Citrus Sinensis ID: 032037


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MHSLYYGGFELICKFNATLNMQNIKETILRYVRVRGFNETYWSYTGTGSRNVLKQLSRQMCASTSANPDEIMHRVIALVKKFDKTDAHKVTETADFQKDLSLDSLDRVELVMAFEEEFSVEIPEEKADKLTCCADVARYIASEAGEKE
ccccccccccEEEccHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHcccc
cccEEEcHEEEEccccHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccccccccEHHHHccccHHHHHHHHHHHHHHccccccHHHHHHccEHHHHHHHcHccccccc
mhslyyggFELICKFNATLNMQNIKETILRYVRVRGFNEtywsytgtgsrnVLKQLSRQmcastsanpDEIMHRVIALVKKfdktdahkvtetadfqkdlsldsLDRVELVMAFEEefsveipeekadkltcCADVARYIASEAGEKE
MHSLYYGGFELICKFNATLNMQNIKETILRYVRVRGFNETYwsytgtgsrnvLKQLSRQMCASTSANPDEIMHRVIALVKKFDKTDAHKVtetadfqkdlsldSLDRVELVMAFEEEfsveipeekadkltCCADVARYIASEAGEKE
MHSLYYGGFELICKFNATLNMQNIKETILRYVRVRGFNETYWSYTGTGSRNVLKQLSRQMCASTSANPDEIMHRVIALVKKFDKTDAHKVTETADFQKDLSLDSLDRVELVMAFeeefsveipeeKADKLTCCADVARYIASEAGEKE
***LYYGGFELICKFNATLNMQNIKETILRYVRVRGFNETYWSYTGTGSRNVLKQLSRQMCA******DEIMHRVIALVKKFDKTDAHKVTETADFQKDLSLDSLDRVELVMAFEEEFSVEIPEEKADKLTCCADVARYIA*******
**SLY*GGFELICKFNATLNMQNIKETILRYVRVR**********************************EIMHRVIALVKKFDKTDAHKVTETADFQKDLSLDSLDRVELVMAFEEEFSVEIPEEKADKLTCCADVARY**SE*****
MHSLYYGGFELICKFNATLNMQNIKETILRYVRVRGFNETYWSYTGTGSRNVLKQLSRQMCASTSANPDEIMHRVIALVKKFDKTDAHKVTETADFQKDLSLDSLDRVELVMAFEEEFSVEIPEEKADKLTCCADVARYIASEAGEKE
*HSLYYGGFELICKFNATLNMQNIKETILRYVRVRGFN**********SRNVLKQLSRQMCASTSANPDEIMHRVIALVKKFDKTDAHKVTETADFQKDLSLDSLDRVELVMAFEEEFSVEIPEEKADKLTCCADVARYIASEA****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHSLYYGGFELICKFNATLNMQNIKETILRYVRVRGFNETYWSYTGTGSRNVLKQLSRQMCASTSANPDEIMHRVIALVKKFDKTDAHKVTETADFQKDLSLDSLDRVELVMAFEEEFSVEIPEEKADKLTCCADVARYIASEAGEKE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query148 2.2.26 [Sep-21-2011]
Q9FGJ4131 Acyl carrier protein 3, m yes no 0.817 0.923 0.503 3e-28
P53665122 Acyl carrier protein 1, m no no 0.709 0.860 0.392 6e-16
O80800126 Acyl carrier protein 2, m no no 0.527 0.619 0.512 4e-15
Q0MQC1156 Acyl carrier protein, mit N/A no 0.587 0.557 0.436 9e-14
Q0MQC3156 Acyl carrier protein, mit yes no 0.587 0.557 0.436 9e-14
O14561156 Acyl carrier protein, mit yes no 0.587 0.557 0.436 9e-14
Q0MQC2156 Acyl carrier protein, mit N/A no 0.587 0.557 0.436 9e-14
P52505156 Acyl carrier protein, mit yes no 0.601 0.570 0.426 1e-13
Q9CR21156 Acyl carrier protein, mit yes no 0.601 0.570 0.426 1e-13
Q10217112 Putative acyl carrier pro yes no 0.5 0.660 0.513 2e-13
>sp|Q9FGJ4|ACPM3_ARATH Acyl carrier protein 3, mitochondrial OS=Arabidopsis thaliana GN=MTACP2 PE=2 SV=1 Back     alignment and function desciption
 Score =  123 bits (309), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 85/133 (63%), Gaps = 12/133 (9%)

Query: 21  MQNIKETILRYVRVR------GFNETYWSYTGTGSRNVLKQLSRQMCASTSANPDEIMHR 74
           M  I+ +IL+++R+R         +    +   G  N   +      A+     D+I+ R
Sbjct: 1   MHCIRSSILQHLRLRVSVRPTSLLQNENGFKSIGIFNFTSE------AAADGGQDQILSR 54

Query: 75  VIALVKKFDKTDAHKVTETADFQKDLSLDSLDRVELVMAFEEEFSVEIPEEKADKLTCCA 134
           VI LVKK+DKT+  +VTE ADFQKDLSLDSLD+ ELVMA EEEFS+EIP+EKADKLTCC 
Sbjct: 55  VIELVKKYDKTNTSEVTERADFQKDLSLDSLDKTELVMAIEEEFSIEIPDEKADKLTCCG 114

Query: 135 DVARYIASEAGEK 147
           DVA YI SE   K
Sbjct: 115 DVATYILSETPTK 127




Carrier of the growing fatty acid chain in fatty acid biosynthesis (By similarity). May be involved in the synthesis of short and medium chain fatty acids. Accessory and non-catalytic subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain.
Arabidopsis thaliana (taxid: 3702)
>sp|P53665|ACPM1_ARATH Acyl carrier protein 1, mitochondrial OS=Arabidopsis thaliana GN=MTACP1 PE=2 SV=1 Back     alignment and function description
>sp|O80800|ACPM2_ARATH Acyl carrier protein 2, mitochondrial OS=Arabidopsis thaliana GN=MTACP2 PE=1 SV=1 Back     alignment and function description
>sp|Q0MQC1|ACPM_PONPY Acyl carrier protein, mitochondrial OS=Pongo pygmaeus GN=NDUFAB1 PE=2 SV=1 Back     alignment and function description
>sp|Q0MQC3|ACPM_PANTR Acyl carrier protein, mitochondrial OS=Pan troglodytes GN=NDUFAB1 PE=2 SV=1 Back     alignment and function description
>sp|O14561|ACPM_HUMAN Acyl carrier protein, mitochondrial OS=Homo sapiens GN=NDUFAB1 PE=1 SV=3 Back     alignment and function description
>sp|Q0MQC2|ACPM_GORGO Acyl carrier protein, mitochondrial OS=Gorilla gorilla gorilla GN=NDUFAB1 PE=2 SV=1 Back     alignment and function description
>sp|P52505|ACPM_BOVIN Acyl carrier protein, mitochondrial OS=Bos taurus GN=NDUFAB1 PE=1 SV=2 Back     alignment and function description
>sp|Q9CR21|ACPM_MOUSE Acyl carrier protein, mitochondrial OS=Mus musculus GN=Ndufab1 PE=1 SV=1 Back     alignment and function description
>sp|Q10217|ACPM_SCHPO Putative acyl carrier protein, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4H3.09 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
224089575129 predicted protein [Populus trichocarpa] 0.824 0.945 0.698 2e-41
449518085138 PREDICTED: acyl carrier protein 3, mitoc 0.891 0.956 0.611 1e-39
449443526130 PREDICTED: acyl carrier protein 3, mitoc 0.851 0.969 0.632 6e-39
255563754126 acyl carrier protein, putative [Ricinus 0.824 0.968 0.629 1e-38
118483644129 unknown [Populus trichocarpa] 0.837 0.961 0.653 1e-37
224139458129 predicted protein [Populus trichocarpa] 0.837 0.961 0.645 5e-37
351724929153 uncharacterized protein LOC100305704 [Gl 0.878 0.849 0.589 5e-35
225469958135 PREDICTED: acyl carrier protein 3, mitoc 0.844 0.925 0.601 5e-34
297735879183 unnamed protein product [Vitis vinifera] 0.837 0.677 0.596 6e-34
388514725128 unknown [Medicago truncatula] 0.831 0.960 0.614 7e-33
>gi|224089575|ref|XP_002308763.1| predicted protein [Populus trichocarpa] gi|222854739|gb|EEE92286.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  173 bits (438), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 88/126 (69%), Positives = 100/126 (79%), Gaps = 4/126 (3%)

Query: 21  MQNIKETILRYVRVRGFNETYWSYTGTGSRNVLKQLSRQMCASTSANPDEIMHRVIALVK 80
           MQ+I+ +IL ++R+RG  E +  +   G  NV KQL RQMC S   +PD+IM RVI LVK
Sbjct: 1   MQSIRNSILSHIRLRGSAEQFL-FAQRG--NVFKQLHRQMCTSVGTSPDKIMDRVIGLVK 57

Query: 81  KFDKTDAHKVTETADFQKDLSLDSLDRVELVMAFEEEFSVEIPEEKADKLTCCADVARYI 140
           KFDK DA KVTETADFQKDL LDSLDRVELVMAFEEEFS+EIPEEKADKLTCCADVA+YI
Sbjct: 58  KFDKIDATKVTETADFQKDLCLDSLDRVELVMAFEEEFSIEIPEEKADKLTCCADVAKYI 117

Query: 141 ASEAGE 146
            S  GE
Sbjct: 118 VS-GGE 122




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449518085|ref|XP_004166074.1| PREDICTED: acyl carrier protein 3, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449443526|ref|XP_004139528.1| PREDICTED: acyl carrier protein 3, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255563754|ref|XP_002522878.1| acyl carrier protein, putative [Ricinus communis] gi|223537863|gb|EEF39478.1| acyl carrier protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|118483644|gb|ABK93716.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224139458|ref|XP_002323122.1| predicted protein [Populus trichocarpa] gi|222867752|gb|EEF04883.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|351724929|ref|NP_001235539.1| uncharacterized protein LOC100305704 [Glycine max] gi|255626363|gb|ACU13526.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|225469958|ref|XP_002275522.1| PREDICTED: acyl carrier protein 3, mitochondrial-like isoform 1 [Vitis vinifera] gi|225469960|ref|XP_002275574.1| PREDICTED: acyl carrier protein 3, mitochondrial-like isoform 3 [Vitis vinifera] gi|225469962|ref|XP_002275545.1| PREDICTED: acyl carrier protein 3, mitochondrial-like isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297735879|emb|CBI18638.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|388514725|gb|AFK45424.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
TAIR|locus:2168968131 mtACP3 "AT5G47630" [Arabidopsi 0.844 0.954 0.449 6.3e-21
UNIPROTKB|E2RJ92154 NDUFAB1 "Acyl carrier protein" 0.601 0.577 0.359 5.2e-10
TAIR|locus:2042331122 MTACP-1 "AT2G44620" [Arabidops 0.736 0.893 0.322 5.2e-10
UNIPROTKB|G3X6L0156 NDUFAB1 "Acyl carrier protein, 0.601 0.570 0.359 6.6e-10
UNIPROTKB|P52505156 NDUFAB1 "Acyl carrier protein, 0.601 0.570 0.359 6.6e-10
TAIR|locus:2206300126 mtACP2 "AT1G65290" [Arabidopsi 0.641 0.753 0.375 6.6e-10
UNIPROTKB|O14561156 NDUFAB1 "Acyl carrier protein, 0.601 0.570 0.359 8.4e-10
UNIPROTKB|F1SAB6156 NDUFAB1 "Uncharacterized prote 0.574 0.544 0.370 8.4e-10
MGI|MGI:1917566156 Ndufab1 "NADH dehydrogenase (u 0.594 0.564 0.363 8.4e-10
RGD|1305619156 Ndufab1 "NADH dehydrogenase (u 0.709 0.673 0.336 1.4e-09
TAIR|locus:2168968 mtACP3 "AT5G47630" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 246 (91.7 bits), Expect = 6.3e-21, P = 6.3e-21
 Identities = 58/129 (44%), Positives = 77/129 (59%)

Query:    21 MQNIKETILRYVRVR-GFNETYWSYTGTGSRNV-LKQLSRQMCASTSANPDEIMHRVIAL 78
             M  I+ +IL+++R+R     T       G +++ +   + +  A+     D+I+ RVI L
Sbjct:     1 MHCIRSSILQHLRLRVSVRPTSLLQNENGFKSIGIFNFTSE--AAADGGQDQILSRVIEL 58

Query:    79 VKKFDKTDAHKVTETADFQKDLSLDSLDRVELVMAFXXXXXXXXXXXKADKLTCCADVAR 138
             VKK+DKT+  +VTE ADFQKDLSLDSLD+ ELVMA            KADKLTCC DVA 
Sbjct:    59 VKKYDKTNTSEVTERADFQKDLSLDSLDKTELVMAIEEEFSIEIPDEKADKLTCCGDVAT 118

Query:   139 YIASEAGEK 147
             YI SE   K
Sbjct:   119 YILSETPTK 127




GO:0000036 "ACP phosphopantetheine attachment site binding involved in fatty acid biosynthetic process" evidence=ISS
GO:0005739 "mitochondrion" evidence=ISM
GO:0006633 "fatty acid biosynthetic process" evidence=IEA;ISS
GO:0010267 "production of ta-siRNAs involved in RNA interference" evidence=RCA
GO:0035196 "production of miRNAs involved in gene silencing by miRNA" evidence=RCA
GO:0051607 "defense response to virus" evidence=RCA
UNIPROTKB|E2RJ92 NDUFAB1 "Acyl carrier protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
TAIR|locus:2042331 MTACP-1 "AT2G44620" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G3X6L0 NDUFAB1 "Acyl carrier protein, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P52505 NDUFAB1 "Acyl carrier protein, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
TAIR|locus:2206300 mtACP2 "AT1G65290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O14561 NDUFAB1 "Acyl carrier protein, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SAB6 NDUFAB1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1917566 Ndufab1 "NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1305619 Ndufab1 "NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FGJ4ACPM3_ARATHNo assigned EC number0.50370.81750.9236yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
TIGR0051777 TIGR00517, acyl_carrier, acyl carrier protein 1e-19
PTZ00171148 PTZ00171, PTZ00171, acyl carrier protein; Provisio 2e-19
PRK0098278 PRK00982, acpP, acyl carrier protein; Provisional 1e-18
CHL0012482 CHL00124, acpP, acyl carrier protein; Validated 3e-15
COG023680 COG0236, AcpP, Acyl carrier protein [Lipid metabol 7e-15
PRK1244980 PRK12449, PRK12449, acyl carrier protein; Provisio 1e-10
pfam0055066 pfam00550, PP-binding, Phosphopantetheine attachme 3e-06
PRK0817282 PRK08172, PRK08172, putative acyl carrier protein 0.001
PRK0708183 PRK07081, PRK07081, acyl carrier protein; Provisio 0.004
>gnl|CDD|213536 TIGR00517, acyl_carrier, acyl carrier protein Back     alignment and domain information
 Score = 77.1 bits (190), Expect = 1e-19
 Identities = 34/74 (45%), Positives = 46/74 (62%)

Query: 69  DEIMHRVIALVKKFDKTDAHKVTETADFQKDLSLDSLDRVELVMAFEEEFSVEIPEEKAD 128
            EI  +V A++K+    D  ++T  A F +DL  DSLD VELVMA EEEF +EIP+E+A+
Sbjct: 2   QEIFEKVKAIIKEQLNVDEDQITTDARFVEDLGADSLDTVELVMALEEEFDIEIPDEEAE 61

Query: 129 KLTCCADVARYIAS 142
           K+    D   YI  
Sbjct: 62  KIATVGDAVNYIEE 75


This small protein has phosphopantetheine covalently bound to a Ser residue. It acts as a carrier of the growing fatty acid chain, which is bound to the prosthetic group, during fatty acid biosynthesis. Homologous phosphopantetheine-binding domains are found in longer proteins. Acyl carrier proteins scoring above the noise cutoff but below the trusted cutoff may be specialized versions. These include those involved in mycolic acid biosynthesis in the Mycobacteria, lipid A biosynthesis in Rhizobium, actinorhodin polyketide synthesis in Streptomyces coelicolor, etc. This protein is not found in the Archaea.Gene name acpP.S (Ser) at position 37 in the seed alignment, in the motif DSLD, is the phosphopantetheine attachment site [Fatty acid and phospholipid metabolism, Biosynthesis]. Length = 77

>gnl|CDD|240304 PTZ00171, PTZ00171, acyl carrier protein; Provisional Back     alignment and domain information
>gnl|CDD|179197 PRK00982, acpP, acyl carrier protein; Provisional Back     alignment and domain information
>gnl|CDD|177047 CHL00124, acpP, acyl carrier protein; Validated Back     alignment and domain information
>gnl|CDD|223314 COG0236, AcpP, Acyl carrier protein [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|183533 PRK12449, PRK12449, acyl carrier protein; Provisional Back     alignment and domain information
>gnl|CDD|215989 pfam00550, PP-binding, Phosphopantetheine attachment site Back     alignment and domain information
>gnl|CDD|181266 PRK08172, PRK08172, putative acyl carrier protein IacP; Validated Back     alignment and domain information
>gnl|CDD|180828 PRK07081, PRK07081, acyl carrier protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 148
KOG1748131 consensus Acyl carrier protein/NADH-ubiquinone oxi 99.94
PRK0711779 acyl carrier protein; Validated 99.83
PRK0535082 acyl carrier protein; Provisional 99.81
PRK0588391 acyl carrier protein; Validated 99.8
CHL0012482 acpP acyl carrier protein; Validated 99.8
PRK0817282 putative acyl carrier protein IacP; Validated 99.8
PRK0582884 acyl carrier protein; Validated 99.8
PRK1244980 acyl carrier protein; Provisional 99.8
PTZ00171148 acyl carrier protein; Provisional 99.78
PRK0763986 acyl carrier protein; Provisional 99.78
TIGR0051777 acyl_carrier acyl carrier protein. S (Ser) at posi 99.76
COG023680 AcpP Acyl carrier protein [Lipid metabolism / Seco 99.73
PRK0650893 acyl carrier protein; Provisional 99.7
PRK0918489 acyl carrier protein; Provisional 99.7
PRK0098278 acpP acyl carrier protein; Provisional 99.68
PRK0708183 acyl carrier protein; Provisional 99.59
PRK0508778 D-alanine--poly(phosphoribitol) ligase subunit 2; 99.57
PF0055067 PP-binding: Phosphopantetheine attachment site; In 99.55
PF1457396 PP-binding_2: Acyl-carrier; PDB: 3CE7_A. 99.37
TIGR0168873 dltC D-alanine--poly(phosphoribitol) ligase, subun 99.23
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 98.87
smart0082386 PKS_PP Phosphopantetheine attachment site. Phospho 98.78
PRK06060705 acyl-CoA synthetase; Validated 98.4
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 98.13
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 98.11
PRK10252 1296 entF enterobactin synthase subunit F; Provisional 97.91
PRK12467 3956 peptide synthase; Provisional 97.62
PRK05691 4334 peptide synthase; Validated 97.55
PRK056914334 peptide synthase; Validated 97.49
PF07377111 DUF1493: Protein of unknown function (DUF1493); In 97.48
PRK123165163 peptide synthase; Provisional 97.46
PRK12467 3956 peptide synthase; Provisional 97.39
PRK12316 5163 peptide synthase; Provisional 97.22
COG343374 Aryl carrier domain [Secondary metabolites biosynt 97.1
KOG1202 2376 consensus Animal-type fatty acid synthase and rela 96.98
PF10501112 Ribosomal_L50: Ribosomal subunit 39S; InterPro: IP 96.43
TIGR02372 386 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactiv 94.88
PF0876654 DEK_C: DEK C terminal domain; InterPro: IPR014876 80.39
KOG1178 1032 consensus Non-ribosomal peptide synthetase/alpha-a 80.11
>KOG1748 consensus Acyl carrier protein/NADH-ubiquinone oxidoreductase, NDUFAB1/SDAP subunit [Energy production and conversion; Lipid transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
Probab=99.94  E-value=1.2e-27  Score=177.36  Aligned_cols=94  Identities=51%  Similarity=0.746  Sum_probs=89.4

Q ss_pred             HHHHHHhcCCC--CChHHHHHHHHHHHHhhhCCCCCCCCCCCCccccCCCChhHHHHHHHHHHHHhCCccChhhhccCCC
Q 032037           55 QLSRQMCASTS--ANPDEIMHRVIALVKKFDKTDAHKVTETADFQKDLSLDSLDRVELVMAFEEEFSVEIPEEKADKLTC  132 (148)
Q Consensus        55 ~~~r~~~~~~~--~t~~eI~~~I~~il~~~l~vd~~~It~d~~l~~dLGlDSLd~VELv~~LEeeFgIeIp~~dl~~~~T  132 (148)
                      ++.|.|+...+  ++++++.++|..+++.+.++++++++++++|.+|||+||||.||++|+|||||||+||+++++++.|
T Consensus        36 ~l~r~~s~~~p~~l~k~~v~~RVl~VVk~~dki~~~k~~~~s~f~~DLGlDSLD~VEiVMAlEEEFgiEIpd~dAdki~t  115 (131)
T KOG1748|consen   36 GLLRSYSAELPRCLAKKEVVDRVLDVVKKFDKIDPSKLTTDSDFFKDLGLDSLDTVEIVMALEEEFGIEIPDEDADKIKT  115 (131)
T ss_pred             hHHHHHhhhhhhhhhHHHHHHHHHHHHHHhhcCCccccchhhHHHHhcCCcccccchhhhhhHHHhCCccCcchhhhhCC
Confidence            56788888766  8999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhhCCCC
Q 032037          133 CADVARYIASEAGEKE  148 (148)
Q Consensus       133 V~dlv~~I~~~~~ake  148 (148)
                      ++++++||.++.+.+|
T Consensus       116 ~~da~~yI~~~~d~ke  131 (131)
T KOG1748|consen  116 VRDAADYIADKPDVKE  131 (131)
T ss_pred             HHHHHHHHHhcccccC
Confidence            9999999999998775



>PRK07117 acyl carrier protein; Validated Back     alignment and domain information
>PRK05350 acyl carrier protein; Provisional Back     alignment and domain information
>PRK05883 acyl carrier protein; Validated Back     alignment and domain information
>CHL00124 acpP acyl carrier protein; Validated Back     alignment and domain information
>PRK08172 putative acyl carrier protein IacP; Validated Back     alignment and domain information
>PRK05828 acyl carrier protein; Validated Back     alignment and domain information
>PRK12449 acyl carrier protein; Provisional Back     alignment and domain information
>PTZ00171 acyl carrier protein; Provisional Back     alignment and domain information
>PRK07639 acyl carrier protein; Provisional Back     alignment and domain information
>TIGR00517 acyl_carrier acyl carrier protein Back     alignment and domain information
>COG0236 AcpP Acyl carrier protein [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK06508 acyl carrier protein; Provisional Back     alignment and domain information
>PRK09184 acyl carrier protein; Provisional Back     alignment and domain information
>PRK00982 acpP acyl carrier protein; Provisional Back     alignment and domain information
>PRK07081 acyl carrier protein; Provisional Back     alignment and domain information
>PRK05087 D-alanine--poly(phosphoribitol) ligase subunit 2; Validated Back     alignment and domain information
>PF00550 PP-binding: Phosphopantetheine attachment site; InterPro: IPR006163 Phosphopantetheine (or pantetheine 4' phosphate) is the prosthetic group of acyl carrier proteins (ACP) in some multienzyme complexes where it serves as a 'swinging arm' for the attachment of activated fatty acid and amino-acid groups [] Back     alignment and domain information
>PF14573 PP-binding_2: Acyl-carrier; PDB: 3CE7_A Back     alignment and domain information
>TIGR01688 dltC D-alanine--poly(phosphoribitol) ligase, subunit 2 Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>smart00823 PKS_PP Phosphopantetheine attachment site Back     alignment and domain information
>PRK06060 acyl-CoA synthetase; Validated Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>PF07377 DUF1493: Protein of unknown function (DUF1493); InterPro: IPR010862 This family consists of several bacterial proteins of around 115 residues in length Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>COG3433 Aryl carrier domain [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>PF10501 Ribosomal_L50: Ribosomal subunit 39S; InterPro: IPR018305 This entry represents the L50 protein from the mitochondrial 39S ribosomal subunit Back     alignment and domain information
>TIGR02372 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactive yellow protein activation family Back     alignment and domain information
>PF08766 DEK_C: DEK C terminal domain; InterPro: IPR014876 DEK is a chromatin associated protein that is linked with cancers and autoimmune disease Back     alignment and domain information
>KOG1178 consensus Non-ribosomal peptide synthetase/alpha-aminoadipate reductase and related enzymes [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
2dnw_A99 Solution Structure Of Rsgi Ruh-059, An Acp Domain O 3e-09
2ehs_A77 Crystal Structure Of Acyl Carrier Protein From Aqui 3e-05
2l3v_A79 Nmr Structure Of Acyl Carrier Protein From Brucella 4e-05
4dxe_H101 2.52 Angstrom Resolution Crystal Structure Of The A 5e-05
1x3o_A80 Crystal Structure Of The Acyl Carrier Protein From 2e-04
2l4b_A88 Solution Structure Of A Putative Acyl Carrier Prote 2e-04
2qnw_A82 Toxoplasma Gondii Apicoplast-Targeted Acyl Carrier 7e-04
>pdb|2DNW|A Chain A, Solution Structure Of Rsgi Ruh-059, An Acp Domain Of Acyl Carrier Protein, Mitochondrial [precursor] From Human Cdna Length = 99 Back     alignment and structure

Iteration: 1

Score = 57.4 bits (137), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 28/71 (39%), Positives = 41/71 (57%) Query: 71 IMHRVIALVKKFDKTDAHKVTETADFQKDLSLDSLDRVELVMAFXXXXXXXXXXXKADKL 130 I RV+ ++K +DK D K++ + F KDL LDSLD+VE++MA A+KL Sbjct: 16 IQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKL 75 Query: 131 TCCADVARYIA 141 C ++ YIA Sbjct: 76 MCPQEIVDYIA 86
>pdb|2EHS|A Chain A, Crystal Structure Of Acyl Carrier Protein From Aquifex Aeolicus (Form 1) Length = 77 Back     alignment and structure
>pdb|2L3V|A Chain A, Nmr Structure Of Acyl Carrier Protein From Brucella Melitensis Length = 79 Back     alignment and structure
>pdb|4DXE|H Chain H, 2.52 Angstrom Resolution Crystal Structure Of The Acyl-Carrier-Protein Synthase (Acps)-Acyl Carrier Protein (Acp) Protein-Protein Complex From Staphylococcus Aureus Subsp. Aureus Col Length = 101 Back     alignment and structure
>pdb|1X3O|A Chain A, Crystal Structure Of The Acyl Carrier Protein From Thermus Thermophilus Hb8 Length = 80 Back     alignment and structure
>pdb|2L4B|A Chain A, Solution Structure Of A Putative Acyl Carrier Protein From Anaplasma Phagocytophilum. Seattle Structural Genomics Center For Infectious Disease Target Anpha.01018.A Length = 88 Back     alignment and structure
>pdb|2QNW|A Chain A, Toxoplasma Gondii Apicoplast-Targeted Acyl Carrier Protein Length = 82 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
2dnw_A99 Acyl carrier protein; ACP, fatty acid biosynthesis 5e-29
2l4b_A88 Acyl carrier protein; infectious disease, human gr 6e-27
3ce7_A107 Specific mitochodrial acyl carrier protein; malari 9e-26
2ava_A82 ACP I, acyl carrier protein I, chloroplast; four-h 1e-24
1vku_A100 Acyl carrier protein; TM0175, structural genomics, 1e-22
2qnw_A82 Acyl carrier protein; malaria, SGC, structural gen 1e-22
1l0i_A78 Acyl carrier protein; acyl chain binding, fatty ac 1e-22
3ejb_A97 Acyl carrier protein; protein-protein complex, cyt 1e-22
2l3v_A79 ACP, acyl carrier protein; structural genomi seatt 2e-22
1x3o_A80 Acyl carrier protein; structural genomics, riken s 7e-22
2lol_A81 ACP, acyl carrier protein; lipid transport; NMR {R 1e-21
1klp_A115 ACP, ACPM, meromycolate extension acyl carrier pro 2e-21
2kwl_A84 ACP, acyl carrier protein; structural genomics, se 3e-21
3gzm_A81 Acyl carrier protein; helix bundle, phosphopanteth 4e-21
2ehs_A77 ACP, acyl carrier protein; lipid transport, struct 6e-21
2cnr_A82 FAS, ACP, acyl carrier protein; polykdetide, phosp 1e-20
2cgq_A113 Acyl carrier protein ACPA; RV0033, protein transpo 3e-20
4dxe_H101 ACP, acyl carrier protein; acyl-carrier-protein sy 3e-20
2kw2_A101 Specialized acyl carrier protein; structural genom 3e-17
1f80_D81 Acyl carrier protein; transferase; HET: PN2; 2.30A 6e-15
2lte_A103 Specialized acyl carrier protein; APO protein, tra 1e-10
2kci_A87 Putative acyl carrier protein; alpha, ACP, PCP, st 4e-10
1nq4_A95 Oxytetracycline polyketide synthase acyl carrier p 3e-09
2jq4_A105 AGR_C_4658P, hypothetical protein ATU2571; ATC2521 2e-08
2kr5_A89 PKS, aflatoxin biosynthesis polyketide synthase; a 1e-07
1af8_A86 Actinorhodin polyketide synthase acyl carrier Pro; 1e-07
1or5_A83 Acyl carrier protein; ACP, biosynthesis, frenolici 2e-07
2l22_A212 Mupirocin didomain acyl carrier protein; biosynthe 5e-06
2lki_A105 Putative uncharacterized protein; helical bundle, 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
1fh1_A92 NODF, nodulation protein F; ROOT nodulation factor 1e-04
1dv5_A80 APO-DCP, APO-D-alanyl carrier protein; 3-helix bun 1e-04
2afd_A88 Protein ASL1650; twisted antiparallel helical bund 4e-04
2amw_A83 Hypothetical protein NE2163; all helical protein, 6e-04
>2dnw_A Acyl carrier protein; ACP, fatty acid biosynthesis, mitochondria, NADH:ubiquinone oxidereductase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
 Score =  100 bits (252), Expect = 5e-29
 Identities = 35/80 (43%), Positives = 52/80 (65%)

Query: 69  DEIMHRVIALVKKFDKTDAHKVTETADFQKDLSLDSLDRVELVMAFEEEFSVEIPEEKAD 128
           + I  RV+ ++K +DK D  K++  + F KDL LDSLD+VE++MA E+EF  EIP+  A+
Sbjct: 14  EGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAE 73

Query: 129 KLTCCADVARYIASEAGEKE 148
           KL C  ++  YIA +    E
Sbjct: 74  KLMCPQEIVDYIADKKDVYE 93


>2l4b_A Acyl carrier protein; infectious disease, human granulocytic anaplasmosis, ssgcid, structural genomics; NMR {Anaplasma phagocytophilum} Length = 88 Back     alignment and structure
>3ce7_A Specific mitochodrial acyl carrier protein; malaria, mitochondrial, ACP, fatty acid biosynthesis, lipid synthesis, phosphopantetheine; 1.64A {Toxoplasma} Length = 107 Back     alignment and structure
>2ava_A ACP I, acyl carrier protein I, chloroplast; four-helix-bundle, biosynthetic protein; NMR {Spinacia oleracea} PDB: 2fva_A* 2fve_A 2fvf_A* 2xz0_D* 2xz1_C* Length = 82 Back     alignment and structure
>1vku_A Acyl carrier protein; TM0175, structural genomics, JCSG, Pro structure initiative, PSI; 2.00A {Thermotoga maritima} SCOP: a.28.1.1 Length = 100 Back     alignment and structure
>2qnw_A Acyl carrier protein; malaria, SGC, structural genomics CONS fatty acid biosynthesis, lipid synthesis, phosphopantethein transit peptide; 1.90A {Toxoplasma gondii} Length = 82 Back     alignment and structure
>1l0i_A Acyl carrier protein; acyl chain binding, fatty acid biosynt lipid transport; HET: PSR; 1.20A {Escherichia coli} SCOP: a.28.1.1 PDB: 3ny7_B* 2fhs_C 1l0h_A* 1acp_A 1t8k_A 2fac_A* 2fad_A* 2fae_A* 2k92_A 2k93_A 2k94_A 2l0q_A Length = 78 Back     alignment and structure
>3ejb_A Acyl carrier protein; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Escherichia coli} SCOP: a.28.1.1 PDB: 3ejd_A* 3eje_A* Length = 97 Back     alignment and structure
>2l3v_A ACP, acyl carrier protein; structural genomi seattle structural genomics center for infectious disease, lipid binding protein; NMR {Brucella melitensis} Length = 79 Back     alignment and structure
>1x3o_A Acyl carrier protein; structural genomics, riken structural genomics/proteomics in RSGI, NPPSFA; 1.50A {Thermus thermophilus} Length = 80 Back     alignment and structure
>2lol_A ACP, acyl carrier protein; lipid transport; NMR {Rickettsia prowazekii str} Length = 81 Back     alignment and structure
>1klp_A ACP, ACPM, meromycolate extension acyl carrier protein; four-helix bundle, ligand transport; NMR {Mycobacterium tuberculosis} SCOP: a.28.1.1 Length = 115 Back     alignment and structure
>2kwl_A ACP, acyl carrier protein; structural genomics, seattle structura genomics center for infectious disease, ssgcid, lipid bindi protein; NMR {Borrelia burgdorferi} Length = 84 Back     alignment and structure
>3gzm_A Acyl carrier protein; helix bundle, phosphopantetheine, fatty acid biosynthesis, L synthesis, transit peptide, biosynthetic protein; HET: PNS; 1.80A {Plasmodium falciparum} PDB: 3gzl_A* 2fq0_A* 2fq2_A* Length = 81 Back     alignment and structure
>2ehs_A ACP, acyl carrier protein; lipid transport, structural genomics, NPPSFA, national proje protein structural and functional analyses; 1.30A {Aquifex aeolicus} PDB: 2eht_A Length = 77 Back     alignment and structure
>2cnr_A FAS, ACP, acyl carrier protein; polykdetide, phosphopantetheine, lipid transport; NMR {Streptomyces coelicolor} PDB: 2koo_A* 2kop_A* 2koq_A* 2kor_A* 2kos_A* Length = 82 Back     alignment and structure
>2cgq_A Acyl carrier protein ACPA; RV0033, protein transport, phosphopant; 1.83A {Mycobacterium tuberculosis} Length = 113 Back     alignment and structure
>4dxe_H ACP, acyl carrier protein; acyl-carrier-protein synthase, type II acid synthesis pathway; 2.51A {Staphylococcus aureus} Length = 101 Back     alignment and structure
>2kw2_A Specialized acyl carrier protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Rhodopseudomonas palustris} PDB: 2ll8_A* 2lpk_A 3lmo_A Length = 101 Back     alignment and structure
>1f80_D Acyl carrier protein; transferase; HET: PN2; 2.30A {Bacillus subtilis} SCOP: a.28.1.1 PDB: 2x2b_A* 1hy8_A Length = 81 Back     alignment and structure
>2lte_A Specialized acyl carrier protein; APO protein, transferase; NMR {Pseudomonas aeruginosa} Length = 103 Back     alignment and structure
>1nq4_A Oxytetracycline polyketide synthase acyl carrier protein; solution structure, dynamics, ACP, biosynthetic protein; NMR {Streptomyces rimosus} SCOP: a.28.1.1 Length = 95 Back     alignment and structure
>2jq4_A AGR_C_4658P, hypothetical protein ATU2571; ATC2521, unknown function, ATC, S genomics, PSI-2, protein structure initiative; NMR {Agrobacterium tumefaciens} SCOP: a.28.1.1 Length = 105 Back     alignment and structure
>2kr5_A PKS, aflatoxin biosynthesis polyketide synthase; acyl carrrier protein, holo, phosphopantetheine, transport protein; HET: PNS; NMR {Aspergillus parasiticus} Length = 89 Back     alignment and structure
>1af8_A Actinorhodin polyketide synthase acyl carrier Pro; acyl carrier protein, solution STR antibiotic biosynthesis; NMR {Streptomyces coelicolor} SCOP: a.28.1.1 PDB: 2af8_A 2k0x_A* 2k0y_A 2kg6_A* 2kg8_A* 2kg9_A* 2kga_A* 2kgc_A* 2kgd_A* 2kge_A* Length = 86 Back     alignment and structure
>1or5_A Acyl carrier protein; ACP, biosynthesis, frenolicin, holo, polyketide synthase, PKS, biosynthetic protein; NMR {Streptomyces roseofulvus} SCOP: a.28.1.1 Length = 83 Back     alignment and structure
>2l22_A Mupirocin didomain acyl carrier protein; biosynthetic protein; NMR {Pseudomonas fluorescens} Length = 212 Back     alignment and structure
>2lki_A Putative uncharacterized protein; helical bundle, acyl carrier, phosphopantetheine, fatty acid biosynthesis, lipid synthesis, PSI-biology; HET: PNS; NMR {Nitrosomonas europaea} Length = 105 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1fh1_A NODF, nodulation protein F; ROOT nodulation factor, protein backbone fold, lipid binding protein; NMR {Rhizobium leguminosarum} SCOP: i.11.1.1 Length = 92 Back     alignment and structure
>1dv5_A APO-DCP, APO-D-alanyl carrier protein; 3-helix bundle, transport protein; NMR {Lactobacillus casei} SCOP: a.28.1.3 PDB: 1hqb_A Length = 80 Back     alignment and structure
>2afd_A Protein ASL1650; twisted antiparallel helical bundle, acyl carrier protein FA structural genomics, PSI, protein structure initiative; NMR {Nostoc SP} PDB: 2afe_A Length = 88 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
2kci_A87 Putative acyl carrier protein; alpha, ACP, PCP, st 99.81
2l9f_A102 CALE8, meacp; transferase, acyl carrier protein; N 99.79
2dnw_A99 Acyl carrier protein; ACP, fatty acid biosynthesis 99.79
3gzm_A81 Acyl carrier protein; helix bundle, phosphopanteth 99.78
2l4b_A88 Acyl carrier protein; infectious disease, human gr 99.78
2kjs_A87 Putative acyl carrier protein; alpha, ACP, PNS, st 99.77
3ejb_A97 Acyl carrier protein; protein-protein complex, cyt 99.77
2kwl_A84 ACP, acyl carrier protein; structural genomics, se 99.77
4dxe_H101 ACP, acyl carrier protein; acyl-carrier-protein sy 99.76
2lol_A81 ACP, acyl carrier protein; lipid transport; NMR {R 99.75
2qnw_A82 Acyl carrier protein; malaria, SGC, structural gen 99.75
2ava_A82 ACP I, acyl carrier protein I, chloroplast; four-h 99.75
2cnr_A82 FAS, ACP, acyl carrier protein; polykdetide, phosp 99.75
1f80_D81 Acyl carrier protein; transferase; HET: PN2; 2.30A 99.74
3ce7_A107 Specific mitochodrial acyl carrier protein; malari 99.74
1vku_A100 Acyl carrier protein; TM0175, structural genomics, 99.74
1x3o_A80 Acyl carrier protein; structural genomics, riken s 99.73
2cgq_A113 Acyl carrier protein ACPA; RV0033, protein transpo 99.73
1klp_A115 ACP, ACPM, meromycolate extension acyl carrier pro 99.72
1dv5_A80 APO-DCP, APO-D-alanyl carrier protein; 3-helix bun 99.72
1l0i_A78 Acyl carrier protein; acyl chain binding, fatty ac 99.71
1af8_A86 Actinorhodin polyketide synthase acyl carrier Pro; 99.71
2kw2_A101 Specialized acyl carrier protein; structural genom 99.7
2lki_A105 Putative uncharacterized protein; helical bundle, 99.69
2amw_A83 Hypothetical protein NE2163; all helical protein, 99.69
2lte_A103 Specialized acyl carrier protein; APO protein, tra 99.51
2jq4_A105 AGR_C_4658P, hypothetical protein ATU2571; ATC2521 99.65
2ehs_A77 ACP, acyl carrier protein; lipid transport, struct 99.65
1or5_A83 Acyl carrier protein; ACP, biosynthesis, frenolici 99.63
1nq4_A95 Oxytetracycline polyketide synthase acyl carrier p 99.61
2l3v_A79 ACP, acyl carrier protein; structural genomi seatt 99.6
1fh1_A92 NODF, nodulation protein F; ROOT nodulation factor 99.59
2afd_A88 Protein ASL1650; twisted antiparallel helical bund 99.54
2kr5_A89 PKS, aflatoxin biosynthesis polyketide synthase; a 99.51
2liu_A99 CURA; holo state, transferase; NMR {Lyngbya majusc 99.49
2cg5_B91 Fatty acid synthase; transferase-hydrolase complex 99.42
2ju1_A95 Erythronolide synthase; carrier protein domain, mo 99.41
2l22_A 212 Mupirocin didomain acyl carrier protein; biosynthe 99.41
2l22_A212 Mupirocin didomain acyl carrier protein; biosynthe 99.32
4i4d_A93 Peptide synthetase NRPS type II-PCP; structural ge 99.31
1dny_A91 Non-ribosomal peptide synthetase peptidyl carrier 99.29
3tej_A 329 Enterobactin synthase component F; nonribosomal pe 98.84
2cq8_A110 10-formyltetrahydrofolate dehydrogenase; 10-FTHFDH 98.77
2jgp_A 520 Tyrocidine synthetase 3; multifunctional enzyme, a 98.44
2fq1_A287 Isochorismatase; ENTB, NRPS, multi-domain, ACP, hy 98.36
2vsq_A 1304 Surfactin synthetase subunit 3; ligase, peptidyl c 98.05
4f6l_B 508 AUSA reductase domain protein; thioester reductase 97.95
3rg2_A617 Enterobactin synthase component E (ENTE), 2,3-DIH 97.82
4dg8_A620 PA1221; ANL superfamily, adenylation domain, pepti 97.76
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 97.15
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 83.49
>2l9f_A CALE8, meacp; transferase, acyl carrier protein; NMR {Micromonospora echinospora} Back     alignment and structure
>2dnw_A Acyl carrier protein; ACP, fatty acid biosynthesis, mitochondria, NADH:ubiquinone oxidereductase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3gzm_A Acyl carrier protein; helix bundle, phosphopantetheine, fatty acid biosynthesis, L synthesis, transit peptide, biosynthetic protein; HET: PNS; 1.80A {Plasmodium falciparum} SCOP: a.28.1.0 PDB: 3gzl_A* 2fq0_A* 2fq2_A* Back     alignment and structure
>2l4b_A Acyl carrier protein; infectious disease, human granulocytic anaplasmosis, ssgcid, structural genomics; NMR {Anaplasma phagocytophilum} Back     alignment and structure
>3ejb_A Acyl carrier protein; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Escherichia coli} SCOP: a.28.1.1 PDB: 3ejd_A* 3eje_A* Back     alignment and structure
>2kwl_A ACP, acyl carrier protein; structural genomics, seattle structura genomics center for infectious disease, ssgcid, lipid bindi protein; NMR {Borrelia burgdorferi} Back     alignment and structure
>4dxe_H ACP, acyl carrier protein; acyl-carrier-protein synthase, type II acid synthesis pathway; 2.51A {Staphylococcus aureus} Back     alignment and structure
>2lol_A ACP, acyl carrier protein; lipid transport; NMR {Rickettsia prowazekii str} Back     alignment and structure
>2qnw_A Acyl carrier protein; malaria, SGC, structural genomics CONS fatty acid biosynthesis, lipid synthesis, phosphopantethein transit peptide; 1.90A {Toxoplasma gondii} Back     alignment and structure
>2ava_A ACP I, acyl carrier protein I, chloroplast; four-helix-bundle, biosynthetic protein; NMR {Spinacia oleracea} PDB: 2fva_A* 2fve_A 2fvf_A* 2xz0_D* 2xz1_C* Back     alignment and structure
>2cnr_A FAS, ACP, acyl carrier protein; polykdetide, phosphopantetheine, lipid transport; NMR {Streptomyces coelicolor} PDB: 2koo_A* 2kop_A* 2koq_A* 2kor_A* 2kos_A* Back     alignment and structure
>1f80_D Acyl carrier protein; transferase; HET: PN2; 2.30A {Bacillus subtilis} SCOP: a.28.1.1 PDB: 2x2b_A* 1hy8_A Back     alignment and structure
>3ce7_A Specific mitochodrial acyl carrier protein; malaria, mitochondrial, ACP, fatty acid biosynthesis, lipid synthesis, phosphopantetheine; 1.64A {Toxoplasma} Back     alignment and structure
>1vku_A Acyl carrier protein; TM0175, structural genomics, JCSG, Pro structure initiative, PSI; 2.00A {Thermotoga maritima} SCOP: a.28.1.1 Back     alignment and structure
>1x3o_A Acyl carrier protein; structural genomics, riken structural genomics/proteomics in RSGI, NPPSFA; 1.50A {Thermus thermophilus} Back     alignment and structure
>2cgq_A Acyl carrier protein ACPA; RV0033, protein transport, phosphopant; 1.83A {Mycobacterium tuberculosis} Back     alignment and structure
>1klp_A ACP, ACPM, meromycolate extension acyl carrier protein; four-helix bundle, ligand transport; NMR {Mycobacterium tuberculosis} SCOP: a.28.1.1 Back     alignment and structure
>1dv5_A APO-DCP, APO-D-alanyl carrier protein; 3-helix bundle, transport protein; NMR {Lactobacillus casei} SCOP: a.28.1.3 PDB: 1hqb_A Back     alignment and structure
>1l0i_A Acyl carrier protein; acyl chain binding, fatty acid biosynt lipid transport; HET: PSR; 1.20A {Escherichia coli} SCOP: a.28.1.1 PDB: 3ny7_B* 2fhs_C 1l0h_A* 1acp_A 1t8k_A 2fac_A* 2fad_A* 2fae_A* 2k92_A 2k93_A 2k94_A 2l0q_A Back     alignment and structure
>1af8_A Actinorhodin polyketide synthase acyl carrier Pro; acyl carrier protein, solution STR antibiotic biosynthesis; NMR {Streptomyces coelicolor} SCOP: a.28.1.1 PDB: 2af8_A 2k0x_A* 2k0y_A 2kg6_A* 2kg8_A* 2kg9_A* 2kga_A* 2kgc_A* 2kgd_A* 2kge_A* Back     alignment and structure
>2kw2_A Specialized acyl carrier protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Rhodopseudomonas palustris} PDB: 2ll8_A* 2lpk_A 3lmo_A Back     alignment and structure
>2lki_A Putative uncharacterized protein; helical bundle, acyl carrier, phosphopantetheine, fatty acid biosynthesis, lipid synthesis, PSI-biology; HET: PNS; NMR {Nitrosomonas europaea} Back     alignment and structure
>2lte_A Specialized acyl carrier protein; APO protein, transferase; NMR {Pseudomonas aeruginosa} Back     alignment and structure
>2jq4_A AGR_C_4658P, hypothetical protein ATU2571; ATC2521, unknown function, ATC, S genomics, PSI-2, protein structure initiative; NMR {Agrobacterium tumefaciens} SCOP: a.28.1.1 Back     alignment and structure
>2ehs_A ACP, acyl carrier protein; lipid transport, structural genomics, NPPSFA, national proje protein structural and functional analyses; 1.30A {Aquifex aeolicus} PDB: 2eht_A Back     alignment and structure
>1or5_A Acyl carrier protein; ACP, biosynthesis, frenolicin, holo, polyketide synthase, PKS, biosynthetic protein; NMR {Streptomyces roseofulvus} SCOP: a.28.1.1 Back     alignment and structure
>1nq4_A Oxytetracycline polyketide synthase acyl carrier protein; solution structure, dynamics, ACP, biosynthetic protein; NMR {Streptomyces rimosus} SCOP: a.28.1.1 Back     alignment and structure
>2l3v_A ACP, acyl carrier protein; structural genomi seattle structural genomics center for infectious disease, lipid binding protein; NMR {Brucella melitensis} Back     alignment and structure
>1fh1_A NODF, nodulation protein F; ROOT nodulation factor, protein backbone fold, lipid binding protein; NMR {Rhizobium leguminosarum} SCOP: i.11.1.1 Back     alignment and structure
>2afd_A Protein ASL1650; twisted antiparallel helical bundle, acyl carrier protein FA structural genomics, PSI, protein structure initiative; NMR {Nostoc SP} PDB: 2afe_A Back     alignment and structure
>2kr5_A PKS, aflatoxin biosynthesis polyketide synthase; acyl carrrier protein, holo, phosphopantetheine, transport protein; HET: PNS; NMR {Aspergillus parasiticus} Back     alignment and structure
>2liu_A CURA; holo state, transferase; NMR {Lyngbya majuscula} PDB: 2liw_A* Back     alignment and structure
>2cg5_B Fatty acid synthase; transferase-hydrolase complex, transferase/hydrolase (comple fatty acid biosynthesis, phosphopantetheine transferase; HET: COA; 2.7A {Homo sapiens} PDB: 2png_A Back     alignment and structure
>2ju1_A Erythronolide synthase; carrier protein domain, modular polyketide synthase, alpha- helical bundle, acyltransferase; NMR {Saccharopolyspora erythraea} PDB: 2ju2_A Back     alignment and structure
>2l22_A Mupirocin didomain acyl carrier protein; biosynthetic protein; NMR {Pseudomonas fluorescens} Back     alignment and structure
>2l22_A Mupirocin didomain acyl carrier protein; biosynthetic protein; NMR {Pseudomonas fluorescens} Back     alignment and structure
>4i4d_A Peptide synthetase NRPS type II-PCP; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MLY; 2.10A {Streptomyces verticillus} Back     alignment and structure
>1dny_A Non-ribosomal peptide synthetase peptidyl carrier protein; four-helix bundle, modular enzyme, domain, flexible region; NMR {Brevibacillus brevis} SCOP: a.28.1.2 PDB: 2gdw_A 2gdx_A 2gdy_A 2k2q_A Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>2cq8_A 10-formyltetrahydrofolate dehydrogenase; 10-FTHFDH, PP-binding, acyl carrier protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jgp_A Tyrocidine synthetase 3; multifunctional enzyme, antibiotic biosynthesis, condensatio domain, peptide bond formation, ligase; 1.85A {Brevibacillus brevis} Back     alignment and structure
>2fq1_A Isochorismatase; ENTB, NRPS, multi-domain, ACP, hydrolase; 2.30A {Escherichia coli} Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} Back     alignment and structure
>4dg8_A PA1221; ANL superfamily, adenylation domain, peptidyl carrier protei ribosomal peptide synthetase, NRPS, valine adenylation, LIG; HET: AMP; 2.15A {Pseudomonas aeruginosa} PDB: 4dg9_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 148
d1t8ka_77 a.28.1.1 (A:) Acyl carrier protein {Escherichia co 5e-18
d1f80d_74 a.28.1.1 (D:) Acyl carrier protein {Bacillus subti 2e-16
d1klpa_115 a.28.1.1 (A:) Acyl carrier protein {Mycobacterium 1e-12
d1dv5a_80 a.28.1.3 (A:) apo-D-alanyl carrier protein {Lactob 7e-12
d1vkua_85 a.28.1.1 (A:) Acyl carrier protein {Thermotoga mar 6e-11
d1nq4a_95 a.28.1.1 (A:) Oxytetracycline polyketide synthase 2e-07
d1or5a_82 a.28.1.1 (A:) Frenolicin polyketide synthase acyl 4e-07
d2af8a_86 a.28.1.1 (A:) Actinorhodin polyketide synthase acy 6e-07
d2jq4a183 a.28.1.1 (A:1-83) Hypothetical protein Atu2571 {Ag 2e-06
>d1t8ka_ a.28.1.1 (A:) Acyl carrier protein {Escherichia coli [TaxId: 562]} Length = 77 Back     information, alignment and structure

class: All alpha proteins
fold: Acyl carrier protein-like
superfamily: ACP-like
family: Acyl-carrier protein (ACP)
domain: Acyl carrier protein
species: Escherichia coli [TaxId: 562]
 Score = 71.4 bits (175), Expect = 5e-18
 Identities = 32/73 (43%), Positives = 41/73 (56%)

Query: 70  EIMHRVIALVKKFDKTDAHKVTETADFQKDLSLDSLDRVELVMAFEEEFSVEIPEEKADK 129
            I  RV  ++ +       +VT  A F +DL  DSLD VELVMA EEEF  EIP+E+A+K
Sbjct: 2   TIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEK 61

Query: 130 LTCCADVARYIAS 142
           +T       YI  
Sbjct: 62  ITTVQAAIDYING 74


>d1f80d_ a.28.1.1 (D:) Acyl carrier protein {Bacillus subtilis [TaxId: 1423]} Length = 74 Back     information, alignment and structure
>d1klpa_ a.28.1.1 (A:) Acyl carrier protein {Mycobacterium tuberculosis [TaxId: 1773]} Length = 115 Back     information, alignment and structure
>d1dv5a_ a.28.1.3 (A:) apo-D-alanyl carrier protein {Lactobacillus casei [TaxId: 1582]} Length = 80 Back     information, alignment and structure
>d1vkua_ a.28.1.1 (A:) Acyl carrier protein {Thermotoga maritima [TaxId: 2336]} Length = 85 Back     information, alignment and structure
>d1nq4a_ a.28.1.1 (A:) Oxytetracycline polyketide synthase acyl carrier {Streptomyces rimosus [TaxId: 1927]} Length = 95 Back     information, alignment and structure
>d1or5a_ a.28.1.1 (A:) Frenolicin polyketide synthase acyl carrier protein, Fren ACP {Streptomyces roseofulvus [TaxId: 33902]} Length = 82 Back     information, alignment and structure
>d2af8a_ a.28.1.1 (A:) Actinorhodin polyketide synthase acyl carrier protein, ACT ACP {Streptomyces coelicolor, A3(2) [TaxId: 1902]} Length = 86 Back     information, alignment and structure
>d2jq4a1 a.28.1.1 (A:1-83) Hypothetical protein Atu2571 {Agrobacterium tumefaciens [TaxId: 358]} Length = 83 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
d1t8ka_77 Acyl carrier protein {Escherichia coli [TaxId: 562 99.84
d1f80d_74 Acyl carrier protein {Bacillus subtilis [TaxId: 14 99.78
d1vkua_85 Acyl carrier protein {Thermotoga maritima [TaxId: 99.76
d1klpa_115 Acyl carrier protein {Mycobacterium tuberculosis [ 99.73
d1dv5a_80 apo-D-alanyl carrier protein {Lactobacillus casei 99.69
d2af8a_86 Actinorhodin polyketide synthase acyl carrier prot 99.64
d1nq4a_95 Oxytetracycline polyketide synthase acyl carrier { 99.64
d2jq4a183 Hypothetical protein Atu2571 {Agrobacterium tumefa 99.57
d1or5a_82 Frenolicin polyketide synthase acyl carrier protei 99.53
d2gdwa176 Peptidyl carrier protein (PCP), thioester domain { 99.26
d2pnga176 Type I fatty acid synthase ACP domain {Rat (Rattus 99.21
d2gyc3147 Ribosomal protein L7/12, oligomerisation (N-termin 90.07
>d1t8ka_ a.28.1.1 (A:) Acyl carrier protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Acyl carrier protein-like
superfamily: ACP-like
family: Acyl-carrier protein (ACP)
domain: Acyl carrier protein
species: Escherichia coli [TaxId: 562]
Probab=99.84  E-value=4e-21  Score=127.95  Aligned_cols=75  Identities=43%  Similarity=0.605  Sum_probs=72.6

Q ss_pred             HHHHHHHHHHHhhhCCCCCCCCCCCCccccCCCChhHHHHHHHHHHHHhCCccChhhhccCCCHHHHHHHHHHhh
Q 032037           70 EIMHRVIALVKKFDKTDAHKVTETADFQKDLSLDSLDRVELVMAFEEEFSVEIPEEKADKLTCCADVARYIASEA  144 (148)
Q Consensus        70 eI~~~I~~il~~~l~vd~~~It~d~~l~~dLGlDSLd~VELv~~LEeeFgIeIp~~dl~~~~TV~dlv~~I~~~~  144 (148)
                      +|.++|++++++.+++++++|+++++|.+|||||||+.+|++.++|++||++||++++.++.||+++++||.++.
T Consensus         2 ~I~~~v~~iia~~l~i~~~~i~~~~~l~~dLg~DSl~~~el~~~iE~~f~i~i~~~~~~~~~Tv~dlv~~i~~~~   76 (77)
T d1t8ka_           2 TIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQ   76 (77)
T ss_dssp             CHHHHHHHHHHHHHTCCGGGCCTTCBTTTTTCCCHHHHHHHHHHHHHHHTCCCCHHHHTTCCBHHHHHHHHHHTC
T ss_pred             cHHHHHHHHHHHHHCCCHHHcCCCCcchhccccchhHHHHHHHHHHHHhCCCCCHHHHHhCCCHHHHHHHHHHcc
Confidence            588999999999999999999999999889999999999999999999999999999999999999999999875



>d1f80d_ a.28.1.1 (D:) Acyl carrier protein {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vkua_ a.28.1.1 (A:) Acyl carrier protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1klpa_ a.28.1.1 (A:) Acyl carrier protein {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dv5a_ a.28.1.3 (A:) apo-D-alanyl carrier protein {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2af8a_ a.28.1.1 (A:) Actinorhodin polyketide synthase acyl carrier protein, ACT ACP {Streptomyces coelicolor, A3(2) [TaxId: 1902]} Back     information, alignment and structure
>d1nq4a_ a.28.1.1 (A:) Oxytetracycline polyketide synthase acyl carrier {Streptomyces rimosus [TaxId: 1927]} Back     information, alignment and structure
>d2jq4a1 a.28.1.1 (A:1-83) Hypothetical protein Atu2571 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1or5a_ a.28.1.1 (A:) Frenolicin polyketide synthase acyl carrier protein, Fren ACP {Streptomyces roseofulvus [TaxId: 33902]} Back     information, alignment and structure
>d2gdwa1 a.28.1.2 (A:8-83) Peptidyl carrier protein (PCP), thioester domain {Bacillus brevis [TaxId: 1393]} Back     information, alignment and structure
>d2pnga1 a.28.1.1 (A:1-76) Type I fatty acid synthase ACP domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gyc31 a.108.1.1 (3:2-48) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure