Citrus Sinensis ID: 032061

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MDVRESISNQTDVALSLTKHVALTEAKDSNLVFSPSSIHVLLSLISAGSKGPTLDQLLSFLKSKSDDQLNTFASELVAVVFADGSPSGGPRLSVANGVWIDKSLSLKNTFKQVVDNVYKAASNQVDFQTKVKTLSWYTTVIHEGLKFT
ccHHHHHHHHHHHHHHHHHHHHccccccccEEEccHHHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccEEEEEEEHHHcccccccHHHHHHHHcccccccEEcccccHHHHHHHHHHHHHcccccc
ccHHHHHHHHHHHHHHHHHHHHccccccccEEEcHHHHHHHHHHHHHcccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccEEEEEccEEEcccccccHHHHHHHHHHHcccEcEccccccHHHHHHHHHHHHcccccc
mdvresisNQTDVALSLTKHVAlteakdsnlvfspSSIHVLLSLIsagskgptLDQLLSFLKSKSDDQLNTFASELVAVVFadgspsggprlsvangvwidkslslKNTFKQVVDNVYKAASNQVDFQTKVKTLSWYTTVIHEGLKFT
mdvresisnqtdvALSLTKHVALTEAKDSNLVFSPSSIHVLLSLISAGSKGPTLDQLLSFLKSKSDDQLNTFASELVAVVFADGSPSGGPRLSVANGVWIDKSLSLKNTFKQVVDNVYKaasnqvdfqtkvktlswyTTVIHEGLKFT
MDVRESISNQTDVALSLTKHVALTEAKDSNLVFSPSSIHVLLSLISAGSKGPTLDQLLSFLKSKSDDQLNTFASELVAVVFADGSPSGGPRLSVANGVWIDKSLSLKNTFKQVVDNVYKAASNQVDFQTKVKTLSWYTTVIHEGLKFT
**************LSLTKHVALTEAKDSNLVFSPSSIHVLLSLISAGSKGPTLDQLLSFLK****DQLNTFASELVAVVFADGS**GGPRLSVANGVWIDKSLSLKNTFKQVVDNVYKAASNQVDFQTKVKTLSWYTTVIHEGL***
*****SISNQTDVALSLTKHVALTEAKDSNLVFSPSSIHVLLSLISAGSKGPTLDQLLSFLKSKSDDQLNTFASELVAVV*******GGPRLSVANGVWIDKSLSLKNTFKQVVDNVYKAASNQVDFQTKVKTLSWYTTVIHEG****
**********TDVALSLTKHVALTEAKDSNLVFSPSSIHVLLSLISAGSKGPTLDQLLSFLKSKSDDQLNTFASELVAVVFADGSPSGGPRLSVANGVWIDKSLSLKNTFKQVVDNVYKAASNQVDFQTKVKTLSWYTTVIHEGLKFT
MDVRESISNQTDVALSLTKHVALTEAKDSNLVFSPSSIHVLLSLISAGSKGPTLDQLLSFLKSKSDDQLNTFASELVAVVFADGSPSGGPRLSVANGVWIDKSLSLKNTFKQVVDNVYKAASNQVDFQTKVKTLSWYTTVIHEGLKFT
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDVRESISNQTDVALSLTKHVALTEAKDSNLVFSPSSIHVLLSLISAGSKGPTLDQLLSFLKSKSDDQLNTFASELVAVVFADGSPSGGPRLSVANGVWIDKSLSLKNTFKQVVDNVYKAASNQVDFQTKVKTLSWYTTVIHEGLKFT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query148 2.2.26 [Sep-21-2011]
Q9S7T8 391 Serpin-ZX OS=Arabidopsis yes no 0.878 0.332 0.638 2e-42
Q9M1T7 393 Serpin-Z4 OS=Arabidopsis no no 0.878 0.330 0.523 2e-28
Q9SH52 385 Serpin-Z1 OS=Arabidopsis no no 0.905 0.348 0.459 3e-28
Q9SIR9 385 Serpin-Z10 OS=Arabidopsis no no 0.851 0.327 0.523 6e-27
O04582 433 Probable non-inhibitory s no no 0.905 0.309 0.442 2e-25
Q10GX0 405 Serpin-ZXB OS=Oryza sativ yes no 0.871 0.318 0.443 4e-24
Q75H81 396 Serpin-ZXA OS=Oryza sativ no no 0.891 0.333 0.460 7e-24
Q9ZQR6 407 Serpin-Z2 OS=Arabidopsis no no 0.905 0.329 0.407 9e-23
O48706 389 Serpin-Z3 OS=Arabidopsis no no 0.851 0.323 0.488 1e-22
Q9ST58 398 Serpin-Z1C OS=Triticum ae N/A no 0.871 0.324 0.446 2e-22
>sp|Q9S7T8|SPZX_ARATH Serpin-ZX OS=Arabidopsis thaliana GN=At1g47710 PE=1 SV=1 Back     alignment and function desciption
 Score =  171 bits (433), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 83/130 (63%), Positives = 109/130 (83%)

Query: 1   MDVRESISNQTDVALSLTKHVALTEAKDSNLVFSPSSIHVLLSLISAGSKGPTLDQLLSF 60
           MDVRESIS Q  V+++L KHV  T +++SN++FSP+SI+V+LS+I+AGS G T DQ+LSF
Sbjct: 1   MDVRESISLQNQVSMNLAKHVITTVSQNSNVIFSPASINVVLSIIAAGSAGATKDQILSF 60

Query: 61  LKSKSDDQLNTFASELVAVVFADGSPSGGPRLSVANGVWIDKSLSLKNTFKQVVDNVYKA 120
           LK  S DQLN+F+SE+V+ V ADGS +GGP+LSVANG WIDKSLS K +FKQ++++ YKA
Sbjct: 61  LKFSSTDQLNSFSSEIVSAVLADGSANGGPKLSVANGAWIDKSLSFKPSFKQLLEDSYKA 120

Query: 121 ASNQVDFQTK 130
           ASNQ DFQ+K
Sbjct: 121 ASNQADFQSK 130
Inhibits metacaspase-9 cysteine protease.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9M1T7|SPZ4_ARATH Serpin-Z4 OS=Arabidopsis thaliana GN=At3g45220 PE=2 SV=1 Back     alignment and function description
>sp|Q9SH52|SPZ1_ARATH Serpin-Z1 OS=Arabidopsis thaliana GN=At1g64030 PE=2 SV=2 Back     alignment and function description
>sp|Q9SIR9|SPZ10_ARATH Serpin-Z10 OS=Arabidopsis thaliana GN=At2g25240 PE=2 SV=1 Back     alignment and function description
>sp|O04582|SPZ5_ARATH Probable non-inhibitory serpin-Z5 OS=Arabidopsis thaliana GN=At1g62170 PE=2 SV=2 Back     alignment and function description
>sp|Q10GX0|SPZXB_ORYSJ Serpin-ZXB OS=Oryza sativa subsp. japonica GN=Os03g0610800 PE=2 SV=1 Back     alignment and function description
>sp|Q75H81|SPZXA_ORYSJ Serpin-ZXA OS=Oryza sativa subsp. japonica GN=Os03g0610650 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZQR6|SPZ2_ARATH Serpin-Z2 OS=Arabidopsis thaliana GN=At2g14540 PE=2 SV=1 Back     alignment and function description
>sp|O48706|SPZ3_ARATH Serpin-Z3 OS=Arabidopsis thaliana GN=At2g26390 PE=3 SV=1 Back     alignment and function description
>sp|Q9ST58|SPZ1C_WHEAT Serpin-Z1C OS=Triticum aestivum PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
26224736 389 serpin-like protein, partial [Citrus x p 0.898 0.341 0.962 4e-64
255538432 391 Protein Z, putative [Ricinus communis] g 0.878 0.332 0.776 1e-50
147810055 389 hypothetical protein VITISV_021647 [Viti 0.878 0.334 0.723 3e-47
302142381 376 unnamed protein product [Vitis vinifera] 0.851 0.335 0.722 7e-45
359492076 445 PREDICTED: serpin-ZX [Vitis vinifera] 0.851 0.283 0.722 8e-45
449470035 389 PREDICTED: serpin-ZX-like [Cucumis sativ 0.878 0.334 0.669 1e-43
58416137 389 serpin [Cucumis sativus] 0.878 0.334 0.669 1e-43
255640324133 unknown [Glycine max] 0.878 0.977 0.676 3e-43
356510338 389 PREDICTED: serpin-ZX-like [Glycine max] 0.878 0.334 0.676 3e-43
356519136 389 PREDICTED: serpin-ZX-like [Glycine max] 0.878 0.334 0.676 9e-43
>gi|26224736|gb|AAN76362.1| serpin-like protein, partial [Citrus x paradisi] Back     alignment and taxonomy information
 Score =  248 bits (634), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 128/133 (96%), Positives = 129/133 (96%)

Query: 3   VRESISNQTDVALSLTKHVALTEAKDSNLVFSPSSIHVLLSLISAGSKGPTLDQLLSFLK 62
           VRESISNQTDVALSLTKHVALTEAKDSNLVFSPSSIHVLLSLISAGSKGPTLDQLLSFLK
Sbjct: 1   VRESISNQTDVALSLTKHVALTEAKDSNLVFSPSSIHVLLSLISAGSKGPTLDQLLSFLK 60

Query: 63  SKSDDQLNTFASELVAVVFADGSPSGGPRLSVANGVWIDKSLSLKNTFKQVVDNVYKAAS 122
           SKSDDQLNTFASELVAVVFADGSPSGGPRLSVANGVWIDKSLSLKNTFKQVVDNVYKAAS
Sbjct: 61  SKSDDQLNTFASELVAVVFADGSPSGGPRLSVANGVWIDKSLSLKNTFKQVVDNVYKAAS 120

Query: 123 NQVDFQTKVKTLS 135
           NQVD QTK   +S
Sbjct: 121 NQVDSQTKAAEVS 133

Source: Citrus x paradisi

Species: Citrus x paradisi

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255538432|ref|XP_002510281.1| Protein Z, putative [Ricinus communis] gi|223550982|gb|EEF52468.1| Protein Z, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147810055|emb|CAN78278.1| hypothetical protein VITISV_021647 [Vitis vinifera] Back     alignment and taxonomy information
>gi|302142381|emb|CBI19584.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359492076|ref|XP_002284126.2| PREDICTED: serpin-ZX [Vitis vinifera] Back     alignment and taxonomy information
>gi|449470035|ref|XP_004152724.1| PREDICTED: serpin-ZX-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|58416137|emb|CAI43280.1| serpin [Cucumis sativus] Back     alignment and taxonomy information
>gi|255640324|gb|ACU20450.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356510338|ref|XP_003523896.1| PREDICTED: serpin-ZX-like [Glycine max] Back     alignment and taxonomy information
>gi|356519136|ref|XP_003528230.1| PREDICTED: serpin-ZX-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
TAIR|locus:2015443 391 SERPIN1 "AT1G47710" [Arabidops 0.878 0.332 0.638 3.3e-40
TAIR|locus:2096910 393 AT3G45220 "AT3G45220" [Arabido 0.878 0.330 0.523 6.4e-28
TAIR|locus:2024532 385 SRP3 "AT1G64030" [Arabidopsis 0.891 0.342 0.466 2.2e-27
TAIR|locus:2059585 385 CCP3 "AT2G25240" [Arabidopsis 0.851 0.327 0.523 4.5e-27
TAIR|locus:2066316 389 AT2G26390 "AT2G26390" [Arabido 0.844 0.321 0.492 1.1e-23
TAIR|locus:2055185 407 SRP2 "AT2G14540" [Arabidopsis 0.891 0.324 0.413 3.8e-23
UNIPROTKB|Q10GX0 405 LOC_Os03g41438 "Serpin-ZXB" [O 0.871 0.318 0.457 2.5e-22
TAIR|locus:2062400 374 AT2G35580 "AT2G35580" [Arabido 0.864 0.342 0.424 5.5e-22
TAIR|locus:2024552121 AT1G64020 [Arabidopsis thalian 0.797 0.975 0.434 2.1e-20
UNIPROTKB|Q94DW6 411 LOC_Os01g56010 "Serpin-Z1" [Or 0.891 0.321 0.352 5.6e-18
TAIR|locus:2015443 SERPIN1 "AT1G47710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 428 (155.7 bits), Expect = 3.3e-40, P = 3.3e-40
 Identities = 83/130 (63%), Positives = 109/130 (83%)

Query:     1 MDVRESISNQTDVALSLTKHVALTEAKDSNLVFSPSSIHVLLSLISAGSKGPTLDQLLSF 60
             MDVRESIS Q  V+++L KHV  T +++SN++FSP+SI+V+LS+I+AGS G T DQ+LSF
Sbjct:     1 MDVRESISLQNQVSMNLAKHVITTVSQNSNVIFSPASINVVLSIIAAGSAGATKDQILSF 60

Query:    61 LKSKSDDQLNTFASELVAVVFADGSPSGGPRLSVANGVWIDKSLSLKNTFKQVVDNVYKA 120
             LK  S DQLN+F+SE+V+ V ADGS +GGP+LSVANG WIDKSLS K +FKQ++++ YKA
Sbjct:    61 LKFSSTDQLNSFSSEIVSAVLADGSANGGPKLSVANGAWIDKSLSFKPSFKQLLEDSYKA 120

Query:   121 ASNQVDFQTK 130
             ASNQ DFQ+K
Sbjct:   121 ASNQADFQSK 130
GO:0004867 "serine-type endopeptidase inhibitor activity" evidence=IEA;ISS;IBA
GO:0005576 "extracellular region" evidence=ISM
GO:0010951 "negative regulation of endopeptidase activity" evidence=IBA
GO:0030162 "regulation of proteolysis" evidence=IBA
GO:0004869 "cysteine-type endopeptidase inhibitor activity" evidence=IDA
GO:0048046 "apoplast" evidence=IDA
TAIR|locus:2096910 AT3G45220 "AT3G45220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024532 SRP3 "AT1G64030" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2059585 CCP3 "AT2G25240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2066316 AT2G26390 "AT2G26390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055185 SRP2 "AT2G14540" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q10GX0 LOC_Os03g41438 "Serpin-ZXB" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2062400 AT2G35580 "AT2G35580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024552 AT1G64020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q94DW6 LOC_Os01g56010 "Serpin-Z1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00014745001
SubName- Full=Putative uncharacterized protein (Chromosome chr18 scaffold_1, whole genome shotgun sequence); (389 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
cd02043 381 cd02043, plant_SERPIN, SERine Proteinase INhibitor 2e-51
pfam00079 369 pfam00079, Serpin, Serpin (serine protease inhibit 2e-25
cd00172 364 cd00172, SERPIN, SERine Proteinase INhibitors (ser 2e-21
smart00093 359 smart00093, SERPIN, SERine Proteinase INhibitors 1e-15
cd02058 380 cd02058, PAI-2, Plasminogen Activator Inhibitor-2 1e-08
cd02048 388 cd02048, neuroserpin, Neuroserpin is a inhibitory 2e-08
cd02056 361 cd02056, alpha-1-antitrypsin_like, alpha-1-antitry 2e-08
cd02045 381 cd02045, antithrombin-III_like, Antithrombin is a 5e-08
cd02049 364 cd02049, bacterial_SERPIN, SERine Proteinase INhib 9e-08
COG4826 410 COG4826, COG4826, Serine protease inhibitor [Postt 2e-07
cd02044 370 cd02044, ov-serpin, ovalbumin family of serpins (o 5e-07
cd02059 389 cd02059, ovalbumin_like, The ovalbumin_like group 9e-06
cd02051 377 cd02051, PAI-1_nexin-1, Plasminogen activator inhi 1e-04
cd02057 372 cd02057, maspin_like, Maspin (mammary serine prote 0.003
cd02047 436 cd02047, HCII, Heparin cofactor II (HCII) inhibits 0.003
>gnl|CDD|238998 cd02043, plant_SERPIN, SERine Proteinase INhibitors (serpins), plant specific subgroup Back     alignment and domain information 
 Score =  167 bits (425), Expect = 2e-51
 Identities = 72/123 (58%), Positives = 91/123 (73%)

Query: 8   SNQTDVALSLTKHVALTEAKDSNLVFSPSSIHVLLSLISAGSKGPTLDQLLSFLKSKSDD 67
            NQ  VA+ L+ HVA    K SN++FSP SI+V LSL++AG++G TLDQLLSFL S S D
Sbjct: 1   KNQCLVAMRLSGHVAAAAGKGSNVIFSPLSINVALSLVAAGARGETLDQLLSFLGSPSTD 60

Query: 68  QLNTFASELVAVVFADGSPSGGPRLSVANGVWIDKSLSLKNTFKQVVDNVYKAASNQVDF 127
           +L+  A+ +V +V AD S SGGPRLS ANGVW+DKSLSLK +FK +  N YKA +  VDF
Sbjct: 61  ELHAVAASIVDLVLADASASGGPRLSFANGVWVDKSLSLKPSFKDLAANSYKAEARPVDF 120

Query: 128 QTK 130
           +TK
Sbjct: 121 RTK 123

It has been suggested that plant serpins play a role in defense against insect predators. This subgroup corresponds to clade P of the serpin superfamily. In general, serpins exhibit conformational polymorphism shifting from native to cleaved, latent, delta, or polymorphic forms. Many serpins, such as antitrypsin and antichymotrypsin, function as serine protease inhibitors which regulate blood coagulation cascades. Non-inhibitory serpins perform many diverse functions such as chaperoning proteins or transporting hormones. Length = 381
>gnl|CDD|215699 pfam00079, Serpin, Serpin (serine protease inhibitor) Back     alignment and domain information
>gnl|CDD|238101 cd00172, SERPIN, SERine Proteinase INhibitors (serpins) exhibit conformational polymorphism shifting from native to cleaved, latent, delta, or polymorphic forms Back     alignment and domain information
>gnl|CDD|214513 smart00093, SERPIN, SERine Proteinase INhibitors Back     alignment and domain information
>gnl|CDD|239013 cd02058, PAI-2, Plasminogen Activator Inhibitor-2 (PAI-2) Back     alignment and domain information
>gnl|CDD|239003 cd02048, neuroserpin, Neuroserpin is a inhibitory member of the SERine Proteinase INhibitor (serpin) family that reacts preferentially with tissue-type plasminogen activator (tPA) Back     alignment and domain information
>gnl|CDD|239011 cd02056, alpha-1-antitrypsin_like, alpha-1-antitrypsin_like Back     alignment and domain information
>gnl|CDD|239000 cd02045, antithrombin-III_like, Antithrombin is a serine proteinase inhibitor (serpin) which controls the process of coagulation Back     alignment and domain information
>gnl|CDD|239004 cd02049, bacterial_SERPIN, SERine Proteinase INhibitors (serpins), prokaryotic subgroup Back     alignment and domain information
>gnl|CDD|227163 COG4826, COG4826, Serine protease inhibitor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238999 cd02044, ov-serpin, ovalbumin family of serpins (ov-serpins) Back     alignment and domain information
>gnl|CDD|239014 cd02059, ovalbumin_like, The ovalbumin_like group of serpins contains ovalbumin, the squamous cell carcinoma antigen 1 (SCCA1) and other closely related serpins of clade B of the serpin superfamily Back     alignment and domain information
>gnl|CDD|239006 cd02051, PAI-1_nexin-1, Plasminogen activator inhibitor-1_like Back     alignment and domain information
>gnl|CDD|239012 cd02057, maspin_like, Maspin (mammary serine proteinase inhibitor), a member of the serpin superfamily, with a multitude of effects on cells and tissues at an assortment of developmental stages Back     alignment and domain information
>gnl|CDD|239002 cd02047, HCII, Heparin cofactor II (HCII) inhibits thrombin, the final protease of the coagulation cascade Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 148
cd02054 372 angiotensinogen Angiotensinogen is part of the ren 99.97
COG4826 410 Serine protease inhibitor [Posttranslational modif 99.97
cd02044 370 ov-serpin ovalbumin family of serpins (ov-serpins) 99.96
cd02047 436 HCII Heparin cofactor II (HCII) inhibits thrombin, 99.96
cd02049 364 bacterial_SERPIN SERine Proteinase INhibitors (ser 99.96
cd02057 372 maspin_like Maspin (mammary serine proteinase inhi 99.96
cd02043 381 plant_SERPIN SERine Proteinase INhibitors (serpins 99.96
cd02058 380 PAI-2 Plasminogen Activator Inhibitor-2 (PAI-2). P 99.96
cd02059 389 ovalbumin_like The ovalbumin_like group of serpins 99.96
cd02046 366 hsp47 Heat shock protein 47 (Hsp47), also called c 99.96
cd02056 361 alpha-1-antitrypsin_like alpha-1-antitrypsin_like. 99.96
cd02051 377 PAI-1_nexin-1 Plasminogen activator inhibitor-1_li 99.96
cd00172 364 SERPIN SERine Proteinase INhibitors (serpins) exhi 99.96
cd02045 381 antithrombin-III_like Antithrombin is a serine pro 99.96
PF00079 371 Serpin: Serpin (serine protease inhibitor); InterP 99.96
cd02048 388 neuroserpin Neuroserpin is a inhibitory member of 99.96
cd02052 374 PEDF Pigment epithelium-derived factor (PEDF)_like 99.95
KOG2392 380 consensus Serpin [Defense mechanisms] 99.95
cd02055 365 PZI Protein Z-dependent protease inhibitor (ZPI) i 99.95
smart00093 359 SERPIN SERine Proteinase INhibitors. 99.95
cd02053 351 alpha2AP Alpha2-antiplasmin (alpha2AP) is the prim 99.94
cd02050 352 C1_inh C1 inhibitor (C1-Inh) is a protease inhibit 99.94
PHA02948 373 serine protease inhibitor-like protein; Provisiona 99.91
PHA02660 364 serpin-like protein; Provisional 99.87
>cd02054 angiotensinogen Angiotensinogen is part of the renin-angiotensin system (RAS), which plays an important role in blood pressure regulation, renal haemodynamics, fluid and electrolyte homeostasis Back     alignment and domain information 
Probab=99.97  E-value=8.3e-30  Score=196.54  Aligned_cols=137  Identities=17%  Similarity=0.143  Sum_probs=117.6

Q ss_pred             hhhhhHHHHHHHHHHHHhccCCCCcEEEccccHHHHHHHHHcCCCCchHHHHHHhcCCCCh------------HHHHHHH
Q 032061            6 SISNQTDVALSLTKHVALTEAKDSNLVFSPSSIHVLLSLISAGSKGPTLDQLLSFLKSKSD------------DQLNTFA   73 (148)
Q Consensus         6 ~~~~~~~F~~~L~~~l~~~~~~~~N~v~SP~si~~~L~~l~~ga~g~T~~el~~~L~~~~~------------~~~~~~~   73 (148)
                      |+..+++||++||+.+... .+++|+|+||+||+.+|+|++.||+|+|++||.++|+++..            .+++..+
T Consensus         2 ~~~~~~~f~~~l~~~l~~~-~~~~N~v~SP~Si~~aL~ml~~GA~G~T~~el~~~L~~~~~~~~~~~~~~~~~~~~~~~~   80 (372)
T cd02054           2 LAMLVNVLGLRMYGMLSEL-WVHTNTLLSPTSVFGTLASLYLGASKKTADSLQALLGLPWKSKNSDCTSRVDGHKVLSTL   80 (372)
T ss_pred             hHHHHHHHHHHHHHHHHhh-CCCCCEEEChHHHHHHHHHHHcCCCccHHHHHHHHhCCCcccccccccccccHHHHHHHH
Confidence            5678899999999999864 57889999999999999999999999999999999998732            2345566


Q ss_pred             HHHHHHHhhCCCCCCCCeeEeeeeeeecCCCCCChhHHHHHHhhcccc-ceEecCCCCccc----chhHHHhhcCCcc
Q 032061           74 SELVAVVFADGSPSGGPRLSVANGVWIDKSLSLKNTFKQVVDNVYKAA-SNQVDFQTKVKT----LSWYTTVIHEGLK  146 (148)
Q Consensus        74 ~~l~~~l~~~~~~~~~~~l~~~n~l~~~~~~~~~~~f~~~~~~~y~~~-~~~~df~~~~~~----N~wv~~~T~g~I~  146 (148)
                      +.+...+..   ......+..+|++|++++++++++|++.++++|+++ ++.+||.++..+    |+||+++|+|+|+
T Consensus        81 ~~~~~~~~~---~~~~~~l~~a~~i~~~~~~~l~~~f~~~~~~~y~a~~~~~vdF~~~~~a~~~IN~WV~~~T~g~I~  155 (372)
T cd02054          81 QAIQSLVDA---QGRQLLLSTVVWTFTAPGIHLSQPFVQGLADFSDASFPRSVDFTEPDVAEEKINNFVQATSDGKVK  155 (372)
T ss_pred             HHHHHHHcC---CCCccEEEEEEEEEecCCCCccHHHHHHHHHHhCcccceeecCCChHHHHHHHHHHHHHHhcCchh
Confidence            666655542   234567999999999999999999999999999997 999999886654    9999999999997

It is also involved in normal and abnormal growth processes. The growth promoting actions of angiotensin have been shown in a variety of cells and tissues. This subgroup represents clade A8 of the serpin superfamily. In general, SERine Proteinase INhibitors (serpins) exhibit conformational polymorphism shifting from native to cleaved, latent, delta, or polymorphic forms. Many serpins, such as antitrypsin and antichymotrypsin, function as serine protease inhibitors which regulate blood coagulation cascades. Non-inhibitory serpins perform many diverse functions such as chaperoning proteins or transporting hormones.
>COG4826 Serine protease inhibitor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02044 ov-serpin ovalbumin family of serpins (ov-serpins) Back     alignment and domain information
>cd02047 HCII Heparin cofactor II (HCII) inhibits thrombin, the final protease of the coagulation cascade Back     alignment and domain information
>cd02049 bacterial_SERPIN SERine Proteinase INhibitors (serpins), prokaryotic subgroup Back     alignment and domain information
>cd02057 maspin_like Maspin (mammary serine proteinase inhibitor), a member of the serpin superfamily, with a multitude of effects on cells and tissues at an assortment of developmental stages Back     alignment and domain information
>cd02043 plant_SERPIN SERine Proteinase INhibitors (serpins), plant specific subgroup Back     alignment and domain information
>cd02058 PAI-2 Plasminogen Activator Inhibitor-2 (PAI-2) Back     alignment and domain information
>cd02059 ovalbumin_like The ovalbumin_like group of serpins contains ovalbumin, the squamous cell carcinoma antigen 1 (SCCA1) and other closely related serpins of clade B of the serpin superfamily Back     alignment and domain information
>cd02046 hsp47 Heat shock protein 47 (Hsp47), also called colligin, because of its collagen binding ability, is a chaperone specific for procollagen Back     alignment and domain information
>cd02056 alpha-1-antitrypsin_like alpha-1-antitrypsin_like Back     alignment and domain information
>cd02051 PAI-1_nexin-1 Plasminogen activator inhibitor-1_like Back     alignment and domain information
>cd00172 SERPIN SERine Proteinase INhibitors (serpins) exhibit conformational polymorphism shifting from native to cleaved, latent, delta, or polymorphic forms Back     alignment and domain information
>cd02045 antithrombin-III_like Antithrombin is a serine proteinase inhibitor (serpin) which controls the process of coagulation Back     alignment and domain information
>PF00079 Serpin: Serpin (serine protease inhibitor); InterPro: IPR023796 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively Back     alignment and domain information
>cd02048 neuroserpin Neuroserpin is a inhibitory member of the SERine Proteinase INhibitor (serpin) family that reacts preferentially with tissue-type plasminogen activator (tPA) Back     alignment and domain information
>cd02052 PEDF Pigment epithelium-derived factor (PEDF)_like Back     alignment and domain information
>KOG2392 consensus Serpin [Defense mechanisms] Back     alignment and domain information
>cd02055 PZI Protein Z-dependent protease inhibitor (ZPI) is a member of the serpin superfamily of proteinase inhibitors (clade A10) Back     alignment and domain information
>smart00093 SERPIN SERine Proteinase INhibitors Back     alignment and domain information
>cd02053 alpha2AP Alpha2-antiplasmin (alpha2AP) is the primary inhibitor of plasmin, a proteinase that digests fibrin, the main component of blood clots Back     alignment and domain information
>cd02050 C1_inh C1 inhibitor (C1-Inh) is a protease inhibitor of the serpin family Back     alignment and domain information
>PHA02948 serine protease inhibitor-like protein; Provisional Back     alignment and domain information
>PHA02660 serpin-like protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
3le2_A 393 Structure Of Arabidopsis Atserpin1. Native Stressed 2e-43
1yxa_A 398 Serpina3n, A Murine Orthologue Of Human Antichymotr 1e-08
2dut_A 423 Crystal Structure Of A M-Loop Deletion Variant Of M 2e-07
2b4x_I 427 Crystal Structure Of Antithrombin-Iii Length = 427 2e-07
2hij_I 432 Crystal Structure Of P14 Alanine Variant Of Antithr 3e-07
2b4x_L 427 Crystal Structure Of Antithrombin-Iii Length = 427 3e-07
1ath_A 432 The Intact And Cleaved Human Antithrombin Iii Compl 3e-07
1dzg_I 432 N135q-S380c-Antithrombin-Iii Length = 432 3e-07
1dzh_I 432 P14-Fluorescein-N135q-S380c-Antithrombin-Iii Length 3e-07
2h4q_A 382 Crystal Structure Of A M-Loop Deletion Variant Of M 4e-07
1oyh_I 432 Crystal Structure Of P13 Alanine Variant Of Antithr 5e-07
1tb6_I 432 2.5a Crystal Structure Of The Antithrombin-Thrombin 6e-07
4eb1_I 440 Hyperstable In-Frame Insertion Variant Of Antithrom 6e-07
1qmn_A 401 Alpha1-Antichymotrypsin Serpin In The Delta Conform 6e-07
3kcg_I 432 Crystal Structure Of The Antithrombin-Factor Ixa- P 6e-07
2gd4_I 443 Crystal Structure Of The Antithrombin-S195a Factor 6e-07
3caa_A 341 Cleaved Antichymotrypsin A347r Length = 341 8e-07
1as4_A 341 Cleaved Antichymotrypsin A349r Length = 341 8e-07
4caa_A 341 Cleaved Antichymotrypsin T345r Length = 341 8e-07
2ach_A 360 Crystal Structure Of Cleaved Human Alpha1-antichymo 1e-06
3dlw_A 411 Antichymotrypsin Length = 411 1e-06
1att_A 429 Crystal Structure Of Cleaved Bovine Antithrombin Ii 1e-06
1atu_A 374 Uncleaved Alpha-1-Antitrypsin Length = 374 2e-06
1oo8_A 394 Crystal Structure Of A1pi-Pittsburgh In The Native 3e-06
2d26_A 358 Active Site Distortion Is Sufficient For Proteinase 3e-06
1iz2_A 394 Interactions Causing The Kinetic Trap In Serpin Pro 3e-06
1kct_A 394 Alpha1-Antitrypsin Length = 394 4e-06
1hp7_A 394 A 2.1 Angstrom Structure Of An Uncleaved Alpha-1-An 4e-06
2arq_A 382 Human Plasminogen Activator Inhibitor-2.[loop (66-9 1e-05
1d5s_A 334 Crystal Structure Of Cleaved Antitrypsin Polymer Le 1e-05
1psi_A 394 Intact Recombined Alpha1-Antitrypsin Mutant Phe 51 1e-05
1ezx_A 335 Crystal Structure Of A Serpin:protease Complex Leng 2e-05
7api_A 347 The S Variant Of Human Alpha1-Antitrypsin, Structur 2e-05
3t1p_A 371 Crystal Structure Of An Alpha-1-Antitrypsin Trimer 2e-05
3ndd_A 343 Cleaved Antitrypsin With P10 Pro, And P9-P6 Asp Len 2e-05
3ndf_A 343 Cleaved Antitrypsin With P8-P6 Asp Length = 343 2e-05
1qlp_A 394 2.0 Angstrom Structure Of Intact Alpha-1-Antitrypsi 2e-05
3drm_A 404 2.2 Angstrom Crystal Structure Of Thr114phe Alpha1- 2e-05
3ne4_A 424 1.8 Angstrom Structure Of Intact Native Wild-Type A 2e-05
2qug_A 394 Crystal Structure Of Alpha-1-Antitrypsin, Crystal F 2e-05
2vdx_A 373 Crystal Structure Of The Reactive Loop Cleaved Cort 3e-05
4bb2_A 340 Crystal Structure Of Cleaved Corticosteroid-binding 4e-05
3f5n_A 407 Structure Of Native Human Neuroserpin Length = 407 4e-05
1by7_A 382 Human Plasminogen Activator Inhibitor-2. Loop (66-9 4e-05
3fgq_A 397 Crystal Structure Of Native Human Neuroserpin Lengt 5e-05
3f02_A 359 Cleaved Human Neuroserpin Length = 359 5e-05
3ozq_A 376 Crystal Structure Of Serpin48, Which Is A Highly Sp 6e-05
1qmb_A 326 Cleaved Alpha-1-Antitrypsin Polymer Length = 326 9e-05
3dy0_A 336 Crystal Structure Of Cleaved Pci Bound To Heparin L 2e-04
2ol2_A 395 High Resolution Structure Of Native Pci In Space Gr 2e-04
1lq8_A 346 Crystal Structure Of Cleaved Protein C Inhibitor Le 2e-04
2h4r_A 415 Crystal Structure Of Wildtype Ment In The Native Co 2e-04
3dru_A 404 Crystal Structure Of Gly117phe Alpha1-Antitrypsin L 3e-04
2h4p_A 394 Crystal Structure Of Wildtype Ment In The Cleaved C 3e-04
4if8_A 414 Structure Of Vaspin Length = 414 4e-04
2hi9_A 363 Crystal Structure Of Human Native Protein C Inhibit 5e-04
>pdb|3LE2|A Chain A, Structure Of Arabidopsis Atserpin1. Native Stressed Conforma Length = 393 Back     alignment and structure 
Iteration: 1

 Score =  171 bits (432), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 83/130 (63%), Positives = 109/130 (83%)
Query: 1   MDVRESISNQTDVALSLTKHVALTEAKDSNLVFSPSSIHVLLSLISAGSKGPTLDQLLSF 60
           MDVRESIS Q  V+++L KHV  T +++SN++FSP+SI+V+LS+I+AGS G T DQ+LSF
Sbjct: 3   MDVRESISLQNQVSMNLAKHVITTVSQNSNVIFSPASINVVLSIIAAGSAGATKDQILSF 62
Query: 61  LKSKSDDQLNTFASELVAVVFADGSPSGGPRLSVANGVWIDKSLSLKNTFKQVVDNVYKA 120
           LK  S DQLN+F+SE+V+ V ADGS +GGP+LSVANG WIDKSLS K +FKQ++++ YKA
Sbjct: 63  LKFSSTDQLNSFSSEIVSAVLADGSANGGPKLSVANGAWIDKSLSFKPSFKQLLEDSYKA 122
Query: 121 ASNQVDFQTK 130
           ASNQ DFQ+K
Sbjct: 123 ASNQADFQSK 132
>pdb|1YXA|A Chain A, Serpina3n, A Murine Orthologue Of Human Antichymotrypsin Length = 398 Back     alignment and structure
>pdb|2DUT|A Chain A, Crystal Structure Of A M-Loop Deletion Variant Of Ment In The Native Conformation Length = 423 Back     alignment and structure
>pdb|2B4X|I Chain I, Crystal Structure Of Antithrombin-Iii Length = 427 Back     alignment and structure
>pdb|2HIJ|I Chain I, Crystal Structure Of P14 Alanine Variant Of Antithrombin Length = 432 Back     alignment and structure
>pdb|2B4X|L Chain L, Crystal Structure Of Antithrombin-Iii Length = 427 Back     alignment and structure
>pdb|1ATH|A Chain A, The Intact And Cleaved Human Antithrombin Iii Complex As A Model For Serpin-Proteinase Interactions Length = 432 Back     alignment and structure
>pdb|1DZG|I Chain I, N135q-S380c-Antithrombin-Iii Length = 432 Back     alignment and structure
>pdb|1DZH|I Chain I, P14-Fluorescein-N135q-S380c-Antithrombin-Iii Length = 432 Back     alignment and structure
>pdb|2H4Q|A Chain A, Crystal Structure Of A M-Loop Deletion Variant Of Ment In The Cleaved Conformation Length = 382 Back     alignment and structure
>pdb|1OYH|I Chain I, Crystal Structure Of P13 Alanine Variant Of Antithrombin Length = 432 Back     alignment and structure
>pdb|1TB6|I Chain I, 2.5a Crystal Structure Of The Antithrombin-Thrombin-Heparin Ternary Complex Length = 432 Back     alignment and structure
>pdb|4EB1|I Chain I, Hyperstable In-Frame Insertion Variant Of Antithrombin Length = 440 Back     alignment and structure
>pdb|1QMN|A Chain A, Alpha1-Antichymotrypsin Serpin In The Delta Conformation (Partial Loop Insertion) Length = 401 Back     alignment and structure
>pdb|3KCG|I Chain I, Crystal Structure Of The Antithrombin-Factor Ixa- Pentasaccharide Complex Length = 432 Back     alignment and structure
>pdb|2GD4|I Chain I, Crystal Structure Of The Antithrombin-S195a Factor Xa-Pentasaccharide Complex Length = 443 Back     alignment and structure
>pdb|3CAA|A Chain A, Cleaved Antichymotrypsin A347r Length = 341 Back     alignment and structure
>pdb|1AS4|A Chain A, Cleaved Antichymotrypsin A349r Length = 341 Back     alignment and structure
>pdb|4CAA|A Chain A, Cleaved Antichymotrypsin T345r Length = 341 Back     alignment and structure
>pdb|2ACH|A Chain A, Crystal Structure Of Cleaved Human Alpha1-antichymotrypsin At 2.7 Angstroms Resolution And Its Comparison With Other Serpins Length = 360 Back     alignment and structure
>pdb|3DLW|A Chain A, Antichymotrypsin Length = 411 Back     alignment and structure
>pdb|1ATT|A Chain A, Crystal Structure Of Cleaved Bovine Antithrombin Iii At 3.2 Angstroms Resolution Length = 429 Back     alignment and structure
>pdb|1ATU|A Chain A, Uncleaved Alpha-1-Antitrypsin Length = 374 Back     alignment and structure
>pdb|1OO8|A Chain A, Crystal Structure Of A1pi-Pittsburgh In The Native Conformation Length = 394 Back     alignment and structure
>pdb|2D26|A Chain A, Active Site Distortion Is Sufficient For Proteinase Inhibit Second Crystal Structure Of Covalent Serpin-Proteinase Complex Length = 358 Back     alignment and structure
>pdb|1IZ2|A Chain A, Interactions Causing The Kinetic Trap In Serpin Protein Folding Length = 394 Back     alignment and structure
>pdb|1KCT|A Chain A, Alpha1-Antitrypsin Length = 394 Back     alignment and structure
>pdb|1HP7|A Chain A, A 2.1 Angstrom Structure Of An Uncleaved Alpha-1-Antitrypsin Shows Variability Of The Reactive Center And Other Loops Length = 394 Back     alignment and structure
>pdb|2ARQ|A Chain A, Human Plasminogen Activator Inhibitor-2.[loop (66-98) Deletion Mutant] Complexed With Peptide N-Acetyl-Teaaagdggvmtgr-Oh Length = 382 Back     alignment and structure
>pdb|1D5S|A Chain A, Crystal Structure Of Cleaved Antitrypsin Polymer Length = 334 Back     alignment and structure
>pdb|1PSI|A Chain A, Intact Recombined Alpha1-Antitrypsin Mutant Phe 51 To Leu Length = 394 Back     alignment and structure
>pdb|1EZX|A Chain A, Crystal Structure Of A Serpin:protease Complex Length = 335 Back     alignment and structure
>pdb|7API|A Chain A, The S Variant Of Human Alpha1-Antitrypsin, Structure And Implications For Function And Metabolism Length = 347 Back     alignment and structure
>pdb|3T1P|A Chain A, Crystal Structure Of An Alpha-1-Antitrypsin Trimer Length = 371 Back     alignment and structure
>pdb|3NDD|A Chain A, Cleaved Antitrypsin With P10 Pro, And P9-P6 Asp Length = 343 Back     alignment and structure
>pdb|3NDF|A Chain A, Cleaved Antitrypsin With P8-P6 Asp Length = 343 Back     alignment and structure
>pdb|1QLP|A Chain A, 2.0 Angstrom Structure Of Intact Alpha-1-Antitrypsin: A Canonical Template For Active Serpins Length = 394 Back     alignment and structure
>pdb|3DRM|A Chain A, 2.2 Angstrom Crystal Structure Of Thr114phe Alpha1- Antitrypsin Length = 404 Back     alignment and structure
>pdb|3NE4|A Chain A, 1.8 Angstrom Structure Of Intact Native Wild-Type Alpha-1-Antitrypsin Length = 424 Back     alignment and structure
>pdb|2QUG|A Chain A, Crystal Structure Of Alpha-1-Antitrypsin, Crystal Form A Length = 394 Back     alignment and structure
>pdb|2VDX|A Chain A, Crystal Structure Of The Reactive Loop Cleaved Corticosteroid Binding Globulin Length = 373 Back     alignment and structure
>pdb|4BB2|A Chain A, Crystal Structure Of Cleaved Corticosteroid-binding Globulin In Complex With Progesterone Length = 340 Back     alignment and structure
>pdb|3F5N|A Chain A, Structure Of Native Human Neuroserpin Length = 407 Back     alignment and structure
>pdb|1BY7|A Chain A, Human Plasminogen Activator Inhibitor-2. Loop (66-98) Deletion Mutant Length = 382 Back     alignment and structure
>pdb|3FGQ|A Chain A, Crystal Structure Of Native Human Neuroserpin Length = 397 Back     alignment and structure
>pdb|3F02|A Chain A, Cleaved Human Neuroserpin Length = 359 Back     alignment and structure
>pdb|3OZQ|A Chain A, Crystal Structure Of Serpin48, Which Is A Highly Specific Serpin In The Insect Tenebrio Molitor Length = 376 Back     alignment and structure
>pdb|1QMB|A Chain A, Cleaved Alpha-1-Antitrypsin Polymer Length = 326 Back     alignment and structure
>pdb|3DY0|A Chain A, Crystal Structure Of Cleaved Pci Bound To Heparin Length = 336 Back     alignment and structure
>pdb|2OL2|A Chain A, High Resolution Structure Of Native Pci In Space Group P21 Length = 395 Back     alignment and structure
>pdb|1LQ8|A Chain A, Crystal Structure Of Cleaved Protein C Inhibitor Length = 346 Back     alignment and structure
>pdb|2H4R|A Chain A, Crystal Structure Of Wildtype Ment In The Native Conformation Length = 415 Back     alignment and structure
>pdb|3DRU|A Chain A, Crystal Structure Of Gly117phe Alpha1-Antitrypsin Length = 404 Back     alignment and structure
>pdb|2H4P|A Chain A, Crystal Structure Of Wildtype Ment In The Cleaved Conformation Length = 394 Back     alignment and structure
>pdb|4IF8|A Chain A, Structure Of Vaspin Length = 414 Back     alignment and structure
>pdb|2HI9|A Chain A, Crystal Structure Of Human Native Protein C Inhibitor Length = 363 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
3le2_A 393 Serpin-ZX; apoplast, glycoprotein, protease inhibi 7e-41
1sek_A 378 Serpin K; serine protease inhibitor, protease; 2.1 3e-27
1mtp_A 323 Serine proteinase inhibitor (serpin), chain A; str 1e-26
1sng_A 370 COG4826: serine protease inhibitor; serine proteas 1e-26
3kcg_I 432 Antithrombin-III, ATIII; michaelis complex, blood 2e-26
3pzf_A 397 Serpin 2; protease inhibitor, melanization, hydrol 1e-24
3ozq_A 376 Serpin48; SPE, hydrolase I; 1.90A {Tenebrio molito 1e-23
1lj5_A 379 Plasminogen activator inhibitor-1; beta-barrell, b 1e-23
2pef_A 373 Serine protease inhibitor; serpin; 1.60A {Thermoan 1e-23
1wz9_A 375 Maspin precursor; serpin, tumor suppressor, serpin 2e-23
4dy0_A 379 GLIA-derived nexin; serpin, protease inhibitor, th 7e-23
3f5n_A 407 Neuroserpin; cleaved form, fenib, human, tissue PL 1e-22
2arr_A 382 Plasminogen activator inhibitor-2; serpin, peptide 2e-22
1hle_A 345 Horse leukocyte elastase inhibitor; hydrolase inhi 6e-22
1jmo_A 480 HC-II, heparin cofactor II, HLS2, serin; serpin, t 1e-21
3f02_A 359 Neuroserpin; cleaved form, fenib, human, disease M 2e-21
3nda_A 377 Serpin-2; vaccination target, TICK, hydrolase inhi 2e-21
3f1s_A 385 Protein Z-dependent protease inhibitor; PZ, ZPI, c 2e-21
2h4r_A 415 MENT, heterochromatin-associated protein MENT; ser 2e-21
1yxa_A 398 Serine (OR cysteine) proteinase inhibitor, clade 3 3e-21
2r9y_A 430 Alpha-2-antiplasmin; inhibitory serpin, plasmin in 4e-21
2vdx_A 373 Corticosteroid-binding globulin; transport protein 6e-21
3b9f_I 395 Protein C inhibitor; michaelis complex, acute phas 7e-21
2v95_A 371 Corticosteroid-binding globulin; transport protein 8e-21
4au2_A 392 HSP47, serpin peptidase inhibitor, clade H (heat s 1e-20
3ne4_A 424 Alpha-1-antitrypsin; serpin, LUNG disease, liver d 3e-20
1as4_A 341 Antichymotrypsin, ACT; serpin, serine protease inh 4e-20
2oay_A 390 C1-inhibitor, plasma protease C1 inhibitor, C1 INH 4e-20
3dy0_A 336 N-terminus plasma serine protease inhibitor; serpi 4e-20
3ndd_A 343 Alpha-1-antitrypsin; serpin, hydrolase inhibitor; 4e-20
1uhg_A 385 Ovalbumin, S-ovalbumin; allergen, egg white protei 4e-20
3sto_A 406 Serine protease inhibitor; serpin fold, hydrolase 7e-20
2ceo_A 379 Thyroxine-binding globulin; transport, serpin, hor 1e-19
2zv6_A 401 Serpin B3; serine proteinase inhibitor, reactive s 1e-19
1imv_A 398 PEDF, pigment epithelium-derived factor; serpin, a 3e-19
2xn6_A 350 Thyroxine-binding globulin; transport, cleaved pro 4e-19
1qmn_A 401 AACT, alpha-1-antichymotrypsin; serpin, serine pro 7e-19
2wxy_C 453 Angiotensinogen, serpin A8; glycoprotein, hyperten 7e-19
2wxw_A 453 Angiotensinogen, serpin A8; glycoprotein, hyperten 4e-18
2h4p_A 394 MENT, heterochromatin-associated protein MENT; ser 1e-17
1f0c_A 305 ICE inhibitor; apoptosis, caspase inhibitor, prote 4e-15
1m93_A55 Serine proteinase inhibitor 2; serpin, CRMA, apopt 9e-07
1m93_B 245 Serine proteinase inhibitor 2; serpin, CRMA, apopt 2e-04
>3le2_A Serpin-ZX; apoplast, glycoprotein, protease inhibitor, secreted, serine protease inhibitor, hydrolase; 2.20A {Arabidopsis thaliana} Length = 393 Back     alignment and structure
 Score =  139 bits (353), Expect = 7e-41
 Identities = 83/130 (63%), Positives = 109/130 (83%)

Query: 1   MDVRESISNQTDVALSLTKHVALTEAKDSNLVFSPSSIHVLLSLISAGSKGPTLDQLLSF 60
           MDVRESIS Q  V+++L KHV  T +++SN++FSP+SI+V+LS+I+AGS G T DQ+LSF
Sbjct: 3   MDVRESISLQNQVSMNLAKHVITTVSQNSNVIFSPASINVVLSIIAAGSAGATKDQILSF 62

Query: 61  LKSKSDDQLNTFASELVAVVFADGSPSGGPRLSVANGVWIDKSLSLKNTFKQVVDNVYKA 120
           LK  S DQLN+F+SE+V+ V ADGS +GGP+LSVANG WIDKSLS K +FKQ++++ YKA
Sbjct: 63  LKFSSTDQLNSFSSEIVSAVLADGSANGGPKLSVANGAWIDKSLSFKPSFKQLLEDSYKA 122

Query: 121 ASNQVDFQTK 130
           ASNQ DFQ+K
Sbjct: 123 ASNQADFQSK 132
>1sek_A Serpin K; serine protease inhibitor, protease; 2.10A {Manduca sexta} SCOP: e.1.1.1 PDB: 1k9o_I Length = 378 Back     alignment and structure
>1mtp_A Serine proteinase inhibitor (serpin), chain A; structural genomics, protease inhibitor; 1.50A {Thermobifida fusca} SCOP: e.1.1.1 Length = 323 Back     alignment and structure
>1sng_A COG4826: serine protease inhibitor; serine protease inhibitor (serpin), native state., hydrolase inhibitor; 1.76A {Thermobifida fusca} SCOP: e.1.1.1 Length = 370 Back     alignment and structure
>3kcg_I Antithrombin-III, ATIII; michaelis complex, blood coagulation, calcium, disulfide bond, EGF-like domain, glycoprotein, hemophilia, hydrolase; HET: NAG FUC MAN NTP; 1.70A {Homo sapiens} PDB: 1e04_I* 1ath_A 1ant_L* 1br8_L 1azx_I* 1dzh_L* 1e03_L* 1dzg_L* 1e05_L* 1jvq_L* 1lk6_L* 1nq9_I* 1oyh_L* 1r1l_L* 1sr5_A* 2ant_L* 2beh_L* 2hij_L* 2znh_A* 3evj_I* ... Length = 432 Back     alignment and structure
>3pzf_A Serpin 2; protease inhibitor, melanization, hydrolase inhibito; 1.75A {Anopheles gambiae} Length = 397 Back     alignment and structure
>3ozq_A Serpin48; SPE, hydrolase I; 1.90A {Tenebrio molitor} Length = 376 Back     alignment and structure
>1lj5_A Plasminogen activator inhibitor-1; beta-barrell, blood clotting; 1.80A {Homo sapiens} SCOP: e.1.1.1 PDB: 1dvn_A 1c5g_A 1a7c_A* 3q02_A 3q03_A 3r4l_A* 1oc0_A 1b3k_A 3pb1_I 1dvm_A 3eox_A 3cvm_A 1db2_A 9pai_A 3lw2_A 9pai_B Length = 379 Back     alignment and structure
>2pef_A Serine protease inhibitor; serpin; 1.60A {Thermoanaerobacter tengcongensis} PDB: 2vh4_A 2pee_A Length = 373 Back     alignment and structure
>1wz9_A Maspin precursor; serpin, tumor suppressor, serpinb5, signaling protein; HET: CME; 2.10A {Homo sapiens} PDB: 1xu8_A 1xqg_A 1xqj_A Length = 375 Back     alignment and structure
>4dy0_A GLIA-derived nexin; serpin, protease inhibitor, thrombin, cell surface, hydrolas inhibitor; HET: IDS SGN; 2.35A {Homo sapiens} PDB: 4dy7_C Length = 379 Back     alignment and structure
>3f5n_A Neuroserpin; cleaved form, fenib, human, tissue PLAS activator, hydrolase inhibitor; 3.15A {Homo sapiens} Length = 407 Back     alignment and structure
>2arr_A Plasminogen activator inhibitor-2; serpin, peptide binding, hydrolase inhibitor-PEPT complex; 1.55A {Homo sapiens} PDB: 2arq_A 1jrr_A 1by7_A Length = 382 Back     alignment and structure
>1hle_A Horse leukocyte elastase inhibitor; hydrolase inhibitor(serine proteinase); 1.95A {Equus caballus} SCOP: e.1.1.1 Length = 345 Back     alignment and structure
>1jmo_A HC-II, heparin cofactor II, HLS2, serin; serpin, thrombin, protease, inhibition, inhibitor, blood CLO; HET: TYS NDG NAG; 2.20A {Homo sapiens} SCOP: e.1.1.1 PDB: 1jmj_A* Length = 480 Back     alignment and structure
>3f02_A Neuroserpin; cleaved form, fenib, human, disease MUT glycoprotein, protease inhibitor, secreted, serine protease inhibitor, hydrolase inhibitor; 1.80A {Homo sapiens} PDB: 3fgq_A 1jjo_C 1jjo_A Length = 359 Back     alignment and structure
>3nda_A Serpin-2; vaccination target, TICK, hydrolase inhibitor; HET: 1PE; 1.80A {Ixodes ricinus} Length = 377 Back     alignment and structure
>3f1s_A Protein Z-dependent protease inhibitor; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} PDB: 3h5c_A* Length = 385 Back     alignment and structure
>2h4r_A MENT, heterochromatin-associated protein MENT; serine protease inhibitor, serpin, hydrolase inhibitor; 2.70A {Gallus gallus} PDB: 2dut_A Length = 415 Back     alignment and structure
>1yxa_A Serine (OR cysteine) proteinase inhibitor, clade 3N; serpin, antichymotrypsin, protease inhibitor, reactive centr plasma, hydrolase inhibitor; 2.10A {Mus musculus} Length = 398 Back     alignment and structure
>2r9y_A Alpha-2-antiplasmin; inhibitory serpin, plasmin inhibitor, AC phase, glycoprotein, protease inhibitor, secreted, serine P inhibitor, sulfation; 2.65A {Mus musculus} Length = 430 Back     alignment and structure
>2vdx_A Corticosteroid-binding globulin; transport protein, cortisol binding globulin, glycoprotein, lipid-binding, disease mutation, CBG, SERP cleaved; 1.84A {Homo sapiens} PDB: 2vdy_A* Length = 373 Back     alignment and structure
>3b9f_I Protein C inhibitor; michaelis complex, acute phase, blood coagulation, cleavage of basic residues, disease mutation; HET: NAG FUC SGN IDS; 1.60A {Homo sapiens} PDB: 2ol2_A* Length = 395 Back     alignment and structure
>2v95_A Corticosteroid-binding globulin; transport protein, CBG, RCL, serpin, secreted, transport, glycoprotein, lipid-binding, glucocorticoids; HET: HCY; 1.93A {Rattus norvegicus} Length = 371 Back     alignment and structure
>4au2_A HSP47, serpin peptidase inhibitor, clade H (heat shock P 47), member 1, (collagen binding...; chaperone-peptide complex; 2.30A {Canis lupus familiaris} PDB: 4au3_A 4au4_A 4awr_A 4au3_B Length = 392 Back     alignment and structure
>3ne4_A Alpha-1-antitrypsin; serpin, LUNG disease, liver disease, polymerisation, hydrolase inhibitor; 1.81A {Homo sapiens} PDB: 1qlp_A 2qug_A 3cwl_A 3cwm_A* 1psi_A 3drm_A 1kct_A 3dru_A 1hp7_A 1iz2_A* 1oph_A 1oo8_A 1atu_A 1d5s_B 1qmb_B Length = 424 Back     alignment and structure
>1as4_A Antichymotrypsin, ACT; serpin, serine protease inhibitor; 2.10A {Homo sapiens} SCOP: e.1.1.1 PDB: 2ach_A* 4caa_A 3caa_A Length = 341 Back     alignment and structure
>2oay_A C1-inhibitor, plasma protease C1 inhibitor, C1 INH, C1INH; latent serpin, RCL insertion, immune system,hydrolase inhibi; HET: NAG; 2.35A {Homo sapiens} Length = 390 Back     alignment and structure
>3dy0_A N-terminus plasma serine protease inhibitor; serpin, blood clotting, hydrolase inhibitor; HET: IDS SGN; 1.55A {Homo sapiens} PDB: 1lq8_A* 2hi9_A* Length = 336 Back     alignment and structure
>3ndd_A Alpha-1-antitrypsin; serpin, hydrolase inhibitor; 1.50A {Homo sapiens} PDB: 3ndf_A 7api_A* 8api_A* 9api_A* 1d5s_A 1ezx_A 3t1p_A 2d26_A 1qmb_A Length = 343 Back     alignment and structure
>1uhg_A Ovalbumin, S-ovalbumin; allergen, egg white protein, serpin; HET: SEP NAG; 1.90A {Gallus gallus} SCOP: e.1.1.1 PDB: 1ova_A* 1jti_A Length = 385 Back     alignment and structure
>3sto_A Serine protease inhibitor; serpin fold, hydrolase inhibitor; 2.41A {Schistosoma haematobium} Length = 406 Back     alignment and structure
>2ceo_A Thyroxine-binding globulin; transport, serpin, hormone trans thyroxine, disease mutation, glycoprotein; HET: T44; 2.80A {Homo sapiens} Length = 379 Back     alignment and structure
>2zv6_A Serpin B3; serine proteinase inhibitor, reactive site loop, acetylation, alternative splicing, cytoplasm, polymorphism, protease inhibitor; 2.70A {Homo sapiens} Length = 401 Back     alignment and structure
>1imv_A PEDF, pigment epithelium-derived factor; serpin, angiogenesis, signaling protein; HET: NAG; 2.85A {Homo sapiens} SCOP: e.1.1.1 Length = 398 Back     alignment and structure
>2xn6_A Thyroxine-binding globulin; transport, cleaved protein; HET: F6Y T44; 1.29A {Homo sapiens} PDB: 2xn7_A* 2xn5_A* 2riv_A 2xn3_A* 2riw_A* Length = 350 Back     alignment and structure
>1qmn_A AACT, alpha-1-antichymotrypsin; serpin, serine proteinase inhibitor, partial loop insertion, loop-sheet polymerization, emphysema, disease mutation; 2.27A {Homo sapiens} SCOP: e.1.1.1 PDB: 3dlw_A Length = 401 Back     alignment and structure
>2wxy_C Angiotensinogen, serpin A8; glycoprotein, hypertension, vasoconstrictor, renin, serpins, vasoactive, hormone; 2.10A {Mus musculus} PDB: 2wxx_A 2wy0_C 2wxz_A 2wxz_C 2wy1_A Length = 453 Back     alignment and structure
>2wxw_A Angiotensinogen, serpin A8; glycoprotein, hypertension, vasoconstrictor, renin, serpins, vasoactive, hormone; 3.30A {Homo sapiens} PDB: 2x0b_B Length = 453 Back     alignment and structure
>2h4p_A MENT, heterochromatin-associated protein MENT; serine protease inhibitor, serpin, hydrolase inhibitor; 1.70A {Gallus gallus} PDB: 2h4q_A Length = 394 Back     alignment and structure
>1f0c_A ICE inhibitor; apoptosis, caspase inhibitor, protease inhibitor, serpin, viral protein; 2.26A {Cowpox virus} SCOP: e.1.1.1 PDB: 1c8o_A Length = 305 Back     alignment and structure
>1m93_A Serine proteinase inhibitor 2; serpin, CRMA, apoptosis, ICE inhibitor, viral protein; 1.65A {Cowpox virus} SCOP: e.1.1.1 Length = 55 Back     alignment and structure
>1m93_B Serine proteinase inhibitor 2; serpin, CRMA, apoptosis, ICE inhibitor, viral protein; 1.65A {Cowpox virus} SCOP: e.1.1.1 Length = 245 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
3le2_A 393 Serpin-ZX; apoplast, glycoprotein, protease inhibi 100.0
3ndd_A 343 Alpha-1-antitrypsin; serpin, hydrolase inhibitor; 100.0
3ne4_A 424 Alpha-1-antitrypsin; serpin, LUNG disease, liver d 100.0
4au2_A 392 HSP47, serpin peptidase inhibitor, clade H (heat s 100.0
1as4_A 341 Antichymotrypsin, ACT; serpin, serine protease inh 100.0
2xn6_A 350 Thyroxine-binding globulin; transport, cleaved pro 100.0
1hle_A 345 Horse leukocyte elastase inhibitor; hydrolase inhi 100.0
4ga7_A 389 Leukocyte elastase inhibitor; serpin, conformation 100.0
4afx_A 387 Protein Z dependent protease inhibitor; hydrolase 100.0
2h4p_A 394 MENT, heterochromatin-associated protein MENT; ser 100.0
2vdx_A 373 Corticosteroid-binding globulin; transport protein 100.0
4dy0_A 379 GLIA-derived nexin; serpin, protease inhibitor, th 100.0
3dy0_A 336 N-terminus plasma serine protease inhibitor; serpi 100.0
3f02_A 359 Neuroserpin; cleaved form, fenib, human, disease M 100.0
2ceo_A 379 Thyroxine-binding globulin; transport, serpin, hor 100.0
3nda_A 377 Serpin-2; vaccination target, TICK, hydrolase inhi 100.0
1mtp_A 323 Serine proteinase inhibitor (serpin), chain A; str 100.0
2h4r_A 415 MENT, heterochromatin-associated protein MENT; ser 100.0
1yxa_A 398 Serine (OR cysteine) proteinase inhibitor, clade 3 100.0
3f5n_A 407 Neuroserpin; cleaved form, fenib, human, tissue PL 100.0
4ajt_A 427 Protein Z-dependent protease inhibitor; blood clot 100.0
1wz9_A 375 Maspin precursor; serpin, tumor suppressor, serpin 99.98
3b9f_I 395 Protein C inhibitor; michaelis complex, acute phas 99.98
1lj5_A 379 Plasminogen activator inhibitor-1; beta-barrell, b 99.98
3ozq_A 376 Serpin48; SPE, hydrolase I; 1.90A {Tenebrio molito 99.98
3f1s_A 385 Protein Z-dependent protease inhibitor; PZ, ZPI, c 99.98
3sto_A 406 Serine protease inhibitor; serpin fold, hydrolase 99.98
2arr_A 382 Plasminogen activator inhibitor-2; serpin, peptide 99.98
1uhg_A 385 Ovalbumin, S-ovalbumin; allergen, egg white protei 99.98
2zv6_A 401 Serpin B3; serine proteinase inhibitor, reactive s 99.97
3kcg_I 432 Antithrombin-III, ATIII; michaelis complex, blood 99.97
1qmn_A 401 AACT, alpha-1-antichymotrypsin; serpin, serine pro 99.97
1sek_A 378 Serpin K; serine protease inhibitor, protease; 2.1 99.97
1sng_A 370 COG4826: serine protease inhibitor; serine proteas 99.97
1jmo_A 480 HC-II, heparin cofactor II, HLS2, serin; serpin, t 99.97
2v95_A 371 Corticosteroid-binding globulin; transport protein 99.97
2wxy_C 453 Angiotensinogen, serpin A8; glycoprotein, hyperten 99.97
1imv_A 398 PEDF, pigment epithelium-derived factor; serpin, a 99.97
2wxw_A 453 Angiotensinogen, serpin A8; glycoprotein, hyperten 99.97
3pzf_A 397 Serpin 2; protease inhibitor, melanization, hydrol 99.97
2pef_A 373 Serine protease inhibitor; serpin; 1.60A {Thermoan 99.96
2r9y_A 430 Alpha-2-antiplasmin; inhibitory serpin, plasmin in 99.96
2oay_A 390 C1-inhibitor, plasma protease C1 inhibitor, C1 INH 99.95
1f0c_A 305 ICE inhibitor; apoptosis, caspase inhibitor, prote 99.93
1m93_A55 Serine proteinase inhibitor 2; serpin, CRMA, apopt 99.67
1m93_B 245 Serine proteinase inhibitor 2; serpin, CRMA, apopt 98.99
>3le2_A Serpin-ZX; apoplast, glycoprotein, protease inhibitor, secreted, serine protease inhibitor, hydrolase; 2.20A {Arabidopsis thaliana} SCOP: e.1.1.0 Back     alignment and structure
Probab=100.00  E-value=4.3e-35  Score=226.26  Aligned_cols=146  Identities=58%  Similarity=0.869  Sum_probs=130.5

Q ss_pred             CChHhhhhhhHHHHHHHHHHH-HhccCCCCcEEEccccHHHHHHHHHcCCCCchHHHHHHhcCCCChHHHHHHHHHHHHH
Q 032061            1 MDVRESISNQTDVALSLTKHV-ALTEAKDSNLVFSPSSIHVLLSLISAGSKGPTLDQLLSFLKSKSDDQLNTFASELVAV   79 (148)
Q Consensus         1 ~~~~~~~~~~~~F~~~L~~~l-~~~~~~~~N~v~SP~si~~~L~~l~~ga~g~T~~el~~~L~~~~~~~~~~~~~~l~~~   79 (148)
                      ||+++.+.++++||++||+++ .. ..+++|+||||+||+.+|+|+++||+|+|++||.++|++++.++++..++.++..
T Consensus         3 ~~~~~~~~~~~~Fa~~L~~~l~~~-~~~~~Ni~~SP~Si~~aLaml~~GA~G~T~~ql~~~L~~~~~~~~~~~~~~l~~~   81 (393)
T 3le2_A            3 MDVRESISLQNQVSMNLAKHVITT-VSQNSNVIFSPASINVVLSIIAAGSAGATKDQILSFLKFSSTDQLNSFSSEIVSA   81 (393)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHT-SCTTCCEEECHHHHHHHHHHHHHTCCTHHHHHHHHHHTCSSHHHHHHHHHHTHHH
T ss_pred             ccHHHHHHhhhHHHHHHHHHHhcc-cCCCCCEEECHHHHHHHHHHHHhcCCCcHHHHHHHHhCCCCHHHHHHHHHHHHHH
Confidence            899999999999999999999 44 3678999999999999999999999999999999999999777889999999888


Q ss_pred             HhhCCCCCCCCeeEeeeeeeecCCCCCChhHHHHHHhhccccceEecCCCC-ccc----chhHHHhhcCCccC
Q 032061           80 VFADGSPSGGPRLSVANGVWIDKSLSLKNTFKQVVDNVYKAASNQVDFQTK-VKT----LSWYTTVIHEGLKF  147 (148)
Q Consensus        80 l~~~~~~~~~~~l~~~n~l~~~~~~~~~~~f~~~~~~~y~~~~~~~df~~~-~~~----N~wv~~~T~g~I~~  147 (148)
                      +..+..+..++.+.++|+||++++++++++|++.++++|+++++.+||.+. ..+    |.||+++|+|+|+.
T Consensus        82 l~~~~~~~~~~~l~~an~l~~~~~~~l~~~f~~~~~~~y~a~~~~vdF~~~~~~a~~~IN~WV~~~T~gkI~~  154 (393)
T 3le2_A           82 VLADGSANGGPKLSVANGAWIDKSLSFKPSFKQLLEDSYKAASNQADFQSKAVEVIAEVNSWAEKETNGLITE  154 (393)
T ss_dssp             HHSCCGGGTSCEEEEEEEEEEETTSCBCHHHHHHHHHHSCCEEEEECHHHHHHHHHHHHHHHHHHHTTTSCCC
T ss_pred             hhccccCCCCcEEEeeeehhhcCCCCcChHHHHHHHHhhcceEEEecccccHHHHHHHHHHHHHHhhcCchhh
Confidence            763222235678999999999999999999999999999999999999863 333    99999999999973
>3ndd_A Alpha-1-antitrypsin; serpin, hydrolase inhibitor; 1.50A {Homo sapiens} PDB: 3ndf_A 7api_A* 8api_A* 9api_A* 1d5s_A 1ezx_A 3t1p_A 2d26_A 1qmb_A Back     alignment and structure
>3ne4_A Alpha-1-antitrypsin; serpin, LUNG disease, liver disease, polymerisation, hydrolase inhibitor; 1.81A {Homo sapiens} PDB: 1qlp_A 2qug_A 3cwl_A 3cwm_A* 1psi_A 3drm_A 1kct_A 3dru_A 1hp7_A 1iz2_A* 1oph_A 1oo8_A 1atu_A 1d5s_B 1qmb_B Back     alignment and structure
>4au2_A HSP47, serpin peptidase inhibitor, clade H (heat shock P 47), member 1, (collagen binding...; chaperone-peptide complex; 2.30A {Canis lupus familiaris} PDB: 4au3_A 4au4_A 4awr_A 4au3_B Back     alignment and structure
>1as4_A Antichymotrypsin, ACT; serpin, serine protease inhibitor; 2.10A {Homo sapiens} SCOP: e.1.1.1 PDB: 2ach_A* 4caa_A 3caa_A Back     alignment and structure
>2xn6_A Thyroxine-binding globulin; transport, cleaved protein; HET: F6Y T44; 1.29A {Homo sapiens} PDB: 2xn7_A* 2xn5_A* 2riv_A 2xn3_A* 2riw_A* Back     alignment and structure
>1hle_A Horse leukocyte elastase inhibitor; hydrolase inhibitor(serine proteinase); 1.95A {Equus caballus} SCOP: e.1.1.1 Back     alignment and structure
>4ga7_A Leukocyte elastase inhibitor; serpin, conformational change, serine protease inhibitor, Ca inhibitor, chymase inhibitor, chymotrypsin inhibitor; 2.90A {Homo sapiens} Back     alignment and structure
>4afx_A Protein Z dependent protease inhibitor; hydrolase inhibitor, serpin, protein Z dependent inhibitor, coagulation; 2.09A {Homo sapiens} PDB: 4aju_A 3h5c_A* 3f1s_A* Back     alignment and structure
>2h4p_A MENT, heterochromatin-associated protein MENT; serine protease inhibitor, serpin, hydrolase inhibitor; 1.70A {Gallus gallus} PDB: 2h4q_A Back     alignment and structure
>2vdx_A Corticosteroid-binding globulin; transport protein, cortisol binding globulin, glycoprotein, lipid-binding, disease mutation, CBG, SERP cleaved; 1.84A {Homo sapiens} PDB: 2vdy_A* Back     alignment and structure
>4dy0_A GLIA-derived nexin; serpin, protease inhibitor, thrombin, cell surface, hydrolas inhibitor; HET: IDS SGN; 2.35A {Homo sapiens} PDB: 4dy7_C Back     alignment and structure
>3dy0_A N-terminus plasma serine protease inhibitor; serpin, blood clotting, hydrolase inhibitor; HET: IDS SGN; 1.55A {Homo sapiens} PDB: 1lq8_A* 2hi9_A* Back     alignment and structure
>3f02_A Neuroserpin; cleaved form, fenib, human, disease MUT glycoprotein, protease inhibitor, secreted, serine protease inhibitor, hydrolase inhibitor; 1.80A {Homo sapiens} PDB: 3fgq_A 1jjo_C 1jjo_A Back     alignment and structure
>2ceo_A Thyroxine-binding globulin; transport, serpin, hormone trans thyroxine, disease mutation, glycoprotein; HET: T44; 2.80A {Homo sapiens} Back     alignment and structure
>3nda_A Serpin-2; vaccination target, TICK, hydrolase inhibitor; HET: 1PE; 1.80A {Ixodes ricinus} Back     alignment and structure
>1mtp_A Serine proteinase inhibitor (serpin), chain A; structural genomics, protease inhibitor; 1.50A {Thermobifida fusca} SCOP: e.1.1.1 Back     alignment and structure
>2h4r_A MENT, heterochromatin-associated protein MENT; serine protease inhibitor, serpin, hydrolase inhibitor; 2.70A {Gallus gallus} PDB: 2dut_A Back     alignment and structure
>1yxa_A Serine (OR cysteine) proteinase inhibitor, clade 3N; serpin, antichymotrypsin, protease inhibitor, reactive centr plasma, hydrolase inhibitor; 2.10A {Mus musculus} Back     alignment and structure
>3f5n_A Neuroserpin; cleaved form, fenib, human, tissue PLAS activator, hydrolase inhibitor; 3.15A {Homo sapiens} Back     alignment and structure
>4ajt_A Protein Z-dependent protease inhibitor; blood clotting, ZPI; 2.50A {Mus musculus} Back     alignment and structure
>1wz9_A Maspin precursor; serpin, tumor suppressor, serpinb5, signaling protein; HET: CME; 2.10A {Homo sapiens} PDB: 1xu8_A 1xqg_A 1xqj_A Back     alignment and structure
>3b9f_I Protein C inhibitor; michaelis complex, acute phase, blood coagulation, cleavage of basic residues, disease mutation; HET: NAG FUC SGN IDS; 1.60A {Homo sapiens} PDB: 2ol2_A* Back     alignment and structure
>1lj5_A Plasminogen activator inhibitor-1; beta-barrell, blood clotting; 1.80A {Homo sapiens} SCOP: e.1.1.1 PDB: 1dvn_A 1c5g_A 1a7c_A* 3q02_A 3q03_A 3r4l_A* 1oc0_A 1b3k_A 3pb1_I 1dvm_A 3eox_A 3cvm_A 1db2_A 9pai_A 3lw2_A 9pai_B Back     alignment and structure
>3ozq_A Serpin48; SPE, hydrolase I; 1.90A {Tenebrio molitor} Back     alignment and structure
>3f1s_A Protein Z-dependent protease inhibitor; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} PDB: 3h5c_A* Back     alignment and structure
>3sto_A Serine protease inhibitor; serpin fold, hydrolase inhibitor; 2.41A {Schistosoma haematobium} Back     alignment and structure
>2arr_A Plasminogen activator inhibitor-2; serpin, peptide binding, hydrolase inhibitor-PEPT complex; 1.55A {Homo sapiens} PDB: 2arq_A 1jrr_A 1by7_A Back     alignment and structure
>1uhg_A Ovalbumin, S-ovalbumin; allergen, egg white protein, serpin; HET: SEP NAG; 1.90A {Gallus gallus} SCOP: e.1.1.1 PDB: 1ova_A* 1jti_A Back     alignment and structure
>2zv6_A Serpin B3; serine proteinase inhibitor, reactive site loop, acetylation, alternative splicing, cytoplasm, polymorphism, protease inhibitor; 2.70A {Homo sapiens} Back     alignment and structure
>3kcg_I Antithrombin-III, ATIII; michaelis complex, blood coagulation, calcium, disulfide bond, EGF-like domain, glycoprotein, hemophilia, hydrolase; HET: NAG FUC MAN NTP; 1.70A {Homo sapiens} SCOP: e.1.1.1 PDB: 1e04_I* 1ath_A 1ant_L* 1br8_L 1azx_I* 1dzh_L* 1e03_L* 1dzg_L* 1e05_L* 1jvq_L* 1lk6_L* 1nq9_I* 1oyh_L* 1r1l_L* 1sr5_A* 2ant_L* 2beh_L* 2hij_L* 2znh_A* 3evj_I* ... Back     alignment and structure
>1qmn_A AACT, alpha-1-antichymotrypsin; serpin, serine proteinase inhibitor, partial loop insertion, loop-sheet polymerization, emphysema, disease mutation; 2.27A {Homo sapiens} SCOP: e.1.1.1 PDB: 3dlw_A Back     alignment and structure
>1sek_A Serpin K; serine protease inhibitor, protease; 2.10A {Manduca sexta} SCOP: e.1.1.1 PDB: 1k9o_I Back     alignment and structure
>1sng_A COG4826: serine protease inhibitor; serine protease inhibitor (serpin), native state., hydrolase inhibitor; 1.76A {Thermobifida fusca} SCOP: e.1.1.1 Back     alignment and structure
>1jmo_A HC-II, heparin cofactor II, HLS2, serin; serpin, thrombin, protease, inhibition, inhibitor, blood CLO; HET: TYS NDG NAG; 2.20A {Homo sapiens} SCOP: e.1.1.1 PDB: 1jmj_A* Back     alignment and structure
>2v95_A Corticosteroid-binding globulin; transport protein, CBG, RCL, serpin, secreted, transport, glycoprotein, lipid-binding, glucocorticoids; HET: HCY; 1.93A {Rattus norvegicus} Back     alignment and structure
>2wxy_C Angiotensinogen, serpin A8; glycoprotein, hypertension, vasoconstrictor, renin, serpins, vasoactive, hormone; 2.10A {Mus musculus} PDB: 2wxx_A 2wy0_C 2wxz_A 2wxz_C 2wy1_A Back     alignment and structure
>1imv_A PEDF, pigment epithelium-derived factor; serpin, angiogenesis, signaling protein; HET: NAG; 2.85A {Homo sapiens} SCOP: e.1.1.1 Back     alignment and structure
>2wxw_A Angiotensinogen, serpin A8; glycoprotein, hypertension, vasoconstrictor, renin, serpins, vasoactive, hormone; 3.30A {Homo sapiens} PDB: 2x0b_B Back     alignment and structure
>3pzf_A Serpin 2; protease inhibitor, melanization, hydrolase inhibito; 1.75A {Anopheles gambiae} Back     alignment and structure
>2pef_A Serine protease inhibitor; serpin; 1.60A {Thermoanaerobacter tengcongensis} PDB: 2vh4_A 2pee_A Back     alignment and structure
>2r9y_A Alpha-2-antiplasmin; inhibitory serpin, plasmin inhibitor, AC phase, glycoprotein, protease inhibitor, secreted, serine P inhibitor, sulfation; 2.65A {Mus musculus} Back     alignment and structure
>2oay_A C1-inhibitor, plasma protease C1 inhibitor, C1 INH, C1INH; latent serpin, RCL insertion, immune system,hydrolase inhibi; HET: NAG; 2.35A {Homo sapiens} Back     alignment and structure
>1f0c_A ICE inhibitor; apoptosis, caspase inhibitor, protease inhibitor, serpin, viral protein; 2.26A {Cowpox virus} SCOP: e.1.1.1 PDB: 1c8o_A Back     alignment and structure
>1m93_A Serine proteinase inhibitor 2; serpin, CRMA, apoptosis, ICE inhibitor, viral protein; 1.65A {Cowpox virus} SCOP: e.1.1.1 Back     alignment and structure
>1m93_B Serine proteinase inhibitor 2; serpin, CRMA, apoptosis, ICE inhibitor, viral protein; 1.65A {Cowpox virus} SCOP: e.1.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 148
d2b5ti1 426 e.1.1.1 (I:6-431) Antithrombin {Human (Homo sapien 2e-19
d1k9oi_ 376 e.1.1.1 (I:) Alaserpin (serpin 1) {Tobacco hornwor 4e-19
d1lj5a_ 379 e.1.1.1 (A:) Plasminogen activator inhibitor-1 {Hu 1e-18
g1mtp.1 355 e.1.1.1 (A:,B:) Thermopin {Thermobifida fusca [Tax 1e-18
d1by7a_ 381 e.1.1.1 (A:) Plasminogen activator inhibitor-2 {Hu 4e-18
d1uhga_ 385 e.1.1.1 (A:) Ovalbumin {Hen (Gallus gallus) [TaxId 5e-18
d1qlpa_ 372 e.1.1.1 (A:) Antitrypsin, alpha-1 {Human (Homo sap 6e-18
g1as4.1 369 e.1.1.1 (A:,B:) Antichymotrypsin, alpha-1 {Human ( 1e-17
g1hle.1 375 e.1.1.1 (A:,B:) Elastase inhibitor {Horse (Equus c 2e-17
g1lq8.1 358 e.1.1.1 (A:,B:) Protein C inhibitor {Human (Homo s 2e-17
d1jmja_ 420 e.1.1.1 (A:) Heparin cofactor II (Hc-II, leuserpin 2e-16
d1xqga_ 378 e.1.1.1 (A:) Maspin {Human (Homo sapiens) [TaxId: 5e-16
d1imva_ 383 e.1.1.1 (A:) Pigment epithelium-derived factor, PE 2e-15
g1jjo.1 334 e.1.1.1 (A:,C:,E:) Neuroserpin {Mouse (Mus musculu 2e-13
g1m93.1 322 e.1.1.1 (A:,B:,C:) Viral serpin crmA (cytokine res 6e-12
>d2b5ti1 e.1.1.1 (I:6-431) Antithrombin {Human (Homo sapiens) [TaxId: 9606]} Length = 426 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: Serpins
superfamily: Serpins
family: Serpins
domain: Antithrombin
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 81.0 bits (199), Expect = 2e-19
 Identities = 32/123 (26%), Positives = 62/123 (50%), Gaps = 7/123 (5%)

Query: 11  TDVALSLTKHVALTEAKDSNLVFSPSSIHVLLSLISAGSKGPTLDQLLSFLK-----SKS 65
           +  A +  +H+A ++  + N+  SP SI    ++   G+   TL QL+   K      K+
Sbjct: 51  SRFATTFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVFKFDTISEKT 110

Query: 66  DDQLNTFASELVAVVFADGSPSGGPRLSVANGVWIDKSLSLKNTFKQVVDNVYKAASNQV 125
            DQ++ F ++L   ++     +   +L  AN ++ DKSL+   T++ + + VY A    +
Sbjct: 111 SDQIHFFFAKLNCRLYRK--ANKASKLVSANRLFGDKSLTFNETYQDISELVYGAKLQPL 168

Query: 126 DFQ 128
           DF+
Sbjct: 169 DFK 171
>d1k9oi_ e.1.1.1 (I:) Alaserpin (serpin 1) {Tobacco hornworm (Manduca sexta) [TaxId: 7130]} Length = 376 Back     information, alignment and structure
>d1lj5a_ e.1.1.1 (A:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 379 Back     information, alignment and structure
>d1by7a_ e.1.1.1 (A:) Plasminogen activator inhibitor-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 381 Back     information, alignment and structure
>d1uhga_ e.1.1.1 (A:) Ovalbumin {Hen (Gallus gallus) [TaxId: 9031]} Length = 385 Back     information, alignment and structure
>d1qlpa_ e.1.1.1 (A:) Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 372 Back     information, alignment and structure
>d1jmja_ e.1.1.1 (A:) Heparin cofactor II (Hc-II, leuserpin 2) {Human (Homo sapiens) [TaxId: 9606]} Length = 420 Back     information, alignment and structure
>d1xqga_ e.1.1.1 (A:) Maspin {Human (Homo sapiens) [TaxId: 9606]} Length = 378 Back     information, alignment and structure
>d1imva_ e.1.1.1 (A:) Pigment epithelium-derived factor, PEDF {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
d2b5ti1 426 Antithrombin {Human (Homo sapiens) [TaxId: 9606]} 99.97
g1hle.1 375 Elastase inhibitor {Horse (Equus caballus) [TaxId: 99.97
d1jmja_ 420 Heparin cofactor II (Hc-II, leuserpin 2) {Human (H 99.97
d1lj5a_ 379 Plasminogen activator inhibitor-1 {Human (Homo sap 99.97
g1as4.1 369 Antichymotrypsin, alpha-1 {Human (Homo sapiens) [T 99.97
d1by7a_ 381 Plasminogen activator inhibitor-2 {Human (Homo sap 99.96
d1k9oi_ 376 Alaserpin (serpin 1) {Tobacco hornworm (Manduca se 99.96
d1qlpa_ 372 Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 99.96
d1xqga_ 378 Maspin {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1uhga_ 385 Ovalbumin {Hen (Gallus gallus) [TaxId: 9031]} 99.96
g1lq8.1 358 Protein C inhibitor {Human (Homo sapiens) [TaxId: 99.96
d1imva_ 383 Pigment epithelium-derived factor, PEDF {Human (Ho 99.96
g1mtp.1 355 Thermopin {Thermobifida fusca [TaxId: 2021]} 99.95
g1jjo.1 334 Neuroserpin {Mouse (Mus musculus) [TaxId: 10090]} 99.9
g1m93.1 322 Viral serpin crmA (cytokine response modifier prot 99.86
d1t6sa185 Segregation and condensation protein B, ScpB {Chlo 80.65
>d2b5ti1 e.1.1.1 (I:6-431) Antithrombin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: Serpins
superfamily: Serpins
family: Serpins
domain: Antithrombin
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.97  E-value=1.3e-31  Score=206.89  Aligned_cols=142  Identities=23%  Similarity=0.390  Sum_probs=124.5

Q ss_pred             HhhhhhhHHHHHHHHHHHHhccCCCCcEEEccccHHHHHHHHHcCCCCchHHHHHHhcCCCCh-----HHHHHHHHHHHH
Q 032061            4 RESISNQTDVALSLTKHVALTEAKDSNLVFSPSSIHVLLSLISAGSKGPTLDQLLSFLKSKSD-----DQLNTFASELVA   78 (148)
Q Consensus         4 ~~~~~~~~~F~~~L~~~l~~~~~~~~N~v~SP~si~~~L~~l~~ga~g~T~~el~~~L~~~~~-----~~~~~~~~~l~~   78 (148)
                      .+|+.++++||++||+++....++++|+||||+||+.+|+||+.||+|+|++||.++|+++..     ++++..++.+..
T Consensus        44 ~~l~~~~~~Fa~~l~~~l~~~~~~~~N~v~SP~si~~aLa~l~~GA~g~T~~el~~~L~~~~~~~~~~~~~~~~~~~l~~  123 (426)
T d2b5ti1          44 WELSKANSRFATTFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVFKFDTISEKTSDQIHFFFAKLNC  123 (426)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTSCTTSCEEECHHHHHHHHHHHHTTCCHHHHHHHHHHTTGGGSCHHHHHTHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHhcCCCCCEEEECHHHHHHHHHHHHHhCchHHHHHHHHhcCCCCCCcchHHHHHHHHHHHHH
Confidence            468999999999999999853367899999999999999999999999999999999998732     357888888888


Q ss_pred             HHhhCCCCCCCCeeEeeeeeeecCCCCCChhHHHHHHhhccccceEecCCCCcc-c----chhHHHhhcCCccC
Q 032061           79 VVFADGSPSGGPRLSVANGVWIDKSLSLKNTFKQVVDNVYKAASNQVDFQTKVK-T----LSWYTTVIHEGLKF  147 (148)
Q Consensus        79 ~l~~~~~~~~~~~l~~~n~l~~~~~~~~~~~f~~~~~~~y~~~~~~~df~~~~~-~----N~wv~~~T~g~I~~  147 (148)
                      .+..  .......+.++|++|++++++++++|++.++++|+++++.+||.+.+. +    |.||+++|+|+|+.
T Consensus       124 ~l~~--~~~~~~~l~~an~l~v~~~~~~~~~f~~~~~~~y~a~~~~vdF~~~~~~a~~~IN~wv~~~T~g~I~~  195 (426)
T d2b5ti1         124 RLYR--KANKASKLVSANRLFGDKSLTFNETYQDISELVYGAKLQPLDFKENAEQSRAAINKWVSNKTEGRITD  195 (426)
T ss_dssp             HHTS--CCCSSEEEEEEEEEEEETTSCCCHHHHHHHHHHHSSCCEEECTTTCHHHHHHHHHHHHHHHTTTSCSC
T ss_pred             HHhc--cCCCCcEEeeeehhhhcccccchHHHHHHHHHhcCCeEEEecccccHHHHHHHHHHHHHHhcCCCccC
Confidence            7763  234456799999999999999999999999999999999999987543 2    99999999999974
>d1jmja_ e.1.1.1 (A:) Heparin cofactor II (Hc-II, leuserpin 2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lj5a_ e.1.1.1 (A:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1by7a_ e.1.1.1 (A:) Plasminogen activator inhibitor-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k9oi_ e.1.1.1 (I:) Alaserpin (serpin 1) {Tobacco hornworm (Manduca sexta) [TaxId: 7130]} Back     information, alignment and structure
>d1qlpa_ e.1.1.1 (A:) Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqga_ e.1.1.1 (A:) Maspin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhga_ e.1.1.1 (A:) Ovalbumin {Hen (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1imva_ e.1.1.1 (A:) Pigment epithelium-derived factor, PEDF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6sa1 a.4.5.60 (A:1-85) Segregation and condensation protein B, ScpB {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure