Citrus Sinensis ID: 031912

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150
MDQMDNAYRNQIAAILRVLNLTTCLREDRVPFEIEQGLFLGSIGAASNKDALKSRNITHILTVANALAPAHPNDFVYKVIGVADKEDTNLSQYFDECISFIDEAKRQRGGVLVHCFAGRSRRCHLFPHLGYFSMIILVYSNDNRPSESGK
cccccHHHHHHHHHHHHHHHHccccccccccccccccEEEccHHHcccHHHHHHccccEEEEccccccccccccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHcHHHHHHHHHHcccccccc
ccccccHHccHHHHHHHHHccccccccccccEEEcccEEEccHHHHHcHHHHHHcccEEEEEEcccccccccccEEEEEcccccccccccHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHccccHHHHHHHHHHcccccccc
MDQMDNAYRNQIAAILRVLNLTtclredrvpfeieqglflgsigaasnkdalksrnITHILTVANalapahpndfVYKVIGvadkedtnlsQYFDECISFIDEAkrqrggvlvhcfagrsrrchlfphlGYFSMIILVYsndnrpsesgk
MDQMDNAYRNQIAAILRVLNLTTCLREDRVPFEIEQGLFLGSIGAASNKDALKSRNITHILTVANALAPAHPNDFVYKVIGVADKEDTNLSQYFDECISFIDEAKRQRGGVLVHCFAGRSRRCHLFPHLGYFSMIILVYSNdnrpsesgk
MDQMDNAYRNQIAAILRVLNLTTCLREDRVPFEIEQGLFLGSIGAASNKDALKSRNITHILTVANALAPAHPNDFVYKVIGVADKEDTNLSQYFDECISFIDEAKRQRGGVLVHCFAGRSRRCHLFPHLGYFSMIILVYSNDNRPSESGK
*******YRNQIAAILRVLNLTTCLREDRVPFEIEQGLFLGSIGAASNKDALKSRNITHILTVANALAPAHPNDFVYKVIGVADKEDTNLSQYFDECISFIDEAKRQRGGVLVHCFAGRSRRCHLFPHLGYFSMIILVYS**********
***************LRVLNLTTCLREDRVPFEIEQGLFLGSIGAASNKDALKSRNITHILTVANALAPAHPNDFVYKVIGVADKEDTNLSQYFDECISFIDEAKRQRGGVLVHCFAGRSRRCHLFPHLGYFSMIILVYSNDNRPSE***
MDQMDNAYRNQIAAILRVLNLTTCLREDRVPFEIEQGLFLGSIGAASNKDALKSRNITHILTVANALAPAHPNDFVYKVIGVADKEDTNLSQYFDECISFIDEAKRQRGGVLVHCFAGRSRRCHLFPHLGYFSMIILVYSND********
*****NAYRNQIAAILRVLNLTTCLREDRVPFEIEQGLFLGSIGAASNKDALKSRNITHILTVANALAPAHPNDFVYKVIGVADKEDTNLSQYFDECISFIDEAKRQRGGVLVHCFAGRSRRCHLFPHLGYFSMIILVYSNDN*******
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDQMDNAYRNQIAAILRVLNLTTCLREDRVPFEIEQGLFLGSIGAASNKDALKSRNITHILTVANALAPAHPNDFVYKVIGVADKEDTNLSQYFDECISFIDEAKRQRGGVLVHCFAGRSRRCHLFPHLGYFSMIILVYSNDNRPSESGK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query150 2.2.26 [Sep-21-2011]
Q9ZR37198 Dual specificity protein no no 0.806 0.611 0.628 7e-42
Q9M8K7167 Dual specificity protein no no 0.593 0.532 0.674 3e-30
Q8WTR2217 Dual specificity protein yes no 0.586 0.405 0.511 6e-17
Q55CS7834 MAP kinase phosphatase wi yes no 0.6 0.107 0.5 1e-16
Q55CS8695 MAP kinase phosphatase wi no no 0.6 0.129 0.489 6e-16
Q91Z46422 Dual specificity protein yes no 0.606 0.215 0.462 1e-14
Q16829419 Dual specificity protein no no 0.606 0.217 0.462 1e-14
Q63340280 Dual specificity protein yes no 0.606 0.325 0.462 1e-14
Q8K4T5220 Dual specificity protein no no 0.586 0.4 0.454 2e-14
Q1LWL2208 Dual specificity protein no no 0.56 0.403 0.470 9e-14
>sp|Q9ZR37|DUS1_ARATH Dual specificity protein phosphatase 1 OS=Arabidopsis thaliana GN=DSPTP1 PE=1 SV=1 Back     alignment and function desciption
 Score =  169 bits (427), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 76/121 (62%), Positives = 96/121 (79%)

Query: 1   MDQMDNAYRNQIAAILRVLNLTTCLREDRVPFEIEQGLFLGSIGAASNKDALKSRNITHI 60
           +++ +   +NQI A++RV+ +    R+D VP  IEQGL+LGS+ AASNK+ LKS N+THI
Sbjct: 21  IEKYNEKVKNQIQALVRVIKVARTYRDDNVPSLIEQGLYLGSVAAASNKNVLKSYNVTHI 80

Query: 61  LTVANALAPAHPNDFVYKVIGVADKEDTNLSQYFDECISFIDEAKRQRGGVLVHCFAGRS 120
           LTVA++L PAHP+DFVYKV+ V DKEDTNL  YFDEC+ FIDEAKRQ G VLVHCF G+S
Sbjct: 81  LTVASSLRPAHPDDFVYKVVRVVDKEDTNLEMYFDECVDFIDEAKRQGGSVLVHCFVGKS 140

Query: 121 R 121
           R
Sbjct: 141 R 141
Has a dual specificity toward Ser/Thr and Tyr-containing proteins. Dephosphorylates MPK4 in vitro.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8
>sp|Q9M8K7|DUS1B_ARATH Dual specificity protein phosphatase 1B OS=Arabidopsis thaliana GN=DSPTP1B PE=1 SV=1 Back     alignment and function description
>sp|Q8WTR2|DUS19_HUMAN Dual specificity protein phosphatase 19 OS=Homo sapiens GN=DUSP19 PE=1 SV=1 Back     alignment and function description
>sp|Q55CS7|MPL1_DICDI MAP kinase phosphatase with leucine-rich repeats protein 1 OS=Dictyostelium discoideum GN=mpl1 PE=2 SV=1 Back     alignment and function description
>sp|Q55CS8|MPL2_DICDI MAP kinase phosphatase with leucine-rich repeats protein 2 OS=Dictyostelium discoideum GN=mpl2 PE=3 SV=2 Back     alignment and function description
>sp|Q91Z46|DUS7_MOUSE Dual specificity protein phosphatase 7 OS=Mus musculus GN=Dusp7 PE=2 SV=4 Back     alignment and function description
>sp|Q16829|DUS7_HUMAN Dual specificity protein phosphatase 7 OS=Homo sapiens GN=DUSP7 PE=1 SV=4 Back     alignment and function description
>sp|Q63340|DUS7_RAT Dual specificity protein phosphatase 7 (Fragment) OS=Rattus norvegicus GN=Dusp7 PE=2 SV=1 Back     alignment and function description
>sp|Q8K4T5|DUS19_MOUSE Dual specificity protein phosphatase 19 OS=Mus musculus GN=Dusp19 PE=2 SV=1 Back     alignment and function description
>sp|Q1LWL2|DS22A_DANRE Dual specificity protein phosphatase 22-A OS=Danio rerio GN=dusp22a PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query150
255552233174 Dual specificity protein phosphatase, pu 0.806 0.695 0.727 4e-48
224114217176 predicted protein [Populus trichocarpa] 0.8 0.681 0.683 4e-43
225432538173 PREDICTED: protein phosphatase Slingshot 0.806 0.699 0.694 4e-43
334185572228 dual specificity protein phosphatase 1 [ 0.806 0.530 0.628 4e-40
15229482198 dual specificity protein phosphatase 1 [ 0.806 0.611 0.628 5e-40
186510352201 dual specificity protein phosphatase 1 [ 0.806 0.601 0.628 5e-40
388502248183 unknown [Medicago truncatula] 0.806 0.661 0.644 7e-40
9294518198 dual-specificity protein phosphatase-lik 0.806 0.611 0.628 7e-40
297831114203 dual specificity protein phosphatase [Ar 0.806 0.596 0.628 1e-39
351724277182 uncharacterized protein LOC100306342 [Gl 0.8 0.659 0.616 4e-37
>gi|255552233|ref|XP_002517161.1| Dual specificity protein phosphatase, putative [Ricinus communis] gi|223543796|gb|EEF45324.1| Dual specificity protein phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  196 bits (497), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 88/121 (72%), Positives = 106/121 (87%)

Query: 1   MDQMDNAYRNQIAAILRVLNLTTCLREDRVPFEIEQGLFLGSIGAASNKDALKSRNITHI 60
           M++ D + +NQIAA++RV+N+T C +ED +P +IE+GLFLGS GAA NKD LKS+NITHI
Sbjct: 1   MEKTDGSIKNQIAALMRVINVTRCFKEDNIPCKIEEGLFLGSFGAAHNKDILKSKNITHI 60

Query: 61  LTVANALAPAHPNDFVYKVIGVADKEDTNLSQYFDECISFIDEAKRQRGGVLVHCFAGRS 120
           LTVAN+LAPAH NDFVYK+IGVAD+EDTNL QYFDEC +FIDEAKRQ GGVLVHCF G+S
Sbjct: 61  LTVANSLAPAHRNDFVYKIIGVADREDTNLRQYFDECFNFIDEAKRQGGGVLVHCFVGKS 120

Query: 121 R 121
           R
Sbjct: 121 R 121

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224114217|ref|XP_002332403.1| predicted protein [Populus trichocarpa] gi|222832336|gb|EEE70813.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225432538|ref|XP_002280487.1| PREDICTED: protein phosphatase Slingshot homolog [Vitis vinifera] gi|297736986|emb|CBI26187.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|334185572|ref|NP_001189955.1| dual specificity protein phosphatase 1 [Arabidopsis thaliana] gi|332643265|gb|AEE76786.1| dual specificity protein phosphatase 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15229482|ref|NP_189003.1| dual specificity protein phosphatase 1 [Arabidopsis thaliana] gi|75267847|sp|Q9ZR37.1|DUS1_ARATH RecName: Full=Dual specificity protein phosphatase 1; Short=AtDsPTP1 gi|4150963|emb|CAA77232.1| DsPTP1 protein [Arabidopsis thaliana] gi|332643263|gb|AEE76784.1| dual specificity protein phosphatase 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|186510352|ref|NP_001118683.1| dual specificity protein phosphatase 1 [Arabidopsis thaliana] gi|332643264|gb|AEE76785.1| dual specificity protein phosphatase 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|388502248|gb|AFK39190.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|9294518|dbj|BAB02780.1| dual-specificity protein phosphatase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297831114|ref|XP_002883439.1| dual specificity protein phosphatase [Arabidopsis lyrata subsp. lyrata] gi|297329279|gb|EFH59698.1| dual specificity protein phosphatase [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|351724277|ref|NP_001237308.1| uncharacterized protein LOC100306342 [Glycine max] gi|255628251|gb|ACU14470.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query150
TAIR|locus:2082395167 MKP2 "MAPK phosphatase 2" [Ara 0.593 0.532 0.674 7.7e-31
UNIPROTKB|Q5VNG7199 OJ1460_H08.5 "Uncharacterized 0.793 0.597 0.536 1.7e-27
UNIPROTKB|Q8WTR2217 DUSP19 "Dual specificity prote 0.586 0.405 0.511 3.2e-17
UNIPROTKB|F1RYL2227 DUSP19 "Uncharacterized protei 0.586 0.387 0.5 4.1e-17
UNIPROTKB|A6H7A7227 DUSP19 "Uncharacterized protei 0.586 0.387 0.511 5.3e-17
UNIPROTKB|F1NG52207 DUSP19 "Uncharacterized protei 0.56 0.405 0.5 2.3e-16
UNIPROTKB|E2RKL4227 DUSP19 "Uncharacterized protei 0.56 0.370 0.5 2.9e-16
DICTYBASE|DDB_G0269918834 mpl1 "putative protein tyrosin 0.6 0.107 0.5 6.8e-16
DICTYBASE|DDB_G0270688695 mpl2 "putative protein tyrosin 0.6 0.129 0.489 1.4e-15
MGI|MGI:1915332220 Dusp19 "dual specificity phosp 0.586 0.4 0.454 4.2e-15
TAIR|locus:2082395 MKP2 "MAPK phosphatase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 317 (116.6 bits), Expect = 7.7e-31, Sum P(2) = 7.7e-31
 Identities = 60/89 (67%), Positives = 73/89 (82%)

Query:    33 EIEQGLFLGSIGAASNKDALKSRNITHILTVANALAPAHPNDFVYKVIGVADKEDTNLSQ 92
             EI+QGLF+GS+  A+NKD LKS NITH+LTVA ALAP +P+DFVYKVI V D+ +T+L+ 
Sbjct:    27 EIQQGLFIGSVAEANNKDFLKSSNITHVLTVAVALAPPYPDDFVYKVIEVVDRSETDLTV 86

Query:    93 YFDECISFIDEAKRQRGGVLVHCFAGRSR 121
             YFDEC SFID+A +  GGVLVHCF G SR
Sbjct:    87 YFDECYSFIDQAIQSGGGVLVHCFMGMSR 115
GO:0005737 "cytoplasm" evidence=ISM;IDA
GO:0006470 "protein dephosphorylation" evidence=IEA;IBA
GO:0008138 "protein tyrosine/serine/threonine phosphatase activity" evidence=IEA;ISS;IBA
GO:0016311 "dephosphorylation" evidence=IEA
GO:0016791 "phosphatase activity" evidence=IEA
GO:0005516 "calmodulin binding" evidence=IDA
GO:0005634 "nucleus" evidence=IDA
GO:0006979 "response to oxidative stress" evidence=IMP
GO:0007243 "intracellular protein kinase cascade" evidence=IC;RCA
GO:0010193 "response to ozone" evidence=IMP
GO:0033549 "MAP kinase phosphatase activity" evidence=IDA
GO:0043407 "negative regulation of MAP kinase activity" evidence=RCA;IMP
GO:0005886 "plasma membrane" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0034051 "negative regulation of plant-type hypersensitive response" evidence=IMP
GO:0034599 "cellular response to oxidative stress" evidence=IMP
UNIPROTKB|Q5VNG7 OJ1460_H08.5 "Uncharacterized protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q8WTR2 DUSP19 "Dual specificity protein phosphatase 19" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RYL2 DUSP19 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|A6H7A7 DUSP19 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NG52 DUSP19 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2RKL4 DUSP19 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0269918 mpl1 "putative protein tyrosine phosphatase, dual specificity" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0270688 mpl2 "putative protein tyrosine phosphatase, dual specificity" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
MGI|MGI:1915332 Dusp19 "dual specificity phosphatase 19" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3.16LOW CONFIDENCE prediction!
3rd Layer3.1.30.691
3rd Layer3.1.3.480.737

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00019907001
SubName- Full=Chromosome chr5 scaffold_2, whole genome shotgun sequence; (188 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
cd00127139 cd00127, DSPc, Dual specificity phosphatases (DSP) 7e-31
smart00195138 smart00195, DSPc, Dual specificity phosphatase, ca 6e-25
pfam00782131 pfam00782, DSPc, Dual specificity phosphatase, cat 1e-17
COG2453180 COG2453, CDC14, Predicted protein-tyrosine phospha 5e-05
PRK12361 547 PRK12361, PRK12361, hypothetical protein; Provisio 1e-04
>gnl|CDD|238073 cd00127, DSPc, Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information 
 Score =  107 bits (270), Expect = 7e-31
 Identities = 42/91 (46%), Positives = 57/91 (62%), Gaps = 2/91 (2%)

Query: 33  EIEQGLFLGSIGAASNKDALKSRNITHILTVANAL--APAHPNDFVYKVIGVADKEDTNL 90
           EI  GL+LGS  AAS+K+ LK   ITH+L VA  +       +DF Y  + + D    ++
Sbjct: 4   EITPGLYLGSYPAASDKELLKKLGITHVLNVAKEVPNENLFLSDFNYLYVPILDLPSQDI 63

Query: 91  SQYFDECISFIDEAKRQRGGVLVHCFAGRSR 121
           S+YFDE + FID+A+ + G VLVHC AG SR
Sbjct: 64  SKYFDEAVDFIDDAREKGGKVLVHCLAGVSR 94

Structurally similar to tyrosine-specific phosphatases but with a shallower active site cleft and a distinctive active site signature motif, HCxxGxxR. Characterized as VHR- or Cdc25-like. Length = 139
>gnl|CDD|214551 smart00195, DSPc, Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|216117 pfam00782, DSPc, Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|225297 COG2453, CDC14, Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|183473 PRK12361, PRK12361, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 150
smart00195138 DSPc Dual specificity phosphatase, catalytic domai 99.98
KOG1717343 consensus Dual specificity phosphatase [Defense me 99.97
KOG1718198 consensus Dual specificity phosphatase [Defense me 99.97
KOG1716285 consensus Dual specificity phosphatase [Defense me 99.96
cd00127139 DSPc Dual specificity phosphatases (DSP); Ser/Thr 99.96
PF00782133 DSPc: Dual specificity phosphatase, catalytic doma 99.95
PRK12361 547 hypothetical protein; Provisional 99.94
KOG1719183 consensus Dual specificity phosphatase [Defense me 99.84
PTZ00242166 protein tyrosine phosphatase; Provisional 99.83
PTZ00393241 protein tyrosine phosphatase; Provisional 99.82
COG2453180 CDC14 Predicted protein-tyrosine phosphatase [Sign 99.67
KOG1720225 consensus Protein tyrosine phosphatase CDC14 [Defe 99.61
PF05706168 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) 99.49
PF03162164 Y_phosphatase2: Tyrosine phosphatase family; Inter 99.45
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 99.44
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 99.42
KOG2836173 consensus Protein tyrosine phosphatase IVA1 [Signa 99.38
PLN02727 986 NAD kinase 99.17
smart00012105 PTPc_DSPc Protein tyrosine phosphatase, catalytic 99.15
smart00404105 PTPc_motif Protein tyrosine phosphatase, catalytic 99.15
KOG1572249 consensus Predicted protein tyrosine phosphatase [ 98.94
PF13350164 Y_phosphatase3: Tyrosine phosphatase family; PDB: 98.91
cd00047231 PTPc Protein tyrosine phosphatases (PTP) catalyze 98.87
COG3453130 Uncharacterized protein conserved in bacteria [Fun 98.86
smart00194258 PTPc Protein tyrosine phosphatase, catalytic domai 98.82
COG5350172 Predicted protein tyrosine phosphatase [General fu 98.65
PHA02742303 protein tyrosine phosphatase; Provisional 98.65
PHA02740298 protein tyrosine phosphatase; Provisional 98.61
PF14566149 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 98.58
PHA02746323 protein tyrosine phosphatase; Provisional 98.57
PF04179451 Init_tRNA_PT: Initiator tRNA phosphoribosyl transf 98.54
PHA02747312 protein tyrosine phosphatase; Provisional 98.5
PHA02738320 hypothetical protein; Provisional 98.45
PF00102235 Y_phosphatase: Protein-tyrosine phosphatase; Inter 98.43
KOG07921144 consensus Protein tyrosine phosphatase PTPMEG, con 98.41
KOG2283 434 consensus Clathrin coat dissociation kinase GAK/PT 98.39
COG5599302 PTP2 Protein tyrosine phosphatase [Signal transduc 98.29
PRK15375535 pathogenicity island 1 effector protein StpP; Prov 98.24
KOG0790600 consensus Protein tyrosine phosphatase Corkscrew a 98.02
COG2365249 Protein tyrosine/serine phosphatase [Signal transd 97.92
KOG0789415 consensus Protein tyrosine phosphatase [Signal tra 97.71
KOG07931004 consensus Protein tyrosine phosphatase [Signal tra 97.57
KOG0791374 consensus Protein tyrosine phosphatase, contains f 97.34
KOG2386 393 consensus mRNA capping enzyme, guanylyltransferase 97.22
KOG4228 1087 consensus Protein tyrosine phosphatase [Signal tra 96.9
KOG42281087 consensus Protein tyrosine phosphatase [Signal tra 96.47
KOG4471 717 consensus Phosphatidylinositol 3-phosphate 3-phosp 96.4
PF06602353 Myotub-related: Myotubularin-like phosphatase doma 95.28
KOG1089 573 consensus Myotubularin-related phosphatidylinosito 94.87
cd01518101 RHOD_YceA Member of the Rhodanese Homology Domain 93.89
COG0607110 PspE Rhodanese-related sulfurtransferase [Inorgani 92.96
PRK10886 196 DnaA initiator-associating protein DiaA; Provision 90.76
COG0279176 GmhA Phosphoheptose isomerase [Carbohydrate transp 89.85
cd01522117 RHOD_1 Member of the Rhodanese Homology Domain sup 88.47
PF14671141 DSPn: Dual specificity protein phosphatase, N-term 86.57
PLN02160136 thiosulfate sulfurtransferase 83.28
cd01443113 Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda 83.21
PRK00414 192 gmhA phosphoheptose isomerase; Reviewed 83.09
cd01520128 RHOD_YbbB Member of the Rhodanese Homology Domain 80.39
cd01523100 RHOD_Lact_B Member of the Rhodanese Homology Domai 80.02
>smart00195 DSPc Dual specificity phosphatase, catalytic domain Back     alignment and domain information 
Probab=99.98  E-value=2.3e-31  Score=183.88  Aligned_cols=117  Identities=37%  Similarity=0.596  Sum_probs=108.4

Q ss_pred             CeeccCCeEEcChhhcCCHHHHHhCCCceEEEcCCCCCCCCCCCceEEEEeeecCCCCCHHHHHHHHHHHHHHHHhCCCc
Q 031912           31 PFEIEQGLFLGSIGAASNKDALKSRNITHILTVANALAPAHPNDFVYKVIGVADKEDTNLSQYFDECISFIDEAKRQRGG  110 (150)
Q Consensus        31 p~~I~~~LylG~~~~~~~~~~l~~~gI~~Vvnl~~~~~~~~~~~~~~~~ip~~D~~~~~l~~~~~~~~~fI~~~~~~~~~  110 (150)
                      |++|.|+||+|+.+++.+.+.++++||++|||++.+.+.....++.|+++|+.|.+..++.+.|..+++||+..+.+|++
T Consensus         1 ~~~I~~~l~~G~~~~~~~~~~l~~~gi~~Vi~l~~~~~~~~~~~~~~~~ipi~D~~~~~~~~~~~~~~~~i~~~~~~~~~   80 (138)
T smart00195        1 PSEILPHLYLGSYSSALNLALLKKLGITHVINVTNEVPNLNKKGFTYLGVPILDNTETKISPYFPEAVEFIEDAEKKGGK   80 (138)
T ss_pred             CcEEeCCeEECChhHcCCHHHHHHcCCCEEEEccCCCCCCCCCCCEEEEEECCCCCCCChHHHHHHHHHHHHHHhcCCCe
Confidence            78999999999999999999999999999999998876655788999999999987888888999999999999999999


Q ss_pred             EEEEcCCCCcchhhHHHHHHHHH-------HHHHHHHhhcCCCCCC
Q 031912          111 VLVHCFAGRSRRCHLFPHLGYFS-------MIILVYSNDNRPSESG  149 (150)
Q Consensus       111 VLVHC~~G~sRS~~v~~~~aylm-------~~a~~~v~~~Rp~is~  149 (150)
                      |||||.+|+|||++++  ++|+|       .+|+++++++||.+..
T Consensus        81 VlVHC~~G~~RS~~v~--~~yl~~~~~~~~~~A~~~v~~~R~~~~p  124 (138)
T smart00195       81 VLVHCQAGVSRSATLI--IAYLMKYRNLSLNDAYDFVKDRRPIISP  124 (138)
T ss_pred             EEEECCCCCchHHHHH--HHHHHHHhCCCHHHHHHHHHHHCCccCC
Confidence            9999999999999999  89999       3699999999998753

>KOG1717 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>KOG1718 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>KOG1716 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>PRK12361 hypothetical protein; Provisional Back     alignment and domain information
>KOG1719 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>PTZ00242 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PTZ00393 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1720 consensus Protein tyrosine phosphatase CDC14 [Defense mechanisms] Back     alignment and domain information
>PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species Back     alignment and domain information
>PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>KOG2836 consensus Protein tyrosine phosphatase IVA1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN02727 NAD kinase Back     alignment and domain information
>smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>KOG1572 consensus Predicted protein tyrosine phosphatase [Defense mechanisms] Back     alignment and domain information
>PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B Back     alignment and domain information
>cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>COG3453 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00194 PTPc Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>COG5350 Predicted protein tyrosine phosphatase [General function prediction only] Back     alignment and domain information
>PHA02742 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02740 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B Back     alignment and domain information
>PHA02746 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PF04179 Init_tRNA_PT: Initiator tRNA phosphoribosyl transferase ; InterPro: IPR007306 This enzyme (2 Back     alignment and domain information
>PHA02747 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02738 hypothetical protein; Provisional Back     alignment and domain information
>PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>KOG0792 consensus Protein tyrosine phosphatase PTPMEG, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2283 consensus Clathrin coat dissociation kinase GAK/PTEN/Auxilin and related tyrosine phosphatases [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15375 pathogenicity island 1 effector protein StpP; Provisional Back     alignment and domain information
>KOG0790 consensus Protein tyrosine phosphatase Corkscrew and related SH2 domain enzymes [Signal transduction mechanisms] Back     alignment and domain information
>COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0789 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0793 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0791 consensus Protein tyrosine phosphatase, contains fn3 domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2386 consensus mRNA capping enzyme, guanylyltransferase (alpha) subunit [RNA processing and modification] Back     alignment and domain information
>KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4471 consensus Phosphatidylinositol 3-phosphate 3-phosphatase myotubularin MTM1 [Lipid transport and metabolism; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06602 Myotub-related: Myotubularin-like phosphatase domain; InterPro: IPR010569 This family represents a region within eukaryotic myotubularin-related proteins that is sometimes found with IPR004182 from INTERPRO Back     alignment and domain information
>KOG1089 consensus Myotubularin-related phosphatidylinositol 3-phosphate 3-phosphatase MTM6 [General function prediction only] Back     alignment and domain information
>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10886 DnaA initiator-associating protein DiaA; Provisional Back     alignment and domain information
>COG0279 GmhA Phosphoheptose isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 Back     alignment and domain information
>PF14671 DSPn: Dual specificity protein phosphatase, N-terminal half; PDB: 1OHD_A 1OHE_A 1OHC_A Back     alignment and domain information
>PLN02160 thiosulfate sulfurtransferase Back     alignment and domain information
>cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily Back     alignment and domain information
>PRK00414 gmhA phosphoheptose isomerase; Reviewed Back     alignment and domain information
>cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
3s4e_A144 Crystal Structrue Of A Novel Mitogen-Activated Prot 6e-17
3lj8_A146 Crystal Structure Of Mkp-4 Length = 146 8e-14
1mkp_A144 Crystal Structure Of Pyst1 (Mkp3) Length = 144 2e-13
2hxp_A155 Crystal Structure Of The Human Phosphatase (Dusp9) 1e-12
1m3g_A145 Solution Structure Of The Catalytic Domain Of Mapk 3e-10
3ezz_A144 Crystal Structure Of Human Mkp-2 Length = 144 4e-10
2nt2_A145 Crystal Structure Of Slingshot Phosphatase 2 Length 8e-10
1yz4_A160 Crystal Structure Of Dusp15 Length = 160 1e-09
1wrm_A165 Crystal Structure Of Jsp-1 Length = 165 4e-09
2g6z_A211 Crystal Structure Of Human Dusp5 Length = 211 6e-09
2wgp_A190 Crystal Structure Of Human Dual Specificity Phospha 3e-08
2r0b_A154 Crystal Structure Of Human Tyrosine Phosphatase-lik 1e-07
1vhr_A184 Human Vh1-Related Dual-Specificity Phosphatase Leng 1e-07
3f81_A183 Interaction Of Vhr With Sa3 Length = 183 2e-07
2esb_A188 Crystal Structure Of Human Dusp18 Length = 188 2e-07
1j4x_A184 Human Vh1-Related Dual-Specificity Phosphatase C124 2e-06
2e0t_A151 Crystal Structure Of Catalytic Domain Of Dual Speci 5e-06
4hrf_A160 Atomic Structure Of Dusp26 Length = 160 5e-05
1zzw_A149 Crystal Structure Of Catalytic Domain Of Human Map 2e-04
2oud_A177 Crystal Structure Of The Catalytic Domain Of Human 3e-04
2y96_A219 Structure Of Human Dual-Specificity Phosphatase 27 7e-04
2p4d_A172 Structure-Assisted Discovery Of Variola Major H1 Ph 8e-04
>pdb|3S4E|A Chain A, Crystal Structrue Of A Novel Mitogen-Activated Protein Kinase Phosphatase, Skrp1 Length = 144 Back     alignment and structure 
Iteration: 1

 Score = 82.8 bits (203), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 54/88 (61%)
Query: 34  IEQGLFLGSIGAASNKDALKSRNITHILTVANALAPAHPNDFVYKVIGVADKEDTNLSQY 93
           I+  L LGS  AA + D LK   +THIL VA  +  A  +DF YK I + D  +TN+  Y
Sbjct: 7   IKPWLLLGSQDAAHDLDTLKKNKVTHILNVAYGVENAFLSDFTYKSISILDLPETNILSY 66
Query: 94  FDECISFIDEAKRQRGGVLVHCFAGRSR 121
           F EC  FI+EAKR+ G VLVH  AG SR
Sbjct: 67  FPECFEFIEEAKRKDGVVLVHSNAGVSR 94
>pdb|3LJ8|A Chain A, Crystal Structure Of Mkp-4 Length = 146 Back     alignment and structure
>pdb|1MKP|A Chain A, Crystal Structure Of Pyst1 (Mkp3) Length = 144 Back     alignment and structure
>pdb|2HXP|A Chain A, Crystal Structure Of The Human Phosphatase (Dusp9) Length = 155 Back     alignment and structure
>pdb|1M3G|A Chain A, Solution Structure Of The Catalytic Domain Of Mapk Phosphatase Pac-1: Insights Into Substrate-Induced Enzymatic Activation Length = 145 Back     alignment and structure
>pdb|3EZZ|A Chain A, Crystal Structure Of Human Mkp-2 Length = 144 Back     alignment and structure
>pdb|2NT2|A Chain A, Crystal Structure Of Slingshot Phosphatase 2 Length = 145 Back     alignment and structure
>pdb|1YZ4|A Chain A, Crystal Structure Of Dusp15 Length = 160 Back     alignment and structure
>pdb|1WRM|A Chain A, Crystal Structure Of Jsp-1 Length = 165 Back     alignment and structure
>pdb|2G6Z|A Chain A, Crystal Structure Of Human Dusp5 Length = 211 Back     alignment and structure
>pdb|2WGP|A Chain A, Crystal Structure Of Human Dual Specificity Phosphatase 14 Length = 190 Back     alignment and structure
>pdb|2R0B|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase-like Serine/threonine/tyrosine-interacting Protein Length = 154 Back     alignment and structure
>pdb|1VHR|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase Length = 184 Back     alignment and structure
>pdb|3F81|A Chain A, Interaction Of Vhr With Sa3 Length = 183 Back     alignment and structure
>pdb|2ESB|A Chain A, Crystal Structure Of Human Dusp18 Length = 188 Back     alignment and structure
>pdb|1J4X|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase C124s Mutant- Peptide Complex Length = 184 Back     alignment and structure
>pdb|2E0T|A Chain A, Crystal Structure Of Catalytic Domain Of Dual Specificity Phosphatase 26, Ms0830 From Homo Sapiens Length = 151 Back     alignment and structure
>pdb|4HRF|A Chain A, Atomic Structure Of Dusp26 Length = 160 Back     alignment and structure
>pdb|1ZZW|A Chain A, Crystal Structure Of Catalytic Domain Of Human Map Kinase Phosphatase 5 Length = 149 Back     alignment and structure
>pdb|2OUD|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Mkp5 Length = 177 Back     alignment and structure
>pdb|2Y96|A Chain A, Structure Of Human Dual-Specificity Phosphatase 27 Length = 219 Back     alignment and structure
>pdb|2P4D|A Chain A, Structure-Assisted Discovery Of Variola Major H1 Phosphatase Inhibitors Length = 172 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 6e-43
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 2e-42
3emu_A161 Leucine rich repeat and phosphatase domain contain 2e-42
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 3e-42
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 7e-42
2hcm_A164 Dual specificity protein phosphatase; structural g 8e-42
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 8e-42
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 6e-41
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 2e-40
2hxp_A155 Dual specificity protein phosphatase 9; human phos 3e-40
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 4e-40
2oud_A177 Dual specificity protein phosphatase 10; A central 3e-39
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 4e-39
2q05_A195 Late protein H1, dual specificity protein phosphat 9e-39
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 6e-38
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 8e-38
3cm3_A176 Late protein H1, dual specificity protein phosphat 9e-38
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 2e-37
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 6e-36
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 6e-36
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 5e-28
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 2e-27
3nme_A 294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 4e-23
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 5e-11
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 2e-05
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 6e-05
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Length = 144 Back     alignment and structure
 Score =  138 bits (349), Expect = 6e-43
 Identities = 44/89 (49%), Positives = 54/89 (60%)

Query: 33  EIEQGLFLGSIGAASNKDALKSRNITHILTVANALAPAHPNDFVYKVIGVADKEDTNLSQ 92
            I+  L LGS  AA + D LK   +THIL VA  +  A  +DF YK I + D  +TN+  
Sbjct: 6   VIKPWLLLGSQDAAHDLDTLKKNKVTHILNVAYGVENAFLSDFTYKSISILDLPETNILS 65

Query: 93  YFDECISFIDEAKRQRGGVLVHCFAGRSR 121
           YF EC  FI+EAKR+ G VLVH  AG SR
Sbjct: 66  YFPECFEFIEEAKRKDGVVLVHSNAGVSR 94
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Length = 211 Back     alignment and structure
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Length = 161 Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Length = 145 Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Length = 188 Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Length = 164 Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} PDB: 1m3g_A Length = 144 Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Length = 190 Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Length = 160 Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Length = 155 Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Length = 165 Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Length = 177 Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Length = 149 Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Length = 195 Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Length = 154 Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Length = 151 Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Length = 176 Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} PDB: 1vhr_A* 1j4x_A* Length = 183 Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Length = 219 Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Length = 205 Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Length = 157 Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Length = 294 Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Length = 348 Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query150
3emu_A161 Leucine rich repeat and phosphatase domain contain 100.0
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 100.0
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 100.0
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 100.0
2hxp_A155 Dual specificity protein phosphatase 9; human phos 99.97
2hcm_A164 Dual specificity protein phosphatase; structural g 99.97
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 99.97
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 99.97
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 99.97
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 99.97
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 99.97
2oud_A177 Dual specificity protein phosphatase 10; A central 99.97
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 99.97
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 99.97
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 99.97
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 99.96
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 99.96
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 99.96
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 99.95
3cm3_A176 Late protein H1, dual specificity protein phosphat 99.95
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 99.95
3nme_A 294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 99.93
2q05_A195 Late protein H1, dual specificity protein phosphat 99.92
4erc_A150 Dual specificity protein phosphatase 23; alpha bet 99.92
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 99.91
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 99.86
1xri_A151 AT1G05000; structural genomics, protein structure 99.82
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 99.81
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 99.8
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 99.79
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 99.79
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 99.78
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 99.77
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 99.7
2f46_A156 Hypothetical protein; structural genomics, joint c 99.65
1d5r_A 324 Phosphoinositide phosphotase PTEN; C2 domain, phos 99.57
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 99.42
3v0d_A 339 Voltage-sensor containing phosphatase; PTP, hydrol 99.32
3n0a_A 361 Tyrosine-protein phosphatase auxilin; phosphatase- 99.28
1ywf_A296 Phosphotyrosine protein phosphatase PTPB; four str 99.16
3mmj_A314 MYO-inositol hexaphosphate phosphohydrolase; phyta 98.91
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 98.88
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 98.84
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 98.81
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 98.8
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 98.78
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 98.78
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 98.76
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 98.76
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 98.75
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 98.75
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 98.74
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 98.73
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 98.73
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 98.73
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 98.73
3f41_A629 Phytase; tandem repeat, protein tyrosine phosphata 98.71
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 98.71
4az1_A302 Tyrosine specific protein phosphatase; hydrolase, 98.69
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 98.68
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 98.68
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 98.67
3f41_A 629 Phytase; tandem repeat, protein tyrosine phosphata 98.66
4grz_A288 Tyrosine-protein phosphatase non-receptor type 6; 98.66
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 98.65
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 98.65
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 98.65
4i8n_A354 Tyrosine-protein phosphatase non-receptor type 1; 98.64
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 98.63
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 98.62
4ge6_A314 Tyrosine-protein phosphatase non-receptor type 9; 98.6
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 98.54
2jjd_A 599 Receptor-type tyrosine-protein phosphatase epsilo; 98.51
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 98.5
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 98.5
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 98.45
1lar_A 575 Protein (LAR); tyrosine phosphatease, LAR protein, 98.43
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 98.43
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 98.42
1ygr_A 610 CD45 protein tyrosine phosphatase; protein tyrosin 98.41
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 98.4
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 98.38
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 98.26
1ohe_A 348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 96.09
2yf0_A 512 Myotubularin-related protein 6; hydrolase; 2.65A { 95.4
1zsq_A 528 Myotubularin-related protein 2; protein-phospholip 94.91
1lw3_A 657 Myotubularin-related protein 2; protein-phosphate 94.38
3sxu_A150 DNA polymerase III subunit CHI; DNA replication, C 86.25
1vee_A134 Proline-rich protein family; hypothetical protein, 84.7
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 84.56
3trj_A 201 Phosphoheptose isomerase; lipopolysaccharide biosy 82.84
2jtq_A85 Phage shock protein E; solution structure rhodanes 82.0
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Back     alignment and structure
Probab=100.00  E-value=3e-34  Score=202.44  Aligned_cols=121  Identities=20%  Similarity=0.237  Sum_probs=107.8

Q ss_pred             CCCCCeeccCCeEEcChhhcCCHHHHHhCCCceEEEcCCCCCCCCCCCceEEEEeeecCCCCCHHHHHHHHHHHHHHHHh
Q 031912           27 EDRVPFEIEQGLFLGSIGAASNKDALKSRNITHILTVANALAPAHPNDFVYKVIGVADKEDTNLSQYFDECISFIDEAKR  106 (150)
Q Consensus        27 ~~~~p~~I~~~LylG~~~~~~~~~~l~~~gI~~Vvnl~~~~~~~~~~~~~~~~ip~~D~~~~~l~~~~~~~~~fI~~~~~  106 (150)
                      .+..|++|.|+||+|+...+.+.+.|+++||++|||++.+.++.++.++.|+++|+.|.+..++.++|+++++||++++.
T Consensus         6 p~~~~~~I~~~LylG~~~~a~~~~~L~~~gIt~Vlnl~~~~~~~~~~~~~~~~ipi~D~~~~~l~~~~~~~~~fI~~~~~   85 (161)
T 3emu_A            6 PTLSPTQIIQYIHLGSFLNAHNVDYIHNNNISSILLVGIEVPSLFKDQCDILRLDIVSEEGHQLYDSIPNAIKFIIRSIQ   85 (161)
T ss_dssp             GGGSCEEEETTEEEEETTGGGCHHHHHHTTEEEEEEEC-------CTTSEEEEECCCCSSTTHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCceEEECCEEECChHHhhCHHHHHHCCCCEEEEeCCCCccccCCCCEEEEEeCcCCCCCcHHHHHHHHHHHHHHHHh
Confidence            34578999999999999999999999999999999999887766788999999999999999999999999999999999


Q ss_pred             CCCcEEEEcCCCCcchhhHHHHHHHHH-------HHHHHHHhhcCCCCCC
Q 031912          107 QRGGVLVHCFAGRSRRCHLFPHLGYFS-------MIILVYSNDNRPSESG  149 (150)
Q Consensus       107 ~~~~VLVHC~~G~sRS~~v~~~~aylm-------~~a~~~v~~~Rp~is~  149 (150)
                      +|++|||||.+|+|||++++  +||||       .+|+++|+++||.|+.
T Consensus        86 ~~~~VlVHC~~G~sRS~~vv--~ayLm~~~~~s~~~A~~~v~~~Rp~i~p  133 (161)
T 3emu_A           86 RKEGVLIISGTGVNKAPAIV--IAFLMYYQRLSFINAFNKVQGLYPLIDI  133 (161)
T ss_dssp             TTCEEEEEESSSSSHHHHHH--HHHHHHHTTCCHHHHHHHHHHHCTTCCC
T ss_pred             cCCeEEEEcCCCCcHHHHHH--HHHHHHHhCCCHHHHHHHHHHHCCCcCC
Confidence            99999999999999999999  89999       4699999999999864
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A Back     alignment and structure
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Back     alignment and structure
>4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Back     alignment and structure
>3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Back     alignment and structure
>1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* Back     alignment and structure
>3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Back     alignment and structure
>4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Back     alignment and structure
>4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>2yf0_A Myotubularin-related protein 6; hydrolase; 2.65A {Homo sapiens} Back     alignment and structure
>1zsq_A Myotubularin-related protein 2; protein-phospholipid complex, hydrolase; HET: PIB; 1.82A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1zvr_A* Back     alignment and structure
>1lw3_A Myotubularin-related protein 2; protein-phosphate complex, hydrolase; 2.30A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1m7r_A Back     alignment and structure
>3sxu_A DNA polymerase III subunit CHI; DNA replication, CHI binds to SSB and PSI, transferase; HET: DNA; 1.85A {Escherichia coli} SCOP: c.128.1.1 PDB: 1em8_A* Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Back     alignment and structure
>3trj_A Phosphoheptose isomerase; lipopolysaccharide biosynthesis; 2.80A {Francisella tularensis subsp} Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 150
d1m3ga_145 c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien 1e-20
d1mkpa_144 c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien 3e-17
d1vhra_178 c.45.1.1 (A:) VH1-related dual-specificity phospha 4e-17
d1i9sa_194 c.45.1.1 (A:) mRNA capping enzyme, triphosphatase 0.002
d1fpza_176 c.45.1.1 (A:) Kinase associated phosphatase (kap) 0.002
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Length = 145 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Dual specificity phosphatase-like
domain: Mapk phosphatase
species: Human (Homo sapiens), pac-1 [TaxId: 9606]

 Score = 80.2 bits (197), Expect = 1e-20
 Identities = 37/95 (38%), Positives = 48/95 (50%)

Query: 31  PFEIEQGLFLGSIGAASNKDALKSRNITHILTVANALAPAHPNDFVYKVIGVADKEDTNL 90
           P EI   LFLGS   +S+   L++  IT +L V+ +        F YK I V D +   +
Sbjct: 4   PVEILPYLFLGSCSHSSDLQGLQACGITAVLNVSASCPNHFEGLFRYKSIPVEDNQMVEI 63

Query: 91  SQYFDECISFIDEAKRQRGGVLVHCFAGRSRRCHL 125
           S +F E I FID  K   G VLVH  AG SR   +
Sbjct: 64  SAWFQEAIGFIDWVKNSGGRVLVHSQAGISRSATI 98
>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Length = 144 Back     information, alignment and structure
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 194 Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query150
d1mkpa_144 Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp 100.0
d1m3ga_145 Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax 100.0
d1vhra_178 VH1-related dual-specificity phosphatase, VHR {Hum 99.97
d1ohea2182 Proline directed phosphatase CDC14b2 {Human (Homo 99.86
d1fpza_176 Kinase associated phosphatase (kap) {Human (Homo s 99.8
d1rxda_152 Protein tyrosine phosphatase type IVa {Human (Homo 99.78
d1i9sa_194 mRNA capping enzyme, triphosphatase domain {Mouse 99.69
d1xria_151 Putative phosphatase At1g05000 {Thale cress (Arabi 99.67
d1d5ra2174 Phoshphoinositide phosphatase Pten (Pten tumor sup 99.66
d1ywfa1272 Phosphotyrosine protein phosphatase PtpB {Mycobact 98.86
d2pt0a1313 Myo-inositol hexaphosphate phosphohydrolase (phyta 98.8
d1rpma_278 Tyrosine phosphatase {Human (Homo sapiens), mu [Ta 98.66
d1wcha_308 Tyrosine-protein phosphatase, non-receptor type 13 98.65
d1g4us2243 SptP tyrosine phosphatase, catalytic domain {Salmo 98.55
d1lara1317 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 98.51
d1jlna_297 Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl 98.49
d1l8ka_273 Tyrosine phosphatase {Human (Homo sapiens), T-cell 98.49
d1yfoa_288 Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 98.48
d1lara2249 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 98.46
d2f71a1297 Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta 98.45
d2shpa1307 Tyrosine phosphatase {Human (Homo sapiens), shp-2 98.45
d1p15a_245 Protein-tyrosine phosphatase alpha {Mouse (Mus mus 98.44
d1fpra_284 Tyrosine phosphatase {Human (Homo sapiens), shp-1 98.32
d1lyva_283 Protein-tyrosine phosphatase YopH, catalytic domai 98.27
d1zsqa2 387 Myotubularin-related protein 2, C-terminal domain 95.69
d1x94a_ 191 Phosphoheptose isomerase GmhA1 {Vibrio cholerae [T 90.11
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 87.29
d1x92a_ 194 Phosphoheptose isomerase GmhA1 {Pseudomonas aerugi 85.42
d1ohea1157 Proline directed phosphatase CDC14b2 {Human (Homo 84.49
d1tk9a_ 188 Phosphoheptose isomerase GmhA1 {Campylobacter jeju 80.53
>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Dual specificity phosphatase-like
domain: Mapk phosphatase
species: Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]

Probab=100.00  E-value=5.1e-35  Score=201.10  Aligned_cols=119  Identities=36%  Similarity=0.487  Sum_probs=110.6

Q ss_pred             CCCeeccCCeEEcChhhcCCHHHHHhCCCceEEEcCCCCCCCC--CCCceEEEEeeecCCCCCHHHHHHHHHHHHHHHHh
Q 031912           29 RVPFEIEQGLFLGSIGAASNKDALKSRNITHILTVANALAPAH--PNDFVYKVIGVADKEDTNLSQYFDECISFIDEAKR  106 (150)
Q Consensus        29 ~~p~~I~~~LylG~~~~~~~~~~l~~~gI~~Vvnl~~~~~~~~--~~~~~~~~ip~~D~~~~~l~~~~~~~~~fI~~~~~  106 (150)
                      .+|+||.|+||+|+..++.+.+.|+++||++|||++.+.+..+  ..++.|+++|+.|.+.+++.++|+.+++||++++.
T Consensus         2 ~~P~eI~p~lylG~~~~a~~~~~l~~~gI~~Iin~~~~~~~~~~~~~~~~y~~~~~~D~~~~~i~~~~~~~~~~i~~~~~   81 (144)
T d1mkpa_           2 SFPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARG   81 (144)
T ss_dssp             CCCEEEETTEEEECTTSCCCHHHHHHTTEEEEEECCSSCCCEEEEETTEEEEECCCCCSTTCCSGGGHHHHHHHHHHHHH
T ss_pred             CCCCeEECCEEECChhHhcCHHHHHhCCCcEEEEccccCCccccCCCceEEEEEEEecCCCCCHHHHHHHHHHHHHHhhh
Confidence            5899999999999999999999999999999999998766543  67799999999999999999999999999999999


Q ss_pred             CCCcEEEEcCCCCcchhhHHHHHHHHH-------HHHHHHHhhcCCCCCC
Q 031912          107 QRGGVLVHCFAGRSRRCHLFPHLGYFS-------MIILVYSNDNRPSESG  149 (150)
Q Consensus       107 ~~~~VLVHC~~G~sRS~~v~~~~aylm-------~~a~~~v~~~Rp~is~  149 (150)
                      +|++|||||.+|+|||++++  +||||       .+|+++|+++||.|..
T Consensus        82 ~~~~VlVHC~~G~~RS~~vv--~aYLm~~~~~~~~~A~~~v~~~Rp~i~p  129 (144)
T d1mkpa_          82 KNCGVLVHSLAGISRSVTVT--VAYLMQKLNLSMNDAYDIVKMKKSNISP  129 (144)
T ss_dssp             TTCEEEEECSSCSHHHHHHH--HHHHHHHHTCCHHHHHHHHHHHCTTCCC
T ss_pred             ccceEEEEecccccchHHHH--HHHHHHHhCCCHHHHHHHHHHHCCCCCC
Confidence            99999999999999999999  99999       3699999999998864
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Back     information, alignment and structure
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Back     information, alignment and structure
>d1zsqa2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x94a_ c.80.1.3 (A:) Phosphoheptose isomerase GmhA1 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1x92a_ c.80.1.3 (A:) Phosphoheptose isomerase GmhA1 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ohea1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tk9a_ c.80.1.3 (A:) Phosphoheptose isomerase GmhA1 {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure