Citrus Sinensis ID: 032130

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------
MEVHDYLKSLCPDLHVTRGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDFKKTATTRLAH
ccHHHHHHHHcccEEEEccccccccccccEEEEEEccEEEEEEccccccccccHHHHHHHHHHccccEEEEcccccEEEEEEccEEEEccccccccccccccccccEEEEEEEEccEEEEEEEEEcccEEEEEEEEEEEcccccccc
ccHHHHHHHHcccEEEEEcccccccccccEEEEEEccEEEEEEcccEEEccccHHHHHHHHHHcccEEEEEcccccEEEEEEccEEEEccccccccccccccccccEEEEEEEcccEEEEEEEEEEcccEEEEEEEEEccccccccc
MEVHDYLKslcpdlhvtrgeydedsrypetktltigqfklgichghqvipwgdlDSLAMLQRQLDVDILVTGHTHqfkaykheggvvinpgsatgayssftfdvnpsfvlmdidgLRVVVYVYELIDgevkvdkidfkktattrlah
mevhdylkslcpdlhvtrgeydedsrypeTKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELidgevkvdkidfkktattrlah
MEVHDYLKSLCPDLHVTRGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDFKKTATTRLAH
*****YLKSLCPDLHVTRGEYDE*SRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDFK*********
MEVHDYLKSLCPDLHVTRGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKI************
MEVHDYLKSLCPDLHVTRGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDFKKTATTRLAH
MEVHDYLKSLCPDLHVTRGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDFKKT*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEVHDYLKSLCPDLHVTRGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDFKKTATTRLAH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query147 2.2.26 [Sep-21-2011]
Q9STT2190 Vacuolar protein sorting- yes no 0.965 0.747 0.866 2e-70
Q7ZV68182 Vacuolar protein sorting- yes no 0.945 0.763 0.604 2e-48
Q5R9Z1182 Vacuolar protein sorting- yes no 0.945 0.763 0.597 8e-48
Q9QZ88182 Vacuolar protein sorting- yes no 0.945 0.763 0.597 9e-48
Q3T0M0186 Vacuolar protein sorting- yes no 0.945 0.747 0.597 9e-48
B2RZ78182 Vacuolar protein sorting- yes no 0.945 0.763 0.597 1e-47
Q9UBQ0182 Vacuolar protein sorting- yes no 0.938 0.758 0.601 2e-47
Q6DEU3182 Vacuolar protein sorting- yes no 0.945 0.763 0.597 4e-47
Q6GP62182 Vacuolar protein sorting- N/A no 0.945 0.763 0.597 4e-47
Q5ZIL2186 Vacuolar protein sorting- yes no 0.945 0.747 0.597 4e-47
>sp|Q9STT2|VPS29_ARATH Vacuolar protein sorting-associated protein 29 OS=Arabidopsis thaliana GN=VPS29 PE=2 SV=1 Back     alignment and function desciption
 Score =  263 bits (672), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 123/142 (86%), Positives = 131/142 (92%)

Query: 2   EVHDYLKSLCPDLHVTRGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQ 61
           E+HDYLK++CPDLH+ RGE+DED+RYPE KTLTIGQFKLG+CHGHQVIPWGDLDSLAMLQ
Sbjct: 45  EIHDYLKTICPDLHIVRGEFDEDARYPENKTLTIGQFKLGLCHGHQVIPWGDLDSLAMLQ 104

Query: 62  RQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVY 121
           RQL VDILVTGHTHQF AYKHEGGVVINPGSATGAYSS   DVNPSFVLMDIDG R VVY
Sbjct: 105 RQLGVDILVTGHTHQFTAYKHEGGVVINPGSATGAYSSINQDVNPSFVLMDIDGFRAVVY 164

Query: 122 VYELIDGEVKVDKIDFKKTATT 143
           VYELIDGEVKVDKI+FKK  TT
Sbjct: 165 VYELIDGEVKVDKIEFKKPPTT 186
Plays a role in vesicular protein sorting. Component of the membrane-associated retromer complex which is essential in endosome-to-Golgi retrograde transport. Required for the auxin-carrier protein PIN2 sorting to the lytic vacuolar pathway and the PIN1 recycling to the plasma membrane. Also involved in the efficient sorting of seed storage proteins globulin 12S and albumin 2S. The VPS29-VPS26-VPS35 subcomplex may be involved in recycling of specific cargos from endosome to the plasma membrane.
Arabidopsis thaliana (taxid: 3702)
>sp|Q7ZV68|VPS29_DANRE Vacuolar protein sorting-associated protein 29 OS=Danio rerio GN=vps29 PE=2 SV=1 Back     alignment and function description
>sp|Q5R9Z1|VPS29_PONAB Vacuolar protein sorting-associated protein 29 OS=Pongo abelii GN=VPS29 PE=2 SV=1 Back     alignment and function description
>sp|Q9QZ88|VPS29_MOUSE Vacuolar protein sorting-associated protein 29 OS=Mus musculus GN=Vps29 PE=1 SV=1 Back     alignment and function description
>sp|Q3T0M0|VPS29_BOVIN Vacuolar protein sorting-associated protein 29 OS=Bos taurus GN=VPS29 PE=2 SV=1 Back     alignment and function description
>sp|B2RZ78|VPS29_RAT Vacuolar protein sorting-associated protein 29 OS=Rattus norvegicus GN=Vps29 PE=1 SV=2 Back     alignment and function description
>sp|Q9UBQ0|VPS29_HUMAN Vacuolar protein sorting-associated protein 29 OS=Homo sapiens GN=VPS29 PE=1 SV=1 Back     alignment and function description
>sp|Q6DEU3|VPS29_XENTR Vacuolar protein sorting-associated protein 29 OS=Xenopus tropicalis GN=vps29 PE=2 SV=1 Back     alignment and function description
>sp|Q6GP62|VPS29_XENLA Vacuolar protein sorting-associated protein 29 OS=Xenopus laevis GN=vps29 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZIL2|VPS29_CHICK Vacuolar protein sorting-associated protein 29 OS=Gallus gallus GN=VPS29 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query147
255558184188 Vacuolar protein sorting, putative [Rici 0.972 0.760 0.972 2e-76
225425766190 PREDICTED: vacuolar protein sorting-asso 0.993 0.768 0.952 6e-76
346470445190 hypothetical protein [Amblyomma maculatu 0.986 0.763 0.937 2e-75
115445439188 Os02g0265400 [Oryza sativa Japonica Grou 0.959 0.75 0.957 3e-75
242064710188 hypothetical protein SORBIDRAFT_04g00982 0.959 0.75 0.957 5e-75
357141447188 PREDICTED: vacuolar protein sorting-asso 0.959 0.75 0.950 1e-74
226531163188 vacuolar protein sorting 29 [Zea mays] g 0.959 0.75 0.950 2e-74
195648603188 vacuolar protein sorting 29 [Zea mays] 0.959 0.75 0.950 4e-74
116791301187 unknown [Picea sitchensis] 0.972 0.764 0.930 9e-74
357462271190 Vacuolar protein sorting [Medicago trunc 0.993 0.768 0.897 1e-73
>gi|255558184|ref|XP_002520119.1| Vacuolar protein sorting, putative [Ricinus communis] gi|223540611|gb|EEF42174.1| Vacuolar protein sorting, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  290 bits (741), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 142/143 (99%)

Query: 2   EVHDYLKSLCPDLHVTRGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQ 61
           EVHDYLKSLCPDLH+TRGEYDEDS YPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQ
Sbjct: 45  EVHDYLKSLCPDLHITRGEYDEDSCYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQ 104

Query: 62  RQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVY 121
           RQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFT+DVNPSFVLMD+DGLRVVVY
Sbjct: 105 RQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTYDVNPSFVLMDVDGLRVVVY 164

Query: 122 VYELIDGEVKVDKIDFKKTATTR 144
           VYELIDGEVKVDKIDFKKTATTR
Sbjct: 165 VYELIDGEVKVDKIDFKKTATTR 187

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225425766|ref|XP_002277517.1| PREDICTED: vacuolar protein sorting-associated protein 29 [Vitis vinifera] gi|296086408|emb|CBI31997.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|346470445|gb|AEO35067.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
>gi|115445439|ref|NP_001046499.1| Os02g0265400 [Oryza sativa Japonica Group] gi|50251955|dbj|BAD27890.1| putative vacuolar protein sorting; Vps29p [Oryza sativa Japonica Group] gi|113536030|dbj|BAF08413.1| Os02g0265400 [Oryza sativa Japonica Group] gi|125538892|gb|EAY85287.1| hypothetical protein OsI_06659 [Oryza sativa Indica Group] gi|215701252|dbj|BAG92676.1| unnamed protein product [Oryza sativa Japonica Group] gi|215765582|dbj|BAG87279.1| unnamed protein product [Oryza sativa Japonica Group] gi|222622567|gb|EEE56699.1| hypothetical protein OsJ_06169 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|242064710|ref|XP_002453644.1| hypothetical protein SORBIDRAFT_04g009820 [Sorghum bicolor] gi|241933475|gb|EES06620.1| hypothetical protein SORBIDRAFT_04g009820 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|357141447|ref|XP_003572228.1| PREDICTED: vacuolar protein sorting-associated protein 29-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|226531163|ref|NP_001147749.1| vacuolar protein sorting 29 [Zea mays] gi|195613446|gb|ACG28553.1| vacuolar protein sorting 29 [Zea mays] gi|413925910|gb|AFW65842.1| vacuolar protein sorting 29 [Zea mays] Back     alignment and taxonomy information
>gi|195648603|gb|ACG43769.1| vacuolar protein sorting 29 [Zea mays] Back     alignment and taxonomy information
>gi|116791301|gb|ABK25927.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|357462271|ref|XP_003601417.1| Vacuolar protein sorting [Medicago truncatula] gi|355490465|gb|AES71668.1| Vacuolar protein sorting [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query147
TAIR|locus:2100362190 MAG1 "AT3G47810" [Arabidopsis 0.965 0.747 0.866 3.6e-66
ZFIN|ZDB-GENE-030131-8764182 vps29 "vacuolar protein sortin 0.945 0.763 0.604 7.9e-46
UNIPROTKB|G3X6P5185 VPS29 "Vacuolar protein sortin 0.945 0.751 0.597 1.6e-45
UNIPROTKB|Q3T0M0186 VPS29 "Vacuolar protein sortin 0.945 0.747 0.597 1.6e-45
UNIPROTKB|F1RNN0186 VPS29 "Uncharacterized protein 0.945 0.747 0.597 1.6e-45
MGI|MGI:1928344182 Vps29 "vacuolar protein sortin 0.945 0.763 0.597 1.6e-45
UNIPROTKB|E2R8A2180 VPS29 "Uncharacterized protein 0.938 0.766 0.601 2.1e-45
UNIPROTKB|F8VXU5214 VPS29 "Vacuolar protein sortin 0.938 0.644 0.601 2.1e-45
UNIPROTKB|H3BLV8199 VPS29 "Vacuolar protein sortin 0.938 0.693 0.601 2.1e-45
UNIPROTKB|Q9UBQ0182 VPS29 "Vacuolar protein sortin 0.938 0.758 0.601 2.1e-45
TAIR|locus:2100362 MAG1 "AT3G47810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 673 (242.0 bits), Expect = 3.6e-66, P = 3.6e-66
 Identities = 123/142 (86%), Positives = 131/142 (92%)

Query:     2 EVHDYLKSLCPDLHVTRGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQ 61
             E+HDYLK++CPDLH+ RGE+DED+RYPE KTLTIGQFKLG+CHGHQVIPWGDLDSLAMLQ
Sbjct:    45 EIHDYLKTICPDLHIVRGEFDEDARYPENKTLTIGQFKLGLCHGHQVIPWGDLDSLAMLQ 104

Query:    62 RQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVY 121
             RQL VDILVTGHTHQF AYKHEGGVVINPGSATGAYSS   DVNPSFVLMDIDG R VVY
Sbjct:   105 RQLGVDILVTGHTHQFTAYKHEGGVVINPGSATGAYSSINQDVNPSFVLMDIDGFRAVVY 164

Query:   122 VYELIDGEVKVDKIDFKKTATT 143
             VYELIDGEVKVDKI+FKK  TT
Sbjct:   165 VYELIDGEVKVDKIEFKKPPTT 186
GO:0004722 "protein serine/threonine phosphatase activity" evidence=ISS
GO:0016788 "hydrolase activity, acting on ester bonds" evidence=IEA
GO:0005771 "multivesicular body" evidence=IDA
GO:0008333 "endosome to lysosome transport" evidence=ISS
GO:0016020 "membrane" evidence=IDA
GO:0030904 "retromer complex" evidence=ISS;IDA
GO:0043231 "intracellular membrane-bounded organelle" evidence=IDA
GO:0006623 "protein targeting to vacuole" evidence=RCA;IMP
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=RCA
GO:0006944 "cellular membrane fusion" evidence=RCA
GO:0009853 "photorespiration" evidence=RCA
GO:0016192 "vesicle-mediated transport" evidence=RCA
GO:0016197 "endosomal transport" evidence=RCA
GO:0051788 "response to misfolded protein" evidence=RCA
GO:0080129 "proteasome core complex assembly" evidence=RCA
GO:0001881 "receptor recycling" evidence=IDA
GO:0007034 "vacuolar transport" evidence=IMP
ZFIN|ZDB-GENE-030131-8764 vps29 "vacuolar protein sorting 29 (yeast)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|G3X6P5 VPS29 "Vacuolar protein sorting-associated protein 29" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0M0 VPS29 "Vacuolar protein sorting-associated protein 29" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RNN0 VPS29 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1928344 Vps29 "vacuolar protein sorting 29 (S. pombe)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2R8A2 VPS29 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F8VXU5 VPS29 "Vacuolar protein sorting-associated protein 29" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H3BLV8 VPS29 "Vacuolar protein sorting-associated protein 29" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UBQ0 VPS29 "Vacuolar protein sorting-associated protein 29" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7ZV68VPS29_DANRE3, ., 1, ., 3, ., 30.60430.94550.7637yesno
Q5R9Z1VPS29_PONAB3, ., 1, ., 3, ., 30.59710.94550.7637yesno
Q9QZ88VPS29_MOUSE3, ., 1, ., 3, ., 30.59710.94550.7637yesno
B2RZ78VPS29_RAT3, ., 1, ., 3, ., 30.59710.94550.7637yesno
Q3T0M0VPS29_BOVIN3, ., 1, ., 3, ., 30.59710.94550.7473yesno
Q9STT2VPS29_ARATHNo assigned EC number0.86610.96590.7473yesno
Q54IF7VPS29_DICDI3, ., 1, ., 3, ., 30.57970.93870.7540yesno
Q6DEU3VPS29_XENTR3, ., 1, ., 3, ., 30.59710.94550.7637yesno
Q5ZIL2VPS29_CHICK3, ., 1, ., 3, ., 30.59710.94550.7473yesno
Q9UBQ0VPS29_HUMAN3, ., 1, ., 3, ., 30.60140.93870.7582yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00037022001
SubName- Full=Chromosome chr1 scaffold_84, whole genome shotgun sequence; (190 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00014384001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (790 aa)
    • • 0.519
GSVIVG00036733001
SubName- Full=Chromosome chr4 scaffold_83, whole genome shotgun sequence; (831 aa)
    • • 0.499
GSVIVG00017341001
SubName- Full=Chromosome chr6 scaffold_15, whole genome shotgun sequence; (310 aa)
    • • 0.423
GSVIVG00037208001
SubName- Full=Chromosome chr16 scaffold_86, whole genome shotgun sequence; (310 aa)
    • • 0.415

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query147
cd07394178 cd07394, MPP_Vps29, Homo sapiens Vps29 and related 6e-88
COG0622172 COG0622, COG0622, Predicted phosphoesterase [Gener 2e-25
pfam12850146 pfam12850, Metallophos_2, Calcineurin-like phospho 1e-23
TIGR00040158 TIGR00040, yfcE, phosphoesterase, MJ0936 family 2e-19
cd00841155 cd00841, MPP_YfcE, Escherichia coli YfcE and relat 8e-17
PRK09453182 PRK09453, PRK09453, phosphodiesterase; Provisional 8e-07
cd07398217 cd07398, MPP_YbbF-LpxH, Escherichia coli YbbF/LpxH 0.004
>gnl|CDD|163637 cd07394, MPP_Vps29, Homo sapiens Vps29 and related proteins, metallophosphatase domain Back     alignment and domain information 
 Score =  253 bits (649), Expect = 6e-88
 Identities = 90/136 (66%), Positives = 116/136 (85%)

Query: 2   EVHDYLKSLCPDLHVTRGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQ 61
           E +DYLK++ PD+H+ RG++DE+  YPETK +T+GQFK+G+ HGHQV+PWGD DSLA LQ
Sbjct: 43  ETYDYLKTIAPDVHIVRGDFDENLNYPETKVITVGQFKIGLIHGHQVVPWGDPDSLAALQ 102

Query: 62  RQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVY 121
           RQLDVDIL++GHTH+F+A++HEG   INPGSATGA+S    +V PSFVLMDI G +VV Y
Sbjct: 103 RQLDVDILISGHTHKFEAFEHEGKFFINPGSATGAFSPLDPNVIPSFVLMDIQGSKVVTY 162

Query: 122 VYELIDGEVKVDKIDF 137
           VY+LIDGEVKV+KI++
Sbjct: 163 VYQLIDGEVKVEKIEY 178

Vps29 (vacuolar sorting protein 29), also known as vacuolar membrane protein Pep11, is a subunit of the retromer complex which is responsible for the retrieval of mannose-6-phosphate receptors (MPRs) from the endosomes for retrograde transport back to the Golgi. Vps29 has a phosphoesterase fold that acts as a protein interaction scaffold for retromer complex assembly as well as a phosphatase with specificity for the cytoplasmic tail of the MPR. The retromer includes the following 5 subunits: Vps35, Vps26, Vps29, and a dimer of the sorting nexins Vps5 (Snx1), and Vps17 (Snx2). Vps29 belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 178
>gnl|CDD|223695 COG0622, COG0622, Predicted phosphoesterase [General function prediction only] Back     alignment and domain information
>gnl|CDD|221807 pfam12850, Metallophos_2, Calcineurin-like phosphoesterase superfamily domain Back     alignment and domain information
>gnl|CDD|232794 TIGR00040, yfcE, phosphoesterase, MJ0936 family Back     alignment and domain information
>gnl|CDD|163617 cd00841, MPP_YfcE, Escherichia coli YfcE and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|181869 PRK09453, PRK09453, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|163641 cd07398, MPP_YbbF-LpxH, Escherichia coli YbbF/LpxH and related proteins, metallophosphatase domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 147
cd07394178 MPP_Vps29 Homo sapiens Vps29 and related proteins, 100.0
KOG3325183 consensus Membrane coat complex Retromer, subunit 99.96
COG0622172 Predicted phosphoesterase [General function predic 99.95
TIGR00040158 yfcE phosphoesterase, MJ0936 family. Members of th 99.92
cd00841155 MPP_YfcE Escherichia coli YfcE and related protein 99.9
PRK09453182 phosphodiesterase; Provisional 99.89
PF12850156 Metallophos_2: Calcineurin-like phosphoesterase su 99.79
cd07379135 MPP_239FB Homo sapiens 239FB and related proteins, 99.52
cd07398217 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and relat 99.45
PRK05340241 UDP-2,3-diacylglucosamine hydrolase; Provisional 99.44
TIGR01854231 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase. 99.43
COG2129226 Predicted phosphoesterases, related to the Icc pro 99.4
cd07388224 MPP_Tt1561 Thermus thermophilus Tt1561 and related 99.4
cd07400144 MPP_YydB Bacillus subtilis YydB and related protei 99.39
COG2908237 Uncharacterized protein conserved in bacteria [Fun 99.37
cd07403129 MPP_TTHA0053 Thermus thermophilus TTHA0053 and rel 99.34
cd07424207 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase do 99.32
PRK09968218 serine/threonine-specific protein phosphatase 2; P 99.3
cd07392188 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and rel 99.2
cd07390168 MPP_AQ1575 Aquifex aeolicus AQ1575 and related pro 99.16
PF14582255 Metallophos_3: Metallophosphoesterase, calcineurin 99.1
cd07395262 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, 99.07
cd07402240 MPP_GpdQ Enterobacter aerogenes GpdQ and related p 99.06
PRK11148275 cyclic 3',5'-adenosine monophosphate phosphodieste 99.04
PRK11439218 pphA serine/threonine protein phosphatase 1; Provi 99.02
PRK04036504 DNA polymerase II small subunit; Validated 98.93
cd07423234 MPP_PrpE Bacillus subtilis PrpE and related protei 98.88
cd07386243 MPP_DNA_pol_II_small_archeal_C archeal DNA polymer 98.86
cd07393232 MPP_DR1119 Deinococcus radiodurans DR1119 and rela 98.78
cd00840223 MPP_Mre11_N Mre11 nuclease, N-terminal metallophos 98.75
cd07404166 MPP_MS158 Microscilla MS158 and related proteins, 98.75
cd00838131 MPP_superfamily metallophosphatase superfamily, me 98.75
cd07378277 MPP_ACP5 Homo sapiens acid phosphatase 5 and relat 98.62
cd07383199 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase 98.61
TIGR00024225 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11 98.59
cd07396267 MPP_Nbla03831 Homo sapiens Nbla03831 and related p 98.58
cd07425208 MPP_Shelphs Shewanella-like phosphatases, metallop 98.52
COG4186186 Predicted phosphoesterase or phosphohydrolase [Gen 98.52
cd07391172 MPP_PF1019 Pyrococcus furiosus PF1019 and related 98.43
cd07399214 MPP_YvnB Bacillus subtilis YvnB and related protei 98.37
TIGR00583405 mre11 DNA repair protein (mre11). All proteins in 98.34
cd07397238 MPP_DevT Myxococcus xanthus DevT and related prote 98.34
cd00839294 MPP_PAPs purple acid phosphatases of the metalloph 98.31
PF00149200 Metallophos: Calcineurin-like phosphoesterase; Int 98.26
PRK11340271 phosphodiesterase YaeI; Provisional 98.12
PTZ00422394 glideosome-associated protein 50; Provisional 98.08
COG1311481 HYS2 Archaeal DNA polymerase II, small subunit/DNA 98.02
COG1768230 Predicted phosphohydrolase [General function predi 98.0
COG1409301 Icc Predicted phosphohydrolases [General function 97.89
cd07406257 MPP_CG11883_N Drosophila melanogaster CG11883 and 97.86
cd07411264 MPP_SoxB_N Thermus thermophilus SoxB and related p 97.84
TIGR03729239 acc_ester putative phosphoesterase. Members of thi 97.63
cd07385223 MPP_YkuE_C Bacillus subtilis YkuE and related prot 97.6
cd07384171 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and re 97.59
cd00144225 MPP_PPP_family phosphoprotein phosphatases of the 97.52
PRK13625245 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provision 97.51
PLN02533427 probable purple acid phosphatase 97.44
cd07410277 MPP_CpdB_N Escherichia coli CpdB and related prote 97.42
PHA02546340 47 endonuclease subunit; Provisional 97.42
cd08165156 MPP_MPPE1 human MPPE1 and related proteins, metall 97.34
COG1407235 Predicted ICC-like phosphoesterases [General funct 97.21
cd07405285 MPP_UshA_N Escherichia coli UshA and related prote 97.21
COG1408284 Predicted phosphohydrolases [General function pred 97.17
cd07409281 MPP_CD73_N CD73 ecto-5'-nucleotidase and related p 97.17
cd07387257 MPP_PolD2_C PolD2 (DNA polymerase delta, subunit 2 97.16
cd08164193 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related 97.12
cd08166195 MPP_Cdc1_like_1 uncharacterized subgroup related t 97.09
cd07412288 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and 96.95
cd07408257 MPP_SA0022_N Staphylococcus aureus SA0022 and rela 96.87
cd07401256 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metal 96.8
COG0420 390 SbcD DNA repair exonuclease [DNA replication, reco 96.73
TIGR03767496 P_acnes_RR metallophosphoesterase, PPA1498 family. 96.65
cd00845252 MPP_UshA_N_like Escherichia coli UshA-like family, 96.65
cd07422257 MPP_ApaH Escherichia coli ApaH and related protein 96.49
PRK09418 780 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 96.44
cd07407282 MPP_YHR202W_N Saccharomyces cerevisiae YHR202W and 96.3
cd07417316 MPP_PP5_C PP5, C-terminal metallophosphatase domai 96.28
cd07382255 MPP_DR1281 Deinococcus radiodurans DR1281 and rela 96.26
PRK00166275 apaH diadenosine tetraphosphatase; Reviewed 96.26
TIGR00668279 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetric 96.18
cd07413222 MPP_PA3087 Pseudomonas aeruginosa PA3087 and relat 96.16
PRK09558 551 ushA bifunctional UDP-sugar hydrolase/5'-nucleotid 96.11
cd08163257 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related 96.09
PRK11907 814 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 96.0
TIGR01530 550 nadN NAD pyrophosphatase/5'-nucleotidase NadN. Thi 95.98
smart00854239 PGA_cap Bacterial capsule synthesis protein PGA_ca 95.82
TIGR01390 626 CycNucDiestase 2',3'-cyclic-nucleotide 2'-phosphod 95.81
PRK09420 649 cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosp 95.72
smart00156271 PP2Ac Protein phosphatase 2A homologues, catalytic 95.57
KOG2310 646 consensus DNA repair exonuclease MRE11 [Replicatio 95.48
COG0639155 ApaH Diadenosine tetraphosphatase and related seri 95.48
PRK09419 1163 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 95.4
PRK09419 1163 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 95.36
cd07381239 MPP_CapA CapA and related proteins, metallophospha 95.3
TIGR00282266 metallophosphoesterase, MG_246/BB_0505 family. A m 94.72
PF09587250 PGA_cap: Bacterial capsule synthesis protein PGA_c 94.57
cd07414293 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzyme 94.41
KOG1378452 consensus Purple acid phosphatase [Carbohydrate tr 94.34
cd08162313 MPP_PhoA_N Synechococcus sp. strain PCC 7942 PhoA 94.26
KOG1432379 consensus Predicted DNA repair exonuclease SIA1 [G 94.2
cd00842296 MPP_ASMase acid sphingomyelinase and related prote 94.16
PTZ00480320 serine/threonine-protein phosphatase; Provisional 93.83
PTZ00239303 serine/threonine protein phosphatase 2A; Provision 93.76
PHA03008234 hypothetical protein; Provisional 93.51
cd07380150 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and re 93.42
cd07415285 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein 92.12
KOG2679336 consensus Purple (tartrate-resistant) acid phospha 91.37
cd07416305 MPP_PP2B PP2B, metallophosphatase domain. PP2B (ca 91.24
PTZ00244294 serine/threonine-protein phosphatase PP1; Provisio 90.96
TIGR03768492 RPA4764 metallophosphoesterase, RPA4764 family. Th 90.96
COG0737 517 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesteras 90.59
cd07418377 MPP_PP7 PP7, metallophosphatase domain. PP7 is a p 88.75
cd07420321 MPP_RdgC Drosophila melanogaster RdgC and related 88.63
cd07419311 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase a 87.8
cd00839294 MPP_PAPs purple acid phosphatases of the metalloph 87.25
cd07405285 MPP_UshA_N Escherichia coli UshA and related prote 85.92
PRK10966 407 exonuclease subunit SbcD; Provisional 81.57
>cd07394 MPP_Vps29 Homo sapiens Vps29 and related proteins, metallophosphatase domain Back     alignment and domain information 
Probab=100.00  E-value=7.3e-32  Score=200.51  Aligned_cols=136  Identities=66%  Similarity=1.176  Sum_probs=121.1

Q ss_pred             cHhHHHHhhCCCeEEEeCCCCCCCCCCceEEEEECCEEEEEEcCCCCCCCCCHHHHHHHHhhCCCCEEEECCccCeeEEE
Q 032130            2 EVHDYLKSLCPDLHVTRGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKAYK   81 (147)
Q Consensus         2 e~l~~l~~~~~~~~~V~GN~D~~~~lP~~~~~~~~g~~i~~~Hg~~~~~~~~~~~l~~~~~~~~~diii~GHtH~p~~~~   81 (147)
                      +++++|++++.++++|+||||....+|....++++|.+|+++||++..++...+.+..++++.++|+++|||||.|+...
T Consensus        43 ~~~~~l~~~~~~~~~V~GN~D~~~~lp~~~~~~~~g~~i~l~HG~~~~~~~~~~~~~~~~~~~~~dvii~GHTH~p~~~~  122 (178)
T cd07394          43 ETYDYLKTIAPDVHIVRGDFDENLNYPETKVITVGQFKIGLIHGHQVVPWGDPDSLAALQRQLDVDILISGHTHKFEAFE  122 (178)
T ss_pred             HHHHHHHhhCCceEEEECCCCccccCCCcEEEEECCEEEEEEECCcCCCCCCHHHHHHHHHhcCCCEEEECCCCcceEEE
Confidence            57788888765699999999987789999999999999999999988776667778888888899999999999999988


Q ss_pred             ECCEEEEcCCCCCCCCCCCCCCCCCeEEEEEEeCCEEEEEEEEecCCeEeeeEEEE
Q 032130           82 HEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDF  137 (147)
Q Consensus        82 ~~~~~~iNpGS~g~p~~~~~~~~~~~y~il~~~~~~~~v~~~~~~~~~~~~~~~~~  137 (147)
                      .+++++|||||++.|+.++++.+.++|++++++++.+.++++.+.++++|+++++|
T Consensus       123 ~~g~~viNPGSv~~~~~~~~~~~~~syail~~~~~~~~~~~~~l~~~~~~~~~~~~  178 (178)
T cd07394         123 HEGKFFINPGSATGAFSPLDPNVIPSFVLMDIQGSKVVTYVYQLIDGEVKVEKIEY  178 (178)
T ss_pred             ECCEEEEECCCCCCCCCCCCCCCCCeEEEEEecCCeEEEEEEEEECCcEEEEEecC
Confidence            99999999999998865545566789999999999999999999999999999875

Vps29 (vacuolar sorting protein 29), also known as vacuolar membrane protein Pep11, is a subunit of the retromer complex which is responsible for the retrieval of mannose-6-phosphate receptors (MPRs) from the endosomes for retrograde transport back to the Golgi. Vps29 has a phosphoesterase fold that acts as a protein interaction scaffold for retromer complex assembly as well as a phosphatase with specificity for the cytoplasmic tail of the MPR. The retromer includes the following 5 subunits: Vps35, Vps26, Vps29, and a dimer of the sorting nexins Vps5 (Snx1), and Vps17 (Snx2). Vps29 belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily incl
>KOG3325 consensus Membrane coat complex Retromer, subunit VPS29/PEP11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0622 Predicted phosphoesterase [General function prediction only] Back     alignment and domain information
>TIGR00040 yfcE phosphoesterase, MJ0936 family Back     alignment and domain information
>cd00841 MPP_YfcE Escherichia coli YfcE and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK09453 phosphodiesterase; Provisional Back     alignment and domain information
>PF12850 Metallophos_2: Calcineurin-like phosphoesterase superfamily domain; InterPro: IPR024654 Domains in this entry are members of the calcineurin-like phosphoesterase domain superfamily [] Back     alignment and domain information
>cd07379 MPP_239FB Homo sapiens 239FB and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07398 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK05340 UDP-2,3-diacylglucosamine hydrolase; Provisional Back     alignment and domain information
>TIGR01854 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase Back     alignment and domain information
>COG2129 Predicted phosphoesterases, related to the Icc protein [General function prediction only] Back     alignment and domain information
>cd07388 MPP_Tt1561 Thermus thermophilus Tt1561 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07400 MPP_YydB Bacillus subtilis YydB and related proteins, metallophosphatase domain Back     alignment and domain information
>COG2908 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd07403 MPP_TTHA0053 Thermus thermophilus TTHA0053 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07424 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase domain Back     alignment and domain information
>PRK09968 serine/threonine-specific protein phosphatase 2; Provisional Back     alignment and domain information
>cd07392 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07390 MPP_AQ1575 Aquifex aeolicus AQ1575 and related proteins, metallophosphatase domain Back     alignment and domain information
>PF14582 Metallophos_3: Metallophosphoesterase, calcineurin superfamily; PDB: 1UF3_B 2YVT_A Back     alignment and domain information
>cd07395 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07402 MPP_GpdQ Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK11148 cyclic 3',5'-adenosine monophosphate phosphodiesterase; Provisional Back     alignment and domain information
>PRK11439 pphA serine/threonine protein phosphatase 1; Provisional Back     alignment and domain information
>PRK04036 DNA polymerase II small subunit; Validated Back     alignment and domain information
>cd07423 MPP_PrpE Bacillus subtilis PrpE and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07386 MPP_DNA_pol_II_small_archeal_C archeal DNA polymerase II, small subunit, C-terminal metallophosphatase domain Back     alignment and domain information
>cd07393 MPP_DR1119 Deinococcus radiodurans DR1119 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd00840 MPP_Mre11_N Mre11 nuclease, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07404 MPP_MS158 Microscilla MS158 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd00838 MPP_superfamily metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>cd07378 MPP_ACP5 Homo sapiens acid phosphatase 5 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07383 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR00024 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11-related Back     alignment and domain information
>cd07396 MPP_Nbla03831 Homo sapiens Nbla03831 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07425 MPP_Shelphs Shewanella-like phosphatases, metallophosphatase domain Back     alignment and domain information
>COG4186 Predicted phosphoesterase or phosphohydrolase [General function prediction only] Back     alignment and domain information
>cd07391 MPP_PF1019 Pyrococcus furiosus PF1019 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07399 MPP_YvnB Bacillus subtilis YvnB and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR00583 mre11 DNA repair protein (mre11) Back     alignment and domain information
>cd07397 MPP_DevT Myxococcus xanthus DevT and related proteins, metallophosphatase domain Back     alignment and domain information
>cd00839 MPP_PAPs purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>PF00149 Metallophos: Calcineurin-like phosphoesterase; InterPro: IPR004843 This domain is found in a diverse range of phosphoesterases [], including protein phosphoserine phosphatases, nucleotidases, sphingomyelin phosphodiesterases and 2'-3' cAMP phosphodiesterases, as well as nucleases such as bacterial SbcD or yeast MRE11 Back     alignment and domain information
>PRK11340 phosphodiesterase YaeI; Provisional Back     alignment and domain information
>PTZ00422 glideosome-associated protein 50; Provisional Back     alignment and domain information
>COG1311 HYS2 Archaeal DNA polymerase II, small subunit/DNA polymerase delta, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1768 Predicted phosphohydrolase [General function prediction only] Back     alignment and domain information
>COG1409 Icc Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>cd07406 MPP_CG11883_N Drosophila melanogaster CG11883 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07411 MPP_SoxB_N Thermus thermophilus SoxB and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>TIGR03729 acc_ester putative phosphoesterase Back     alignment and domain information
>cd07385 MPP_YkuE_C Bacillus subtilis YkuE and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>cd07384 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd00144 MPP_PPP_family phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>PRK13625 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional Back     alignment and domain information
>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>cd07410 MPP_CpdB_N Escherichia coli CpdB and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>PHA02546 47 endonuclease subunit; Provisional Back     alignment and domain information
>cd08165 MPP_MPPE1 human MPPE1 and related proteins, metallophosphatase domain Back     alignment and domain information
>COG1407 Predicted ICC-like phosphoesterases [General function prediction only] Back     alignment and domain information
>cd07405 MPP_UshA_N Escherichia coli UshA and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>COG1408 Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>cd07409 MPP_CD73_N CD73 ecto-5'-nucleotidase and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07387 MPP_PolD2_C PolD2 (DNA polymerase delta, subunit 2), C-terminal domain Back     alignment and domain information
>cd08164 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd08166 MPP_Cdc1_like_1 uncharacterized subgroup related to Saccharomyces cerevisiae CDC1, metallophosphatase domain Back     alignment and domain information
>cd07412 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07408 MPP_SA0022_N Staphylococcus aureus SA0022 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07401 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metallophosphatase domain Back     alignment and domain information
>COG0420 SbcD DNA repair exonuclease [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03767 P_acnes_RR metallophosphoesterase, PPA1498 family Back     alignment and domain information
>cd00845 MPP_UshA_N_like Escherichia coli UshA-like family, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07422 MPP_ApaH Escherichia coli ApaH and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK09418 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>cd07407 MPP_YHR202W_N Saccharomyces cerevisiae YHR202W and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07417 MPP_PP5_C PP5, C-terminal metallophosphatase domain Back     alignment and domain information
>cd07382 MPP_DR1281 Deinococcus radiodurans DR1281 and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK00166 apaH diadenosine tetraphosphatase; Reviewed Back     alignment and domain information
>TIGR00668 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetrical) Back     alignment and domain information
>cd07413 MPP_PA3087 Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK09558 ushA bifunctional UDP-sugar hydrolase/5'-nucleotidase periplasmic precursor; Reviewed Back     alignment and domain information
>cd08163 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK11907 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>TIGR01530 nadN NAD pyrophosphatase/5'-nucleotidase NadN Back     alignment and domain information
>smart00854 PGA_cap Bacterial capsule synthesis protein PGA_cap Back     alignment and domain information
>TIGR01390 CycNucDiestase 2',3'-cyclic-nucleotide 2'-phosphodiesterase Back     alignment and domain information
>PRK09420 cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase periplasmic precursor protein; Reviewed Back     alignment and domain information
>smart00156 PP2Ac Protein phosphatase 2A homologues, catalytic domain Back     alignment and domain information
>KOG2310 consensus DNA repair exonuclease MRE11 [Replication, recombination and repair] Back     alignment and domain information
>COG0639 ApaH Diadenosine tetraphosphatase and related serine/threonine protein phosphatases [Signal transduction mechanisms] Back     alignment and domain information
>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>cd07381 MPP_CapA CapA and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR00282 metallophosphoesterase, MG_246/BB_0505 family Back     alignment and domain information
>PF09587 PGA_cap: Bacterial capsule synthesis protein PGA_cap; InterPro: IPR019079 CapA is a putative poly-gamma-glutamate capsule biosynthesis protein found in bacteria Back     alignment and domain information
>cd07414 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG1378 consensus Purple acid phosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd08162 MPP_PhoA_N Synechococcus sp Back     alignment and domain information
>KOG1432 consensus Predicted DNA repair exonuclease SIA1 [General function prediction only] Back     alignment and domain information
>cd00842 MPP_ASMase acid sphingomyelinase and related proteins, metallophosphatase domain Back     alignment and domain information
>PTZ00480 serine/threonine-protein phosphatase; Provisional Back     alignment and domain information
>PTZ00239 serine/threonine protein phosphatase 2A; Provisional Back     alignment and domain information
>PHA03008 hypothetical protein; Provisional Back     alignment and domain information
>cd07380 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07415 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain Back     alignment and domain information
>KOG2679 consensus Purple (tartrate-resistant) acid phosphatase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd07416 MPP_PP2B PP2B, metallophosphatase domain Back     alignment and domain information
>PTZ00244 serine/threonine-protein phosphatase PP1; Provisional Back     alignment and domain information
>TIGR03768 RPA4764 metallophosphoesterase, RPA4764 family Back     alignment and domain information
>COG0737 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesterase and related esterases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd07418 MPP_PP7 PP7, metallophosphatase domain Back     alignment and domain information
>cd07420 MPP_RdgC Drosophila melanogaster RdgC and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07419 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>cd00839 MPP_PAPs purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>cd07405 MPP_UshA_N Escherichia coli UshA and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>PRK10966 exonuclease subunit SbcD; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query147
1z2w_A192 Crystal Structure Of Mouse Vps29 Complexed With Mn2 1e-48
1w24_A182 Crystal Structure Of Human Vps29 Length = 182 1e-48
2r17_A183 Functional Architecture Of The Retromer Cargo-Recog 3e-47
2a22_A215 Structure Of Vacuolar Protein Sorting 29 From Crypt 3e-31
>pdb|1Z2W|A Chain A, Crystal Structure Of Mouse Vps29 Complexed With Mn2+ Length = 192 Back     alignment and structure 
Iteration: 1

 Score =  188 bits (477), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 83/139 (59%), Positives = 113/139 (81%)
Query: 2   EVHDYLKSLCPDLHVTRGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQ 61
           E +DYLK+L  D+H+ RG++DE+  YPE K +T+GQFK+G+ HGHQVIPWGD+ SLA+LQ
Sbjct: 54  ESYDYLKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGLIHGHQVIPWGDMASLALLQ 113
Query: 62  RQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVY 121
           RQ DVDIL++GHTH+F+A++HE    INPGSATGAY++   ++ PSFVLMDI    VV Y
Sbjct: 114 RQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYNALETNIIPSFVLMDIQASTVVTY 173
Query: 122 VYELIDGEVKVDKIDFKKT 140
           VY+LI  +VKV++I++KK+
Sbjct: 174 VYQLIGDDVKVERIEYKKS 192
>pdb|1W24|A Chain A, Crystal Structure Of Human Vps29 Length = 182 Back     alignment and structure
>pdb|2R17|A Chain A, Functional Architecture Of The Retromer Cargo-Recognition Complex Length = 183 Back     alignment and structure
>pdb|2A22|A Chain A, Structure Of Vacuolar Protein Sorting 29 From Cryptosporidium Parvum Length = 215 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query147
2a22_A215 Vacuolar protein sorting 29; alpha-beta-BETA-alpha 5e-57
1z2w_A192 Vacuolar protein sorting 29; VPS29, retromer, phos 5e-54
2kkn_A178 Uncharacterized protein; protein phosphatase 2A ho 9e-36
3ck2_A176 Conserved uncharacterized protein (predicted phosp 3e-30
1s3l_A190 Hypothetical protein MJ0936; phosphodiesterase, nu 2e-16
1su1_A208 Hypothetical protein YFCE; structural genomics, ph 7e-16
3qfm_A270 SAPH, putative uncharacterized protein; sandwich f 9e-07
1nnw_A252 Hypothetical protein; structural genomics, PSI, pr 5e-04
>2a22_A Vacuolar protein sorting 29; alpha-beta-BETA-alpha sandwich, structural genomics, structural genomics consortium, SGC, protein transport; 2.20A {Cryptosporidium parvum} SCOP: d.159.1.7 Length = 215 Back     alignment and structure
 Score =  176 bits (447), Expect = 5e-57
 Identities = 62/147 (42%), Positives = 94/147 (63%), Gaps = 9/147 (6%)

Query: 2   EVHDYLKSLCPDLHVTRGEYDED---------SRYPETKTLTIGQFKLGICHGHQVIPWG 52
           E  + LK++  ++++  G+ D             +PE   + IG+FK+G+ HG+QV+PW 
Sbjct: 69  EYVEMLKNITKNVYIVSGDLDSAIFNPDPESNGVFPEYVVVQIGEFKIGLMHGNQVLPWD 128

Query: 53  DLDSLAMLQRQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMD 112
           D  SL   QR+LD DILVTGHTH+ + ++  G + +NPG+ATGA+S+ T D  PSF+LM 
Sbjct: 129 DPGSLEQWQRRLDCDILVTGHTHKLRVFEKNGKLFLNPGTATGAFSALTPDAPPSFMLMA 188

Query: 113 IDGLRVVVYVYELIDGEVKVDKIDFKK 139
           + G +VV+YVY+L DG+  V   +F K
Sbjct: 189 LQGNKVVLYVYDLRDGKTNVAMSEFSK 215
>1z2w_A Vacuolar protein sorting 29; VPS29, retromer, phosphatase, manganese, protein transport; 2.00A {Mus musculus} SCOP: d.159.1.7 PDB: 1z2x_A 3lh6_A 3lh7_A 3psn_A 3pso_A 1w24_A 2r17_A Length = 192 Back     alignment and structure
>2kkn_A Uncharacterized protein; protein phosphatase 2A homologue, structural genomics, PSI- 2, protein structure initiative; NMR {Thermotoga maritima} Length = 178 Back     alignment and structure
>3ck2_A Conserved uncharacterized protein (predicted phosphoesterase COG0622); structural genomics, predicted phosphodiesterase, PSI-2; HET: SRT; 2.30A {Streptococcus pneumoniae} SCOP: d.159.1.7 Length = 176 Back     alignment and structure
>1s3l_A Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC struc funded by NIH; 2.40A {Methanocaldococcus jannaschii} SCOP: d.159.1.7 PDB: 1s3m_A 1s3n_A 2ahd_A Length = 190 Back     alignment and structure
>1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} SCOP: d.159.1.7 Length = 208 Back     alignment and structure
>3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A* Length = 270 Back     alignment and structure
>1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A Length = 252 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query147
1z2w_A192 Vacuolar protein sorting 29; VPS29, retromer, phos 99.97
2a22_A215 Vacuolar protein sorting 29; alpha-beta-BETA-alpha 99.96
3ck2_A176 Conserved uncharacterized protein (predicted phosp 99.93
3qfm_A270 SAPH, putative uncharacterized protein; sandwich f 99.91
2kkn_A178 Uncharacterized protein; protein phosphatase 2A ho 99.88
1nnw_A252 Hypothetical protein; structural genomics, PSI, pr 99.83
3rqz_A246 Metallophosphoesterase; PSI-biology, midwest cente 99.82
1s3l_A190 Hypothetical protein MJ0936; phosphodiesterase, nu 99.8
1su1_A208 Hypothetical protein YFCE; structural genomics, ph 99.8
1uf3_A228 Hypothetical protein TT1561; metallo-dependent pho 99.61
3ib7_A330 ICC protein; metallophosphoesterase, alpha-beta fo 99.61
1xm7_A195 Hypothetical protein AQ_1665; structural genomics, 99.6
3d03_A274 Phosphohydrolase; glycerophosphodiesterase, metall 99.59
2yvt_A260 Hypothetical protein AQ_1956; structural genomics, 99.56
1g5b_A221 Serine/threonine protein phosphatase; bacteriophag 99.46
2xmo_A443 LMO2642 protein; phosphodiesterase, hydrolase; 1.7 99.27
3av0_A386 DNA double-strand break repair protein MRE11; DNA 99.21
1ute_A313 Protein (II purple acid phosphatase); tartrate res 99.03
3tho_B379 Exonuclease, putative; adenosine triphosphate, bac 98.95
3rl5_A296 Metallophosphoesterase mpped2; alpha-beta fold, me 98.95
4fbk_A472 DNA repair and telomere maintenance protein NBS1, 98.83
4fbw_A417 DNA repair protein RAD32; DNA double-strand break 98.81
2nxf_A322 Putative dimetal phosphatase; dinuclear metal cent 98.81
3tgh_A342 Glideosome-associated protein 50; phosphatase fold 98.8
2qjc_A262 Diadenosine tetraphosphatase, putative; putative d 98.72
3t1i_A431 Double-strand break repair protein MRE11A; DNA rep 98.68
1ii7_A333 MRE11 nuclease; RAD50, DNA double-strand break rep 98.66
2q8u_A336 Exonuclease, putative; structural genomics, joint 98.58
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 98.18
1xzw_A426 Purple acid phosphatase; hydrolase; HET: NAG FUC M 98.12
2z72_A342 Protein-tyrosine-phosphatase; cold-active enzyme, 97.91
2qfp_A424 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 97.75
1hp1_A 516 5'-nucleotidase; metallophosphatase, dinuclear, me 97.68
3qfk_A 527 Uncharacterized protein; structural genomics, cent 97.59
3h63_A315 Serine/threonine-protein phosphatase 5; metalloenz 97.51
2wdc_A 562 SOXB, sulfur oxidation protein SOXB; sulfur-sulfur 96.94
2dfj_A280 Diadenosinetetraphosphatase; helices and strands m 96.83
2ie4_C309 PP2A-alpha;, serine/threonine-protein phosphatase 96.81
3gve_A341 YFKN protein; alpha-beta-BETA-alpha sandwich, stru 96.8
3icf_A335 PPT, serine/threonine-protein phosphatase T; IRO m 96.79
3jyf_A339 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- n 96.78
3e7a_A299 PP-1A, serine/threonine-protein phosphatase PP1-al 96.62
3ive_A 509 Nucleotidase; structural genomics, PSI-2, protein 96.35
1fjm_A330 Protein serine/threonine phosphatase-1 (alpha ISO 96.18
3ztv_A 579 NAD nucleotidase, NADN; hydrolase, NAD pyrophospha 95.36
1aui_A 521 Calcineurin, serine/threonine phosphatase 2B; hydr 95.22
4h2g_A 546 5'-nucleotidase; dimer, hydrolase, phosphatase, ex 94.77
2z1a_A 552 5'-nucleotidase; metal-binding, nucleotide-binding 94.72
3c9f_A 557 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, p 94.3
2yeq_A527 Apased, PHOD, alkaline phosphatase D; hydrolase, p 94.11
3flo_A460 DNA polymerase alpha subunit B; protein-protein co 93.44
4h1s_A 530 5'-nucleotidase; hydrolase; HET: NAG; 2.20A {Homo 92.74
3ll8_A357 Serine/threonine-protein phosphatase 2B catalytic 92.33
1t70_A255 Phosphatase; crystal, X-RAY crystallography, struc 91.87
1t71_A281 Phosphatase, conserved HYPO; crystal, X-RAY crysta 90.21
2z06_A252 Putative uncharacterized protein TTHA0625; metal b 87.29
>1z2w_A Vacuolar protein sorting 29; VPS29, retromer, phosphatase, manganese, protein transport; 2.00A {Mus musculus} SCOP: d.159.1.7 PDB: 1z2x_A 3lh6_A 3lh7_A 3psn_A 3pso_A 1w24_A 2r17_A Back     alignment and structure
Probab=99.97  E-value=7.5e-29  Score=183.97  Aligned_cols=139  Identities=60%  Similarity=1.084  Sum_probs=124.9

Q ss_pred             cHhHHHHhhCCCeEEEeCCCCCCCCCCceEEEEECCEEEEEEcCCCCCCCCCHHHHHHHHhhCCCCEEEECCccCeeEEE
Q 032130            2 EVHDYLKSLCPDLHVTRGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKAYK   81 (147)
Q Consensus         2 e~l~~l~~~~~~~~~V~GN~D~~~~lP~~~~~~~~g~~i~~~Hg~~~~~~~~~~~l~~~~~~~~~diii~GHtH~p~~~~   81 (147)
                      ++++.|+++..++++|+||||....+|....+++++.+|+++||++..++.+.+.+.+++++.++|++++||||.+....
T Consensus        54 ~~~~~l~~~~~~~~~v~GNhD~~~~lp~~~~~~~~~~~i~l~Hg~~~~~~~~~~~l~~~~~~~~~d~vi~GHtH~~~~~~  133 (192)
T 1z2w_A           54 ESYDYLKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGLIHGHQVIPWGDMASLALLQRQFDVDILISGHTHKFEAFE  133 (192)
T ss_dssp             HHHHHHHHHCSEEEECCCTTCCCTTSCSEEEEEETTEEEEEECSCCCCBTTCHHHHHHHHHHHSSSEEECCSSCCCEEEE
T ss_pred             HHHHHHHhcCCCEEEEcCCcCccccCCcceEEEECCEEEEEECCCcCCCCCCHHHHHHHHHhcCCCEEEECCcCcCccEe
Confidence            56788888876799999999998899999999999999999999998877777888888877899999999999999888


Q ss_pred             ECCEEEEcCCCCCCCCCCCCCCCCCeEEEEEEeCCEEEEEEEEecCCeEeeeEEEEeec
Q 032130           82 HEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDFKKT  140 (147)
Q Consensus        82 ~~~~~~iNpGS~g~p~~~~~~~~~~~y~il~~~~~~~~v~~~~~~~~~~~~~~~~~~~~  140 (147)
                      .++++++||||++.|+.+++..+.++|+++++++++++++++.+++++++++++.|+|.
T Consensus       134 ~~~~~~inpGS~~~~~~~~~~~~~~~y~il~~~~~~~~~~~~~~~~~~~~v~~~~~~~~  192 (192)
T 1z2w_A          134 HENKFYINPGSATGAYNALETNIIPSFVLMDIQASTVVTYVYQLIGDDVKVERIEYKKS  192 (192)
T ss_dssp             ETTEEEEECCCTTCCCCSSCSCCCCEEEEEEEETTEEEEEEEEEETTEEEEEEEEEECC
T ss_pred             ECCEEEEECCcccccCCCCCcCCCCcEEEEEEECCEEEEEEEEccCCEEEEEEEEEccC
Confidence            89999999999999765455567899999999999999999999999999999999873
>2a22_A Vacuolar protein sorting 29; alpha-beta-BETA-alpha sandwich, structural genomics, structural genomics consortium, SGC, protein transport; 2.20A {Cryptosporidium parvum} SCOP: d.159.1.7 Back     alignment and structure
>3ck2_A Conserved uncharacterized protein (predicted phosphoesterase COG0622); structural genomics, predicted phosphodiesterase, PSI-2; HET: SRT; 2.30A {Streptococcus pneumoniae} SCOP: d.159.1.7 Back     alignment and structure
>3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A* Back     alignment and structure
>2kkn_A Uncharacterized protein; protein phosphatase 2A homologue, structural genomics, PSI- 2, protein structure initiative; NMR {Thermotoga maritima} Back     alignment and structure
>1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A Back     alignment and structure
>3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} SCOP: d.159.1.0 Back     alignment and structure
>1s3l_A Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC struc funded by NIH; 2.40A {Methanocaldococcus jannaschii} SCOP: d.159.1.7 PDB: 1s3m_A 1s3n_A 2ahd_A Back     alignment and structure
>1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} SCOP: d.159.1.7 Back     alignment and structure
>1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6 Back     alignment and structure
>3ib7_A ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, HYDR; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A Back     alignment and structure
>1xm7_A Hypothetical protein AQ_1665; structural genomics, protein structure initi midwest center for structural genomics, PSI, MCSG, unknown; 2.40A {Aquifex aeolicus} SCOP: d.159.1.8 Back     alignment and structure
>3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A Back     alignment and structure
>2yvt_A Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national PROJ protein structural and functional analyses; 1.60A {Aquifex aeolicus} SCOP: d.159.1.6 Back     alignment and structure
>1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 Back     alignment and structure
>2xmo_A LMO2642 protein; phosphodiesterase, hydrolase; 1.70A {Listeria monocytogenes} Back     alignment and structure
>3av0_A DNA double-strand break repair protein MRE11; DNA repair, calcineurin-like phosphoesterase, ABC transporte domain-like; HET: DNA AGS; 3.10A {Methanocaldococcus jannaschii} PDB: 3auz_A* Back     alignment and structure
>1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A* Back     alignment and structure
>3tho_B Exonuclease, putative; adenosine triphosphate, bacterial proteins, DNA breaks, DOUB stranded, DNA repair, DNA repair enzymes; HET: ADP; 2.61A {Thermotoga maritima} PDB: 3qg5_C Back     alignment and structure
>3rl5_A Metallophosphoesterase mpped2; alpha-beta fold, metallophosphodiesterase, active site mutan nucleotide polymorphism, hydrolase; 1.26A {Rattus norvegicus} PDB: 3rl3_A* 3rl4_A* Back     alignment and structure
>4fbk_A DNA repair and telomere maintenance protein NBS1, protein RAD32 chimeric protein; DNA double-strand break repair, nuclease; HET: DNA; 2.38A {Schizosaccharomyces pombe} PDB: 4fbq_A* Back     alignment and structure
>4fbw_A DNA repair protein RAD32; DNA double-strand break repair, nuclease, hydrolase; HET: DNA; 2.20A {Schizosaccharomyces pombe} PDB: 4fcx_B* Back     alignment and structure
>2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12 Back     alignment and structure
>3tgh_A Glideosome-associated protein 50; phosphatase fold, NOT A phosphatase, motor protein, structur protein, membrane protein; 1.70A {Plasmodium falciparum 3D7} Back     alignment and structure
>2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} Back     alignment and structure
>3t1i_A Double-strand break repair protein MRE11A; DNA repair, MRN complex, metallophosphatase, exonuclease, endonuclease, RAD50, NBS1, hydrolase; 3.00A {Homo sapiens} Back     alignment and structure
>1ii7_A MRE11 nuclease; RAD50, DNA double-strand break repair, DAMP, manganese, replication; HET: DA; 2.20A {Pyrococcus furiosus} SCOP: d.159.1.4 PDB: 3dsc_A* 3dsd_A* 1s8e_A Back     alignment and structure
>2q8u_A Exonuclease, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.20A {Thermotoga maritima MSB8} PDB: 3thn_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Back     alignment and structure
>2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A Back     alignment and structure
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Back     alignment and structure
>1hp1_A 5'-nucleotidase; metallophosphatase, dinuclear, metalloenzyme, hydrolase, domain movement; HET: ATP; 1.70A {Escherichia coli} SCOP: d.114.1.1 d.159.1.2 PDB: 1ush_A 2ush_A 1hpu_A* 1ho5_A* 1oi8_A 1oid_A 1oie_A Back     alignment and structure
>3qfk_A Uncharacterized protein; structural genomics, center for structural genomics of infec diseases, csgid, phosphoesterase, hydrolase; HET: MSE AKG; 2.05A {Staphylococcus aureus subsp} Back     alignment and structure
>3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} SCOP: d.159.1.3 PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A Back     alignment and structure
>2wdc_A SOXB, sulfur oxidation protein SOXB; sulfur-sulfur hydrolysis, sulfur oxidation pathway, Cys S-thiosulfonate, hydrolase; 1.50A {Thermus thermophilus} PDB: 2wdd_A* 2wde_A 2wdf_A Back     alignment and structure
>2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A} Back     alignment and structure
>2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* Back     alignment and structure
>3gve_A YFKN protein; alpha-beta-BETA-alpha sandwich, structural genomics, PSI-2, structure initiative; HET: CIT; 1.25A {Bacillus subtilis subsp} Back     alignment and structure
>3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3jyf_A 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- nucleotidase bifunctional periplasmic...; APC63187.2; HET: EPE TAM; 2.43A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} SCOP: d.159.1.3 PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3v4y_A* 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* Back     alignment and structure
>3ive_A Nucleotidase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: CTN; 1.70A {Escherichia coli O6} PDB: 3ivd_A* Back     alignment and structure
>1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 Back     alignment and structure
>3ztv_A NAD nucleotidase, NADN; hydrolase, NAD pyrophosphatase, NMN nucleotidase, periplasmi enzyme, CD73; HET: ADN; 1.30A {Haemophilus influenzae} PDB: 3zu0_A* Back     alignment and structure
>1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 Back     alignment and structure
>4h2g_A 5'-nucleotidase; dimer, hydrolase, phosphatase, extracellular; HET: ADN; 1.55A {Homo sapiens} PDB: 4h2f_A* 4h1y_P* 4h2i_A* 4h1s_A* 4h2b_A* Back     alignment and structure
>2z1a_A 5'-nucleotidase; metal-binding, nucleotide-binding, hydrolase, structural genomics, NPPSFA; HET: THM; 1.75A {Thermus thermophilus} SCOP: d.114.1.1 d.159.1.2 Back     alignment and structure
>3c9f_A 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, protein STR initiative, PSI-2, NEW YORK SGX research center for structu genomics, nysgxrc; 1.90A {Candida albicans} SCOP: d.114.1.1 d.159.1.2 Back     alignment and structure
>2yeq_A Apased, PHOD, alkaline phosphatase D; hydrolase, phosphodiesterase; HET: PE5; 1.93A {Bacillus subtilis} Back     alignment and structure
>3flo_A DNA polymerase alpha subunit B; protein-protein complex, phosphoesterase fold, OB fold, zinc motif, DNA replication, nucleus; HET: DNA; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4h1s_A 5'-nucleotidase; hydrolase; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
>3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A Back     alignment and structure
>1t70_A Phosphatase; crystal, X-RAY crystallography, structural GENO berkeley structural genomics center, BSGC, PSI, protein STR initiative; 2.30A {Deinococcus radiodurans} SCOP: d.159.1.9 Back     alignment and structure
>1t71_A Phosphatase, conserved HYPO; crystal, X-RAY crystallography, structural GENO berkeley structural genomics center, BSGC, PSI; 2.10A {Mycoplasma pneumoniae M129} SCOP: d.159.1.9 Back     alignment and structure
>2z06_A Putative uncharacterized protein TTHA0625; metal binding protein, structural genomics, NPPSFA; 2.20A {Thermus thermophilus} SCOP: d.159.1.10 PDB: 2cv9_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 147
d2a22a1193 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, V 3e-41
d1z2wa1182 d.159.1.7 (A:1-182) Vacuolar protein sorting 29, V 1e-40
d3ck2a1173 d.159.1.7 (A:1-173) Uncharacterized protein SP1879 1e-19
d1su1a_184 d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia 4e-14
d1s3la_165 d.159.1.7 (A:) Putative phosphodiesterase MJ0936 { 8e-14
>d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]} Length = 193 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: YfcE-like
domain: Vacuolar protein sorting 29, VPS29
species: Cryptosporidium parvum [TaxId: 5807]

 Score =  134 bits (337), Expect = 3e-41
 Identities = 62/147 (42%), Positives = 94/147 (63%), Gaps = 9/147 (6%)

Query: 2   EVHDYLKSLCPDLHVTRGEYDED---------SRYPETKTLTIGQFKLGICHGHQVIPWG 52
           E  + LK++  ++++  G+ D             +PE   + IG+FK+G+ HG+QV+PW 
Sbjct: 47  EYVEMLKNITKNVYIVSGDLDSAIFNPDPESNGVFPEYVVVQIGEFKIGLMHGNQVLPWD 106

Query: 53  DLDSLAMLQRQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMD 112
           D  SL   QR+LD DILVTGHTH+ + ++  G + +NPG+ATGA+S+ T D  PSF+LM 
Sbjct: 107 DPGSLEQWQRRLDCDILVTGHTHKLRVFEKNGKLFLNPGTATGAFSALTPDAPPSFMLMA 166

Query: 113 IDGLRVVVYVYELIDGEVKVDKIDFKK 139
           + G +VV+YVY+L DG+  V   +F K
Sbjct: 167 LQGNKVVLYVYDLRDGKTNVAMSEFSK 193
>d1z2wa1 d.159.1.7 (A:1-182) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]} Length = 182 Back     information, alignment and structure
>d3ck2a1 d.159.1.7 (A:1-173) Uncharacterized protein SP1879 {Streptococcus pneumoniae [TaxId: 1313]} Length = 173 Back     information, alignment and structure
>d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} Length = 184 Back     information, alignment and structure
>d1s3la_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]} Length = 165 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query147
d1z2wa1182 Vacuolar protein sorting 29, VPS29 {Mouse (Mus mus 100.0
d2a22a1193 Vacuolar protein sorting 29, VPS29 {Cryptosporidiu 100.0
d3ck2a1173 Uncharacterized protein SP1879 {Streptococcus pneu 99.97
d1s3la_165 Putative phosphodiesterase MJ0936 {Methanococcus j 99.92
d1nnwa_251 Hypothetical protein PF1291 {Archaeon Pyrococcus f 99.83
d1su1a_184 Phosphodiesterase yfcE {Escherichia coli [TaxId: 5 99.8
d1uf3a_228 Hypothetical protein TT1561 {Thermus thermophilus 99.56
d2yvta1257 Uncharacterized protein Aq_1956 {Aquifex aeolicus 99.56
d2hy1a1256 Rv0805 cyclic nucleotide phosphodiesterase {Mycoba 99.02
d3d03a1271 Glycerophosphodiesterase GpdQ {Enterobacter aeroge 98.91
d1xm7a_188 Hypothetical protein aq_1666 {Aquifex aeolicus [Ta 98.81
d2nxfa1320 Uncharacterized C17orf48 homolog zgc:64213 {Zebraf 98.69
d1g5ba_219 lambda ser/thr protein phosphatase {Bacteriophage 98.62
d1utea_302 Mammalian purple acid phosphatase {Pig (Sus scrofa 98.58
d1ii7a_333 Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 98.52
d1usha2337 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 97.87
d2qfra2312 Plant purple acid phosphatase, catalytic domain {K 97.75
d2z1aa2302 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 96.04
d1s95a_324 Serine/threonine protein phosphatase 5, PP5 {Human 94.97
d1jk7a_294 Protein phosphatase-1 (PP-1) {Human (Homo sapiens) 94.2
d3c5wc1288 Protein phosphatase 2A catalytic subunit alpha iso 92.56
d3c9fa2322 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 92.44
d1auia_ 473 Protein phosphatase-2B (PP-2B, calcineurin A subun 91.44
d2qfra2312 Plant purple acid phosphatase, catalytic domain {K 88.34
>d1z2wa1 d.159.1.7 (A:1-182) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: YfcE-like
domain: Vacuolar protein sorting 29, VPS29
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=100.00  E-value=1.1e-34  Score=213.46  Aligned_cols=139  Identities=60%  Similarity=1.084  Sum_probs=130.5

Q ss_pred             cHhHHHHhhCCCeEEEeCCCCCCCCCCceEEEEECCEEEEEEcCCCCCCCCCHHHHHHHHhhCCCCEEEECCccCeeEEE
Q 032130            2 EVHDYLKSLCPDLHVTRGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKAYK   81 (147)
Q Consensus         2 e~l~~l~~~~~~~~~V~GN~D~~~~lP~~~~~~~~g~~i~~~Hg~~~~~~~~~~~l~~~~~~~~~diii~GHtH~p~~~~   81 (147)
                      |++++|+++++++++|+||||....+|....++++|.+|+++||+...++.+.+.+.+++++.++|+++|||||.|.+..
T Consensus        44 e~l~~l~~~~~~v~~V~GN~D~~~~~p~~~~~~~~g~~i~~~Hg~~~~~~~~~~~l~~~~~~~~~divi~GHTH~p~~~~  123 (182)
T d1z2wa1          44 ESYDYLKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGLIHGHQVIPWGDMASLALLQRQFDVDILISGHTHKFEAFE  123 (182)
T ss_dssp             HHHHHHHHHCSEEEECCCTTCCCTTSCSEEEEEETTEEEEEECSCCCCBTTCHHHHHHHHHHHSSSEEECCSSCCCEEEE
T ss_pred             hhHHHHHhhCCceEEEeCCcCcccccceEEEEEEcCcEEEEEeCCCCCCCCCHHHHHHHHhccCCCEEEECCcCcceEEE
Confidence            78999999987899999999999999999999999999999999999888889999999999999999999999999999


Q ss_pred             ECCEEEEcCCCCCCCCCCCCCCCCCeEEEEEEeCCEEEEEEEEecCCeEeeeEEEEeec
Q 032130           82 HEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDFKKT  140 (147)
Q Consensus        82 ~~~~~~iNpGS~g~p~~~~~~~~~~~y~il~~~~~~~~v~~~~~~~~~~~~~~~~~~~~  140 (147)
                      .+++++|||||+|.|+.....++.+||++++++++++.+.++++++++++++++.|+|.
T Consensus       124 ~~~~~~iNPGSv~~pr~~~~~~~~~syaild~~~~~v~~~~~~l~~~~v~~~~~~~~~~  182 (182)
T d1z2wa1         124 HENKFYINPGSATGAYNALETNIIPSFVLMDIQASTVVTYVYQLIGDDVKVERIEYKKS  182 (182)
T ss_dssp             ETTEEEEECCCTTCCCCSSCSCCCCEEEEEEEETTEEEEEEEEEETTEEEEEEEEEECC
T ss_pred             ECCEEEEeCCCCCCCCCCCCCCCCCEEEEEEEeCCEEEEEEEEecCCcEEEEEEEEEcC
Confidence            99999999999999975555677899999999999999999999999999999999984
>d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d3ck2a1 d.159.1.7 (A:1-173) Uncharacterized protein SP1879 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1s3la_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2hy1a1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3d03a1 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]} Back     information, alignment and structure
>d1xm7a_ d.159.1.8 (A:) Hypothetical protein aq_1666 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ii7a_ d.159.1.4 (A:) Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1usha2 d.159.1.2 (A:26-362) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2z1aa2 d.159.1.2 (A:28-329) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} Back     information, alignment and structure
>d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c9fa2 d.159.1.2 (A:16-337) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Candida albicans [TaxId: 5476]} Back     information, alignment and structure
>d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure