1q6ha_210 Peptidyl-prolyl cis-trans isomerase FkpA {Escheric 99.97
d1jvwa_160 Macrophage infectivity potentiator protein (MIP) { 99.96
d1q1ca1120 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.96
d2ppna1107 FK-506 binding protein (FKBP12), an immunophilin { 99.95
d1r9ha_118 FKB-6, N-terminal domain {Caenorhabditis elegans [ 99.95
d1kt1a2111 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.95
d1yata_113 Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc 99.95
d1u79a_125 FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 99.94
d1pbka_116 FKBP25 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1kt1a3115 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.9
d1q1ca2117 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.88
d1ix5a_151 Archaeal FKBP {Archaeon Methanococcus thermolithot 99.77
d1hxva_85 Trigger factor PPIase domain {Mycoplasma genitaliu 99.74
d1l1pa_106 Trigger factor PPIase domain {Escherichia coli [Ta 99.57
d1t11a3113 Trigger factor PPIase domain {Vibrio cholerae [Tax 99.48
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: Macrophage infectivity potentiator protein (MIP)
species: Legionella pneumophila [TaxId: 446]

Probab=99.97  E-value=7.7e-31  Score=192.07  Aligned_cols=122  Identities=33%  Similarity=0.564  Sum_probs=113.7

Q ss_pred             HHhhhHHhccCCCceeeecceEEee--CCCccccCCCCEEEEEEEEEeCCCCEEecccCCCccEEEEeCCCchhHHHHHH
Q 031781           18 VLSTLVSANKSGDVTELQIGVKYKP--KTCDIQAHKGDKIKVHYRGKLTDGTVFDSSFERGDPIEFELGSGHVIKGWDQG   95 (153)
Q Consensus        18 ~~~~~~~~~~~~~~~~~~~g~~~~~--~~~~~~~~~gd~V~v~y~~~~~dg~~~~st~~~~~~~~~~lg~~~~~~g~~~a   95 (153)
                      ...|++++++.+.+.+++||++|++  .+.|..|..||.|.+||++++.||++|++++..+.|++|.++  ++++||+++
T Consensus        80 ~~~fl~~~~~~~~v~~~~sGl~y~v~~~G~G~~p~~~d~v~v~y~g~l~dg~~f~~s~~~~~p~~~~~~--~~i~G~~e~  157 (204)
T d1fd9a_          80 GEAFLTENKNKPGVVVLPSGLQYKVINSGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVS--QVIPGWTEA  157 (204)
T ss_dssp             HHHHHHHHHHSTTEEECTTSCEEEEEECCCSCCCCTTCEEEEEEEEEETTSCEEEEHHHHCSCEEEEGG--GSCHHHHHH
T ss_pred             HHHHHHhcccCCceEEecCccEEEEeecCCCcccCCCCEEEEEEEEEECCCCEecccccCCCCceecCC--ccchhHHHH
Confidence            4467788888899999999999987  567889999999999999999999999999988889999887  899999999


Q ss_pred             HcCCCCCcEEEEEeeCCCCCCCCCCCCCCCCCCeEEEEEEEEeecC
Q 031781           96 LLGMCVGEKRKLKIPAKLGYGAQGSPPTIPGGATLIFDTELVTVNG  141 (153)
Q Consensus        96 l~~mk~G~~~~~~vp~~~ayg~~g~~~~ip~~~~l~~~v~l~~i~~  141 (153)
                      |.+|++|++++++|||+++||..|.++.||||++|+|+|+|++|++
T Consensus       158 l~~m~~G~~~~~~iP~~laYG~~g~~~~Ipp~s~l~feveL~~i~k  203 (204)
T d1fd9a_         158 LQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKK  203 (204)
T ss_dssp             HTTCCTTCEEEEEECGGGTTTTCCCSSSCCTTCCEEEEEEEEEEEC
T ss_pred             hcCCCCCCEEEEEEChHHCcCCCCCCCCcCcCCcEEEEEEEEEEEc
Confidence            9999999999999999999999999878999999999999999986
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Back     information, alignment and structure
>d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure