Citrus Sinensis ID: 032185

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-----
MASKKEMEVVRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWSDGKRGSIEGTAYKADPKSDEAKLKILCREPHMDEAIYNQLVEKATSEGYDVSKLHRTPQSDNPPEAEESPQDTKGIWWIKSIFGK
cccccccccccccccccccEEEEEEEEEccccccccccccEEEEEEcccccEEEEEEEEEcccEEEEEEEEEEccccccccEEEEEcccccccHHHHHHHHHHHHHcccccccEEEcccccccccccccccccccEEEEEEcccc
cccccccEEEccccHHHHcccEEEEHccccccccccccEEEEEEEEcccccEEEEEcEcccccEcEEEEEEEEccccccHcHEEEEcccccccHHHHHHHHHHHHHccccHHHcEEcccccccccccccccccccHHHEHHHccc
MASKKEMEVVRGLDIKRYMGRWyeiasfpsrnqpkngadtratytlnedgtvhvrnetwsdgkrgsiegtaykadpksdeAKLKIlcrephmdEAIYNQLVEKatsegydvsklhrtpqsdnppeaeespqdtkgIWWIKSIFGK
maskkemevvrgldikryMGRWYEIasfpsrnqpkngadtratytlnedgtvhvrnetwsdgkrgsiegtaykadpksdeAKLKILCREPHMDEAIYNQLVEKATSEGYDVSKlhrtpqsdnppeaeespqdtkgiwwiKSIFGK
MASKKEMEVVRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWSDGKRGSIEGTAYKADPKSDEAKLKILCREPHMDEAIYNQLVEKATSEGYDVSKLHRTPQSDNPPEAEESPQDTKGIWWIKSIFGK
********VVRGLDIKRYMGRWYEIASF*******************************************************KILCREPHMDEAIYNQLV*********************************GIWWIKSIF**
*****EM**VRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWSDGKRGSIEGTAYKADPKSDEAKLKILCREPHMDEAIYNQLVEKATSEGYDVSKLHRTPQ**************KGIWWIKSIFG*
*********VRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWSDGKRGSIEGTAYKADPKSDEAKLKILCREPHMDEAIYNQLVEKATSEGYDVSKLHR***************DTKGIWWIKSIFGK
*****EMEVVRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWSDGKRGSIEGTAYKADPKSDEAKLKILCREPHMDEAIYNQLVEKATSEGYDVSKLHRTPQS************TKGIWWIKSIFGK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASKKEMEVVRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWSDGKRGSIEGTAYKADPKSDEAKLKILCREPHMDEAIYNQLVEKATSEGYDVSKLHRTPQSDNPPEAEESPQDTKGIWWIKSIFGK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query145 2.2.26 [Sep-21-2011]
Q5URA7169 Putative lipocalin R877 O N/A no 0.779 0.668 0.315 7e-10
Q46036177 Outer membrane lipoprotei N/A no 0.744 0.610 0.308 1e-07
P0A901177 Outer membrane lipoprotei N/A no 0.751 0.615 0.282 1e-06
P0A902177 Outer membrane lipoprotei N/A no 0.751 0.615 0.282 1e-06
P05090189 Apolipoprotein D OS=Homo yes no 0.510 0.391 0.371 3e-06
P51910189 Apolipoprotein D OS=Mus m no no 0.772 0.592 0.261 3e-06
P23593189 Apolipoprotein D OS=Rattu yes no 0.510 0.391 0.371 5e-06
P37153189 Apolipoprotein D OS=Oryct yes no 0.510 0.391 0.358 4e-05
Q32KY0189 Apolipoprotein D OS=Bos t yes no 0.510 0.391 0.358 5e-05
P51909189 Apolipoprotein D OS=Cavia yes no 0.510 0.391 0.371 0.0001
>sp|Q5URA7|YR877_MIMIV Putative lipocalin R877 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R877 PE=1 SV=1 Back     alignment and function desciption
 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 48/152 (31%), Positives = 67/152 (44%), Gaps = 39/152 (25%)

Query: 3   SKKEMEVVRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWSDG 62
           SK+++     LDI+RYMG WYEIA  P+  Q K   ++ A Y L E   + V N    +G
Sbjct: 18  SKRDVVSQSSLDIQRYMGTWYEIARLPTSFQ-KGCVNSTANYQLLEPNKIQVTNNCEING 76

Query: 63  KRGSIEGTAYKA----------DPKS-----------------DEA-----------KLK 84
           +  S+ GTA  A           P S                 DE             L 
Sbjct: 77  RINSVTGTAIPAANTRIVSGFLTPASLMVNFGYGFSPYNVIFIDENYQYAIVSGGNDTLW 136

Query: 85  ILCREPHMDEAIYNQLVEKATSEGYDVSKLHR 116
           IL R  +++++ YNQLV    ++GYDV+ L R
Sbjct: 137 ILSRFKNINQSTYNQLVTIVYNQGYDVNNLIR 168
Could play a role in the transport of a small ligand.
Acanthamoeba polyphaga (taxid: 5757)
>sp|Q46036|BLC_CITFR Outer membrane lipoprotein blc OS=Citrobacter freundii PE=3 SV=1 Back     alignment and function description
>sp|P0A901|BLC_ECOLI Outer membrane lipoprotein blc OS=Escherichia coli (strain K12) GN=blc PE=1 SV=1 Back     alignment and function description
>sp|P0A902|BLC_ECO57 Outer membrane lipoprotein blc OS=Escherichia coli O157:H7 GN=blc PE=3 SV=1 Back     alignment and function description
>sp|P05090|APOD_HUMAN Apolipoprotein D OS=Homo sapiens GN=APOD PE=1 SV=1 Back     alignment and function description
>sp|P51910|APOD_MOUSE Apolipoprotein D OS=Mus musculus GN=Apod PE=2 SV=1 Back     alignment and function description
>sp|P23593|APOD_RAT Apolipoprotein D OS=Rattus norvegicus GN=Apod PE=1 SV=1 Back     alignment and function description
>sp|P37153|APOD_RABIT Apolipoprotein D OS=Oryctolagus cuniculus GN=APOD PE=2 SV=1 Back     alignment and function description
>sp|Q32KY0|APOD_BOVIN Apolipoprotein D OS=Bos taurus GN=APOD PE=2 SV=1 Back     alignment and function description
>sp|P51909|APOD_CAVPO Apolipoprotein D OS=Cavia porcellus GN=APOD PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query145
77744899186 temperature-induced lipocalin [Citrus si 1.0 0.779 0.779 5e-74
255565025187 apolipoprotein d, putative [Ricinus comm 0.993 0.770 0.648 3e-59
77744905185 temperature-induced lipocalin [Populus t 0.993 0.778 0.639 1e-58
77744871185 temperature-induced lipocalin' [Populus 0.993 0.778 0.639 1e-58
350539918185 temperature-induced lipocalin' [Solanum 0.986 0.772 0.619 3e-58
77744903185 temperature-induced lipocalin [Populus t 0.993 0.778 0.629 8e-58
224143988185 predicted protein [Populus trichocarpa] 0.993 0.778 0.629 9e-58
209967467185 temperature-induced lipocalin [Populus e 0.993 0.778 0.639 9e-58
118489127185 unknown [Populus trichocarpa x Populus d 0.986 0.772 0.632 1e-57
77744901185 temperature-induced lipocalin [Populus b 0.993 0.778 0.623 3e-57
>gi|77744899|gb|ABB02403.1| temperature-induced lipocalin [Citrus sinensis] Back     alignment and taxonomy information
 Score =  281 bits (720), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 145/186 (77%), Positives = 145/186 (77%), Gaps = 41/186 (22%)

Query: 1   MASKKEMEVVRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWS 60
           MASKKEMEVVRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWS
Sbjct: 1   MASKKEMEVVRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWS 60

Query: 61  DGKRGSIEGTAYKADPKSDEAKLK------------------------------------ 84
           DGKRGSIEGTAYKADPKSDEAKLK                                    
Sbjct: 61  DGKRGSIEGTAYKADPKSDEAKLKVKFYVPPFFPIIPVVGNYWVLYIDDNYQYALIGEPT 120

Query: 85  -----ILCREPHMDEAIYNQLVEKATSEGYDVSKLHRTPQSDNPPEAEESPQDTKGIWWI 139
                ILCREPHMDEAIYNQLVEKATSEGYDVSKLHRTPQSDNPPEAEESPQDTKGIWWI
Sbjct: 121 RKYLWILCREPHMDEAIYNQLVEKATSEGYDVSKLHRTPQSDNPPEAEESPQDTKGIWWI 180

Query: 140 KSIFGK 145
           KSIFGK
Sbjct: 181 KSIFGK 186

Source: Citrus sinensis

Species: Citrus sinensis

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255565025|ref|XP_002523505.1| apolipoprotein d, putative [Ricinus communis] gi|223537212|gb|EEF38844.1| apolipoprotein d, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|77744905|gb|ABB02406.1| temperature-induced lipocalin [Populus tremula x Populus tremuloides] Back     alignment and taxonomy information
>gi|77744871|gb|ABB02389.1| temperature-induced lipocalin' [Populus balsamifera] gi|209967465|gb|ACJ02357.1| temperature-induced lipocalin [Populus tremula x Populus alba] Back     alignment and taxonomy information
>gi|350539918|ref|NP_001234832.1| temperature-induced lipocalin' [Solanum lycopersicum] gi|77744859|gb|ABB02383.1| temperature-induced lipocalin' [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|77744903|gb|ABB02405.1| temperature-induced lipocalin [Populus tremuloides] Back     alignment and taxonomy information
>gi|224143988|ref|XP_002325147.1| predicted protein [Populus trichocarpa] gi|118489173|gb|ABK96393.1| unknown [Populus trichocarpa x Populus deltoides] gi|222866581|gb|EEF03712.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|209967467|gb|ACJ02358.1| temperature-induced lipocalin [Populus euphratica] Back     alignment and taxonomy information
>gi|118489127|gb|ABK96370.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
>gi|77744901|gb|ABB02404.1| temperature-induced lipocalin [Populus balsamifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query145
TAIR|locus:2155831186 TIL "temperature-induced lipoc 0.586 0.456 0.823 2.9e-58
MGI|MGI:88056189 Apod "apolipoprotein D" [Mus m 0.510 0.391 0.371 6.8e-13
UNIPROTKB|Q74AM6185 GSU2326 "Outer membrane lipopr 0.510 0.4 0.371 2.2e-12
TIGR_CMR|GSU_2326185 GSU_2326 "outer membrane lipop 0.510 0.4 0.371 2.2e-12
UNIPROTKB|P0A901177 blc [Escherichia coli K-12 (ta 0.517 0.423 0.379 2.2e-12
UNIPROTKB|G3QHM6200 APOD "Uncharacterized protein" 0.510 0.37 0.371 7.4e-12
DICTYBASE|DDB_G0269882182 DDB_G0269882 "lipocalin family 0.468 0.373 0.388 7.4e-12
UNIPROTKB|Q0BZJ9182 HNE_2399 "Lipocalin-like lipop 0.558 0.445 0.395 9.3e-12
UNIPROTKB|P05090189 APOD "Apolipoprotein D" [Homo 0.510 0.391 0.371 1.2e-11
UNIPROTKB|C9JF17215 APOD "Apolipoprotein D" [Homo 0.510 0.344 0.371 2.5e-11
TAIR|locus:2155831 TIL "temperature-induced lipocalin" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 384 (140.2 bits), Expect = 2.9e-58, Sum P(2) = 2.9e-58
 Identities = 70/85 (82%), Positives = 78/85 (91%)

Query:     1 MASKKEMEVVRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWS 60
             M  KKEMEVV+GL+++RYMGRWYEIASFPSR QPKNG DTRATYTLN DGT+HV NETWS
Sbjct:     1 MTEKKEMEVVKGLNVERYMGRWYEIASFPSRFQPKNGVDTRATYTLNPDGTIHVLNETWS 60

Query:    61 DGKRGSIEGTAYKADPKSDEAKLKI 85
             +GKRG IEG+AYKADPKSDEAKLK+
Sbjct:    61 NGKRGFIEGSAYKADPKSDEAKLKV 85
GO:0005215 "transporter activity" evidence=IEA;ISS
GO:0005576 "extracellular region" evidence=ISM
GO:0006810 "transport" evidence=IEA;ISS
GO:0009409 "response to cold" evidence=IEP
GO:0005739 "mitochondrion" evidence=IDA
GO:0005773 "vacuole" evidence=IDA
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0009416 "response to light stimulus" evidence=IMP
GO:0009408 "response to heat" evidence=IMP
GO:0042538 "hyperosmotic salinity response" evidence=IMP
GO:0005829 "cytosol" evidence=RCA
GO:0009506 "plasmodesma" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=IDA
MGI|MGI:88056 Apod "apolipoprotein D" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q74AM6 GSU2326 "Outer membrane lipoprotein, lipocalin family" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2326 GSU_2326 "outer membrane lipoprotein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|P0A901 blc [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|G3QHM6 APOD "Uncharacterized protein" [Gorilla gorilla gorilla (taxid:9595)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0269882 DDB_G0269882 "lipocalin family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q0BZJ9 HNE_2399 "Lipocalin-like lipoprotein" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] Back     alignment and assigned GO terms
UNIPROTKB|P05090 APOD "Apolipoprotein D" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|C9JF17 APOD "Apolipoprotein D" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_Genewise1_v1.C_LG_XVIII3287
hypothetical protein (185 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.XV.984.1
hypothetical protein (283 aa)
•       0.487
gw1.II.4176.1
SubName- Full=Putative uncharacterized protein; (163 aa)
•       0.434
eugene3.179700001
Predicted protein (56 aa)
      • 0.415

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query145
pfam08212140 pfam08212, Lipocalin_2, Lipocalin-like domain 2e-37
COG3040174 COG3040, Blc, Bacterial lipocalin [Cell envelope b 3e-17
PRK10477177 PRK10477, PRK10477, outer membrane lipoprotein Blc 5e-12
>gnl|CDD|116798 pfam08212, Lipocalin_2, Lipocalin-like domain Back     alignment and domain information 
 Score =  123 bits (312), Expect = 2e-37
 Identities = 55/142 (38%), Positives = 66/142 (46%), Gaps = 37/142 (26%)

Query: 13  LDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETW-SDGKRGSIEGTA 71
           +D+ RYMG WYEIA  P R + +   D  ATYTL +DGT+ V N     DGK  + EG A
Sbjct: 1   VDLSRYMGTWYEIARLPMRFE-RGCVDVTATYTLRDDGTIAVTNRCRTPDGKWKTAEGKA 59

Query: 72  YKADPKSDEAKLK----------------------------------ILCREPHMDEAIY 97
             ADP S  AKLK                                  IL R P + +  Y
Sbjct: 60  KVADPGS-NAKLKVSFFGPFKGDYWVLYLDPDYSWALVGSPDRDYLWILSRTPQLSDEQY 118

Query: 98  NQLVEKATSEGYDVSKLHRTPQ 119
            QL+ KA  +GYDVSKL   PQ
Sbjct: 119 EQLLAKARDQGYDVSKLIWVPQ 140

Lipocalins are transporters for small hydrophobic molecules, such as lipids, steroid hormones, bilins, and retinoids. The structure is an eight-stranded beta barrel. Length = 140
>gnl|CDD|225582 COG3040, Blc, Bacterial lipocalin [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|182489 PRK10477, PRK10477, outer membrane lipoprotein Blc; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 145
KOG4824224 consensus Apolipoprotein D/Lipocalin [Cell wall/me 100.0
PF08212143 Lipocalin_2: Lipocalin-like domain; InterPro: IPR0 99.97
COG3040174 Blc Bacterial lipocalin [Cell envelope biogenesis, 99.96
PRK10477177 outer membrane lipoprotein Blc; Provisional 99.96
PF07137198 VDE: Violaxanthin de-epoxidase (VDE); InterPro: IP 99.38
PF00061144 Lipocalin: Lipocalin / cytosolic fatty-acid bindin 99.21
PLN02372455 violaxanthin de-epoxidase 98.86
PF02087178 Nitrophorin: Nitrophorin; InterPro: IPR002351 Nitr 98.1
PF11032186 ApoM: Apolipoprotein M (ApoM); InterPro: IPR022734 98.05
PF03973148 Triabin: Triabin; InterPro: IPR005657 This family 94.86
PF08400134 phage_tail_N: Prophage tail fibre N-terminal; Inte 84.64
PF0035646 LacI: Bacterial regulatory proteins, lacI family; 82.4
PF15060110 PPDFL: Differentiation and proliferation regulator 81.52
>KOG4824 consensus Apolipoprotein D/Lipocalin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information 
Probab=100.00  E-value=1.2e-35  Score=220.37  Aligned_cols=144  Identities=44%  Similarity=0.724  Sum_probs=132.6

Q ss_pred             CCCCCCCcccCCCCccccceeeEEEeEeCCcCCCCCCcceEEEEEECC-CCcEEEEEeEEe--CCeeeEEeeeEEEcCCC
Q 032185            1 MASKKEMEVVRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNE-DGTVHVRNETWS--DGKRGSIEGTAYKADPK   77 (145)
Q Consensus         1 ~~~~p~v~~~~~Fdl~ry~G~WYeiar~p~~~e~~~~~c~~a~Y~~~~-~g~i~V~n~~~~--~G~~~~~~G~a~~~~~~   77 (145)
                      |+-||+++++++||++||+|+|||||++|..||... -|.+..|++.. ||.|.|.|.|+.  +|....++|.|++++++
T Consensus        30 lg~cpnypv~knFnv~RylGrWYEVas~p~~fe~~~-gctt~~y~~~nkngkI~Vln~~v~r~dG~~n~ieG~atpvn~~  108 (224)
T KOG4824|consen   30 LGECPNYPVAKNFNVERYLGRWYEVASFPRGFEGKG-GCTTGAYTFDNKNGKIHVLNECVHRPDGKINFIEGKATPVNED  108 (224)
T ss_pred             eccCCCCccccCCChhhhcceeeeeeccccccccCC-CceeeeeEecCCCceEEEeeeeeecCCCccceeeeeeeecCCc
Confidence            678999999999999999999999999999999874 59999998874 999999999994  99999999999999866


Q ss_pred             CCcceeE------------------------------------------------EeecCCCCCHHHHHHHHHHHHhcCC
Q 032185           78 SDEAKLK------------------------------------------------ILCREPHMDEAIYNQLVEKATSEGY  109 (145)
Q Consensus        78 ~~~~kl~------------------------------------------------IlsR~p~l~~~~~~~~~~~~~~~G~  109 (145)
                      .+.+.++                                                ||||+|++.++.++++.++|.+.|+
T Consensus       109 s~k~e~kf~~~~p~~~~~~l~~~~iy~Vl~tdyenya~~ysc~alisl~h~df~wIlsRtpn~epEt~~klkn~l~~~gy  188 (224)
T KOG4824|consen  109 SDKAELKFEFQEPIFEKCFLRFPPIYFVLGTDYENYADDYSCHALISLKHKDFLWILSRTPNMEPETIAKLKNKLAEEGY  188 (224)
T ss_pred             hhhhcceeEEecCchHhhccCCCCCcceecccHhheeccccccceeccCCCceEEEEecCCCCChHHHHHHHHHHHHcCC
Confidence            3323222                                                9999999999999999999999999


Q ss_pred             CCCCeEEcCCCCCCCCcCCCCCCCCceeEEeeccCC
Q 032185          110 DVSKLHRTPQSDNPPEAEESPQDTKGIWWIKSIFGK  145 (145)
Q Consensus       110 d~~~l~~~~q~~c~~~~~~~~~~~~~~~~~~~~~~~  145 (145)
                      |+++|..++|++|+++..+++.|.||.||-||+|||
T Consensus       189 DpeKl~~Tpq~dcp~~s~~~~~~~~~~~~~~sl~~~  224 (224)
T KOG4824|consen  189 DPEKLHDTPQSDCPPESAEAAADMKGPGMEKSLFGK  224 (224)
T ss_pred             CHHHhccCCccCCChhhhhhHHhccCcchhhhhccC
Confidence            999999999999999999999999999999999997

>PF08212 Lipocalin_2: Lipocalin-like domain; InterPro: IPR000566 Proteins which transport small hydrophobic molecules such as steroids, bilins, retinoids, and lipids share limited regions of sequence homology and a common tertiary structure architecture [, , , , ] Back     alignment and domain information
>COG3040 Blc Bacterial lipocalin [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10477 outer membrane lipoprotein Blc; Provisional Back     alignment and domain information
>PF07137 VDE: Violaxanthin de-epoxidase (VDE); InterPro: IPR010788 This family represents a conserved region approximately 350 residues long within plant violaxanthin de-epoxidase (VDE) Back     alignment and domain information
>PF00061 Lipocalin: Lipocalin / cytosolic fatty-acid binding protein family fatty acid-binding protein signature lipocalin signature; InterPro: IPR000566 Proteins which transport small hydrophobic molecules such as steroids, bilins, retinoids, and lipids share limited regions of sequence homology and a common tertiary structure architecture [, , , , ] Back     alignment and domain information
>PLN02372 violaxanthin de-epoxidase Back     alignment and domain information
>PF02087 Nitrophorin: Nitrophorin; InterPro: IPR002351 Nitrophorins are haemoproteins found in saliva of blood-feeding insects [, ] Back     alignment and domain information
>PF11032 ApoM: Apolipoprotein M (ApoM); InterPro: IPR022734 ApoM is a 25 kDa plasma protein associated with high-density lipoproteins (HDLs) Back     alignment and domain information
>PF03973 Triabin: Triabin; InterPro: IPR005657 This family contains saliva proteins from haematophagous insects that counteract vertebrate host haemostasis events such as coagulation, vasoconstriction and platelet aggregation [] Back     alignment and domain information
>PF08400 phage_tail_N: Prophage tail fibre N-terminal; InterPro: IPR013609 This entry represents the N terminus of phage 933W tail fibre protein Back     alignment and domain information
>PF00356 LacI: Bacterial regulatory proteins, lacI family; InterPro: IPR000843 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PF15060 PPDFL: Differentiation and proliferation regulator Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query145
3mbt_A168 Structure Of Monomeric Blc From E. Coli Length = 16 5e-08
2aco_A173 Xray Structure Of Blc Dimer In Complex With Vacceni 1e-07
1qwd_A177 Crystal Structure Of A Bacterial Lipocalin, The Blc 1e-07
2hzq_A174 Crystal Structure Of Human Apolipoprotein D (Apod) 1e-06
3ebw_A163 Crystal Structure Of Major Allergens, Per A 4 From 3e-04
>pdb|3MBT|A Chain A, Structure Of Monomeric Blc From E. Coli Length = 168 Back     alignment and structure 
Iteration: 1

 Score = 53.1 bits (126), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 67/165 (40%), Gaps = 39/165 (23%)
Query: 5   KEMEVVRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWSD--G 62
           + + VV   D KRY+G WYEIA F  R + +      ATY+L +DG ++V N+ ++   G
Sbjct: 8   RGVTVVNNFDAKRYLGTWYEIARFDHRFE-RGLEKVTATYSLRDDGGLNVINKGYNPDRG 66
Query: 63  KRGSIEGTAYKADPKS---------------------------------DEAKLKILCRE 89
                EG AY     +                                 D   L IL R 
Sbjct: 67  MWQQSEGKAYFTGAPTRAALKVSFFGPFYGGYNVIALDREYRHALVSGPDRDYLWILSRT 126
Query: 90  PHMDEAIYNQLVEKATSEGYDVSKLHRTPQSDNPPEAEESPQDTK 134
           P + + +  +++  AT EG+DVSK     Q   P  A   PQ  K
Sbjct: 127 PTISDEVKQEMLAVATREGFDVSKFIWVQQ---PGSAWSHPQFEK 168
>pdb|2ACO|A Chain A, Xray Structure Of Blc Dimer In Complex With Vaccenic Acid Length = 173 Back     alignment and structure
>pdb|1QWD|A Chain A, Crystal Structure Of A Bacterial Lipocalin, The Blc Gene Product From E. Coli Length = 177 Back     alignment and structure
>pdb|2HZQ|A Chain A, Crystal Structure Of Human Apolipoprotein D (Apod) In Complex With Progesterone Length = 174 Back     alignment and structure
>pdb|3EBW|A Chain A, Crystal Structure Of Major Allergens, Per A 4 From Cockroaches Length = 163 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query145
3ebw_A163 PER A 4 allergen; beta barrel, cockroach; HET: PE4 2e-33
2hzq_A174 Apolipoprotein D, APO-D, APOD; lipocalin, beta bar 5e-31
1qwd_A177 Outer membrane lipoprotein BLC; bacterial lipocali 5e-28
1i4u_A181 Crustacyanin; lipocalin fold, antiparallel beta ba 4e-27
3fmz_A212 Retinol-binding protein 4; disease mutation, secre 4e-26
1gka_B174 Crustacyanin A2 subunit; lipocalin, lobster, astax 9e-25
1z24_A189 Insecticyanin A form; blue biliprotein, INS-A, chr 1e-23
1kt6_A183 RBP, plasma retinol-binding protein; transport pro 2e-22
1kxo_A184 DIGA16; lipocalin, anticalin, genetical engineerin 1e-21
1epa_A164 Epididymal retinoic acid-binding protein; 2.10A {R 4e-15
3bx8_A178 Engineered human lipocalin 2; protein design, liga 9e-14
2xst_A161 Lipocalin 15; transport protein, LCN15, MSFL2541; 2e-12
3cbc_A198 Neutrophil gelatinase-associated lipocalin; sidero 3e-12
2l5p_A184 Lipocalin 12; beta barrel, transport protein; NMR 8e-12
3o22_A162 Prostaglandin-H2 D-isomerase; lipocalin, prostagla 5e-10
3s26_A190 Neutrophil gelatinase-associated lipocalin; beta-b 8e-10
1ew3_A159 Allergen EQU C 1; lipocalin, beta barrel; 2.30A {E 3e-09
1gm6_A175 SAL, salivary lipocalin; odorant-binding protein; 8e-09
1lf7_A182 Complement protein C8gamma; lipocalin, beta barrel 4e-08
3qkg_A193 Protein AMBP; beta barrel, binding protein, bound 8e-08
2a2u_A181 Protein (alpha-2U-globulin); lipid binding protein 8e-08
3sao_A160 Extracellular fatty acid-binding protein; beta-bar 7e-05
1beb_A162 Beta-lactoglobulin; lipocalin, MILK WHEY protein, 1e-04
3kff_A162 MUP 4, major urinary protein 4; pheromone, lipocal 6e-04
>3ebw_A PER A 4 allergen; beta barrel, cockroach; HET: PE4; 2.80A {Periplaneta americana} Length = 163 Back     alignment and structure
 Score =  114 bits (286), Expect = 2e-33
 Identities = 27/157 (17%), Positives = 47/157 (29%), Gaps = 38/157 (24%)

Query: 6   EMEVVRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWSDGKRG 65
                 GLD+ +Y+G WYE+   P+ ++          YTL+E+G + V +  +++  RG
Sbjct: 6   IGTSFTGLDMTKYVGTWYELFRTPNSDEEDFTNCEYDKYTLDENGVIQVTSVAYTNSIRG 65

Query: 66  SIEGTAYKADPKSDEAKLK--------------------------------------ILC 87
            I  T        D   +                                       I  
Sbjct: 66  FITSTGTVPSWTEDTFDIAYGDDETWSSTYFMVGTDYQTYSIVAGCLDNDYSRHLYWIAS 125

Query: 88  REPHMDEAIYNQLVEKATSEGYDVSKLHRTPQSDNPP 124
            E   D+A   ++ E        +  +    QS    
Sbjct: 126 HETSFDDATKAKVNEVLAPYNLSLDDMEPVDQSYCVQ 162
>2hzq_A Apolipoprotein D, APO-D, APOD; lipocalin, beta barrel, bilin-binding protein, transport protein; HET: STR; 1.80A {Homo sapiens} PDB: 2hzr_A Length = 174 Back     alignment and structure
>1qwd_A Outer membrane lipoprotein BLC; bacterial lipocalin, lipid binding protein; 1.75A {Escherichia coli} SCOP: b.60.1.1 PDB: 2aco_A* 3mbt_A Length = 177 Back     alignment and structure
>1i4u_A Crustacyanin; lipocalin fold, antiparallel beta barrel, transport protein; 1.15A {Synthetic} SCOP: b.60.1.1 PDB: 1obq_A 1obu_A 1s2p_A 1h91_A 1gka_A 1s44_A Length = 181 Back     alignment and structure
>3fmz_A Retinol-binding protein 4; disease mutation, secreted, sensory transduction, transport, vision, vitamin A, transport protein; HET: 2T1; 2.90A {Homo sapiens} Length = 212 Back     alignment and structure
>1gka_B Crustacyanin A2 subunit; lipocalin, lobster, astaxanthin, bathochromic, coloration; HET: AXT D12 EPE; 3.23A {Homarus gammarus} SCOP: b.60.1.1 Length = 174 Back     alignment and structure
>1z24_A Insecticyanin A form; blue biliprotein, INS-A, chromophore binding., lipid binding protein; HET: BLV; 2.60A {Manduca sexta} SCOP: b.60.1.1 Length = 189 Back     alignment and structure
>1kt6_A RBP, plasma retinol-binding protein; transport protein; HET: RTL; 1.10A {Bos taurus} SCOP: b.60.1.1 PDB: 1erb_A* 1fem_A* 1fen_A* 1hbp_A* 1fel_A* 1kt4_A* 1kt3_A* 1kt7_A* 1hbq_A 1aqb_A* 1kt5_A* 1rlb_E* 1rbp_A* 1brq_A 1brp_A* 1jyd_A 1jyj_A 2wqa_E* 3bsz_E* 1qab_E* ... Length = 183 Back     alignment and structure
>1kxo_A DIGA16; lipocalin, anticalin, genetical engineering, digoxigenin, ligand binding protein; 1.80A {Pieris brassicae} SCOP: b.60.1.1 PDB: 1lke_A* 1lnm_A* 1n0s_A* 1t0v_A 1bbp_A* Length = 184 Back     alignment and structure
>1epa_A Epididymal retinoic acid-binding protein; 2.10A {Rattus norvegicus} SCOP: b.60.1.1 PDB: 1epb_A* Length = 164 Back     alignment and structure
>3bx8_A Engineered human lipocalin 2; protein design, ligand binding protein, de novo protein, protein binding; HET: 1PE PE5; 2.00A {Homo sapiens} PDB: 3bx7_A* 3dtq_A 3dsz_A* 1l6m_A* 3tf6_A* 1x71_A* 1x89_A* 1x8u_A* 3fw4_A 3fw5_A 3k3l_A* 3pec_A* 3ped_A* 3tzs_A* 1ngl_A 1dfv_A* 1qqs_A* Length = 178 Back     alignment and structure
>2xst_A Lipocalin 15; transport protein, LCN15, MSFL2541; 1.63A {Homo sapiens} Length = 161 Back     alignment and structure
>3cbc_A Neutrophil gelatinase-associated lipocalin; siderocalin, NGAL, enterobactin, glycoprotein, pyrroli carboxylic acid, secreted; HET: DBS; 2.17A {Homo sapiens} PDB: 3hwg_A* 3hwf_A* 3hwe_A* 3u03_A* 3u0d_A* 3cmp_A* 3i0a_A* 3hwd_A 3t1d_A* 3by0_A* Length = 198 Back     alignment and structure
>2l5p_A Lipocalin 12; beta barrel, transport protein; NMR {Rattus norvegicus} Length = 184 Back     alignment and structure
>3o22_A Prostaglandin-H2 D-isomerase; lipocalin, prostaglandin synthase; HET: OLA PLM; 1.40A {Homo sapiens} PDB: 3o19_A* 3o2y_A* 2wwp_A 2czt_A 2czu_A 2rq0_A 2e4j_A 2ktd_A* Length = 162 Back     alignment and structure
>3s26_A Neutrophil gelatinase-associated lipocalin; beta-barrel, siderophore binding protein, N-linked glycosyla secreted, transport protein; HET: NAG BMA MAN; 1.80A {Mus musculus} PDB: 2k23_A Length = 190 Back     alignment and structure
>1ew3_A Allergen EQU C 1; lipocalin, beta barrel; 2.30A {Equus caballus} SCOP: b.60.1.1 Length = 159 Back     alignment and structure
>1gm6_A SAL, salivary lipocalin; odorant-binding protein; HET: NAG; 2.13A {Sus scrofa} SCOP: b.60.1.1 Length = 175 Back     alignment and structure
>1lf7_A Complement protein C8gamma; lipocalin, beta barrel, calyx, MAC, immune system; HET: CIT; 1.20A {Homo sapiens} SCOP: b.60.1.1 PDB: 1iw2_A* 2ovd_A* 2ove_A 2ova_A 2rd7_C 3ojy_C* 2qos_C Length = 182 Back     alignment and structure
>3qkg_A Protein AMBP; beta barrel, binding protein, bound chromophore, human plasm system; 2.30A {Homo sapiens} Length = 193 Back     alignment and structure
>2a2u_A Protein (alpha-2U-globulin); lipid binding protein; 2.50A {Rattus norvegicus} SCOP: b.60.1.1 PDB: 2a2g_A Length = 181 Back     alignment and structure
>3sao_A Extracellular fatty acid-binding protein; beta-barrel, siderophore binding protein, transport protein; HET: NKN DBH; 1.80A {Gallus gallus} PDB: 1jzu_A 2kt4_B* 2lbv_A* Length = 160 Back     alignment and structure
>1beb_A Beta-lactoglobulin; lipocalin, MILK WHEY protein, bovine, retinol-binding; 1.80A {Bos taurus} SCOP: b.60.1.1 PDB: 3nq3_A* 1b0o_A 1bsq_A 1gx8_A* 1gx9_A* 1gxa_A* 2gj5_A* 2r56_A* 3npo_A 1b8e_A* 3nq9_A* 3qzj_A* 3qzk_A* 3ueu_A* 3uev_A* 3uew_A* 3uex_A* 4dq3_A* 4dq4_A* 1qg5_A ... Length = 162 Back     alignment and structure
>3kff_A MUP 4, major urinary protein 4; pheromone, lipocalin, beta barrel, DI bond, pheromone-binding, secreted, transport, transport Pro; 0.96A {Mus musculus} PDB: 3kfg_A 3kfh_A 3kfi_A 2l9c_A 2lb6_A 1i06_A 1i05_A* 1i04_A 1mup_A 1znd_A 1qy0_A* 1qy2_A* 1qy1_A 1zne_A 1zng_A 1znh_A 1znk_A* 1znl_A* 2dm5_A* 2ozq_A ... Length = 162 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query145
3ebw_A163 PER A 4 allergen; beta barrel, cockroach; HET: PE4 100.0
2hzq_A174 Apolipoprotein D, APO-D, APOD; lipocalin, beta bar 99.97
1qwd_A177 Outer membrane lipoprotein BLC; bacterial lipocali 99.97
1gka_B174 Crustacyanin A2 subunit; lipocalin, lobster, astax 99.95
1z24_A189 Insecticyanin A form; blue biliprotein, INS-A, chr 99.95
3fmz_A212 Retinol-binding protein 4; disease mutation, secre 99.94
1gm6_A175 SAL, salivary lipocalin; odorant-binding protein; 99.94
1kxo_A184 DIGA16; lipocalin, anticalin, genetical engineerin 99.94
3s26_A190 Neutrophil gelatinase-associated lipocalin; beta-b 99.94
3cbc_A198 Neutrophil gelatinase-associated lipocalin; sidero 99.94
1kt6_A183 RBP, plasma retinol-binding protein; transport pro 99.94
1i4u_A181 Crustacyanin; lipocalin fold, antiparallel beta ba 99.94
3bx8_A178 Engineered human lipocalin 2; protein design, liga 99.94
2xst_A161 Lipocalin 15; transport protein, LCN15, MSFL2541; 99.93
2l5p_A184 Lipocalin 12; beta barrel, transport protein; NMR 99.93
1bj7_A156 D 2; allergen, lipocalin; 1.80A {Bos taurus} SCOP: 99.93
1xki_A162 VON ebner'S gland protein; beta barrel, ligand bin 99.93
1ew3_A159 Allergen EQU C 1; lipocalin, beta barrel; 2.30A {E 99.93
1epa_A164 Epididymal retinoic acid-binding protein; 2.10A {R 99.92
1lf7_A182 Complement protein C8gamma; lipocalin, beta barrel 99.92
3o22_A162 Prostaglandin-H2 D-isomerase; lipocalin, prostagla 99.92
2ra6_A166 Trichosurin; lipocalin, beta barrel, glycoprotein, 99.91
2hlv_A160 Odorant-binding protein; domain swapping, transpor 99.91
1exs_A160 Beta-lactoglobulin; lipocalin fold, lipid-binding 99.91
1beb_A162 Beta-lactoglobulin; lipocalin, MILK WHEY protein, 99.91
1dzk_A157 PIG OBP, odorant-binding protein; lipocalin, trans 99.91
2a2u_A181 Protein (alpha-2U-globulin); lipid binding protein 99.9
1e5p_A151 Aphrodisin; lipocalin, pheromone, hamster,; HET: M 99.89
3qkg_A193 Protein AMBP; beta barrel, binding protein, bound 99.88
3kff_A162 MUP 4, major urinary protein 4; pheromone, lipocal 99.86
3sao_A160 Extracellular fatty acid-binding protein; beta-bar 99.84
3l4r_A170 Allergen DOG 2, minor allergen CAN F 2; lipocalin 99.8
3kq0_A192 Alpha-1-acid glycoprotein 1; plasma protein, polym 99.73
3fiq_A157 OBP1, RCG36470, odorant-binding protein 1F; lipoca 99.65
1pm1_X180 Nitrophorin 2, NP2, prolixin-S; beta barrel, lipoc 99.64
3ebk_A176 Allergen BLA G 4; beta barrel, cockroach, glycopro 99.6
1x8p_A184 Nitrophorin 4, NP4; lipocalin, beta barrel, ferric 99.57
4ge1_A197 Biogenic amine-binding protein; lipocalin binding 99.56
3cqn_A185 Violaxanthin DE-epoxidase, chloroplast; lipocalin, 99.49
3bx6_A192 Alpha-1-acid glycoprotein; plasma protein, acute p 99.4
1avg_I142 Triabin; bovine thrombin, thrombin inhibitor, comp 99.24
2yg2_A172 Apolipoprotein M; lipid transport, lipocalin, HDL; 97.93
>3ebw_A PER A 4 allergen; beta barrel, cockroach; HET: PE4; 2.80A {Periplaneta americana} Back     alignment and structure
Probab=100.00  E-value=3.5e-33  Score=204.10  Aligned_cols=120  Identities=21%  Similarity=0.311  Sum_probs=109.2

Q ss_pred             CCCCCCcccCCCCccccceeeEEEeEeCCcCCCCCCcceEEEEEECCCCcEEEEEeEEeCCeee-EEeeeEEEcCCCCCc
Q 032185            2 ASKKEMEVVRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWSDGKRG-SIEGTAYKADPKSDE   80 (145)
Q Consensus         2 ~~~p~v~~~~~Fdl~ry~G~WYeiar~p~~~e~~~~~c~~a~Y~~~~~g~i~V~n~~~~~G~~~-~~~G~a~~~~~~~~~   80 (145)
                      +.||+++++++||++||+|+||||||+|+.||++|.+|++++|++.+||.|.|.|+| ++|.+. .+.|.|+++++. .+
T Consensus         2 ~~Cp~v~~~~~fdl~ry~G~WYeiar~~~~fe~~~~~~~~a~Y~l~~dg~i~V~n~~-~~g~~~~~~~G~a~~~~~~-~~   79 (163)
T 3ebw_A            2 DSCQIGTSFTGLDMTKYVGTWYELFRTPNSDEEDFTNCEYDKYTLDENGVIQVTSVA-YTNSIRGFITSTGTVPSWT-ED   79 (163)
T ss_dssp             CSCCCCCCCCCCCTTTTCEEEEEEEECCCSTTSSCCSCEEEEEEECTTSCEEEEEEE-ECSTTSSEEEEEEECCCBC-SS
T ss_pred             CCCcCCCccCCCChHHhCEEeEEEEEeCcccccCcCccceEEEEECCCCeEEEEEEe-eCCeEEEEEEEEEEeCCCC-CC
Confidence            579999999999999999999999999999999754899999999999999999999 689898 999999887654 23


Q ss_pred             ceeE----------------------------------------EeecCCCCCHHHHHHHHHHHHhcCCCCCCeEEcCCC
Q 032185           81 AKLK----------------------------------------ILCREPHMDEAIYNQLVEKATSEGYDVSKLHRTPQS  120 (145)
Q Consensus        81 ~kl~----------------------------------------IlsR~p~l~~~~~~~~~~~~~~~G~d~~~l~~~~q~  120 (145)
                      | |+                                        ||||+|+++++++++++++++++||+.++|++++|+
T Consensus        80 ~-l~v~f~~~~~~~~~y~Vl~tDY~~Ya~v~~c~~~~~~~~~~wilsR~~~l~~~~~~~~~~~~~~~G~~~~~l~~~~q~  158 (163)
T 3ebw_A           80 T-FDIAYGDDETWSSTYFMVGTDYQTYSIVAGCLDNDYSRHLYWIASHETSFDDATKAKVNEVLAPYNLSLDDMEPVDQS  158 (163)
T ss_dssp             E-EEEBC------CEEEEEEEECSSSCEEEEEEETTEEEEEEEEEEESSSSCCHHHHHHHHHHHGGGTCCGGGSEECCCC
T ss_pred             c-eEEEeccCCCccccEEEEEeCCCCEEEEEEecCCCccceEEEEEeCCCCCCHHHHHHHHHHHHHcCCCHHHeEECCCC
Confidence            3 32                                        999999999999999999999999999999999999


Q ss_pred             CCCC
Q 032185          121 DNPP  124 (145)
Q Consensus       121 ~c~~  124 (145)
                      +|..
T Consensus       159 ~C~~  162 (163)
T 3ebw_A          159 YCVQ  162 (163)
T ss_dssp             TTTT
T ss_pred             CCCC
Confidence            9964
>2hzq_A Apolipoprotein D, APO-D, APOD; lipocalin, beta barrel, bilin-binding protein, transport protein; HET: STR; 1.80A {Homo sapiens} PDB: 2hzr_A Back     alignment and structure
>1qwd_A Outer membrane lipoprotein BLC; bacterial lipocalin, lipid binding protein; 1.75A {Escherichia coli} SCOP: b.60.1.1 PDB: 2aco_A* 3mbt_A Back     alignment and structure
>1gka_B Crustacyanin A2 subunit; lipocalin, lobster, astaxanthin, bathochromic, coloration; HET: AXT D12 EPE; 3.23A {Homarus gammarus} SCOP: b.60.1.1 Back     alignment and structure
>1z24_A Insecticyanin A form; blue biliprotein, INS-A, chromophore binding., lipid binding protein; HET: BLV; 2.60A {Manduca sexta} SCOP: b.60.1.1 Back     alignment and structure
>3fmz_A Retinol-binding protein 4; disease mutation, secreted, sensory transduction, transport, vision, vitamin A, transport protein; HET: 2T1; 2.90A {Homo sapiens} Back     alignment and structure
>1gm6_A SAL, salivary lipocalin; odorant-binding protein; HET: NAG; 2.13A {Sus scrofa} SCOP: b.60.1.1 Back     alignment and structure
>1kxo_A DIGA16; lipocalin, anticalin, genetical engineering, digoxigenin, ligand binding protein; 1.80A {Pieris brassicae} SCOP: b.60.1.1 PDB: 1lke_A* 1lnm_A* 1n0s_A* 1t0v_A 1bbp_A* Back     alignment and structure
>3s26_A Neutrophil gelatinase-associated lipocalin; beta-barrel, siderophore binding protein, N-linked glycosyla secreted, transport protein; HET: NAG BMA MAN; 1.80A {Mus musculus} SCOP: b.60.1.1 PDB: 2k23_A Back     alignment and structure
>3cbc_A Neutrophil gelatinase-associated lipocalin; siderocalin, NGAL, enterobactin, glycoprotein, pyrroli carboxylic acid, secreted; HET: DBS; 2.17A {Homo sapiens} PDB: 3hwg_A* 3hwf_A* 3hwe_A* 3u03_A* 3u0d_A* 3cmp_A* 3i0a_A* 3hwd_A 3t1d_A* 3by0_A* Back     alignment and structure
>1kt6_A RBP, plasma retinol-binding protein; transport protein; HET: RTL; 1.10A {Bos taurus} SCOP: b.60.1.1 PDB: 1erb_A* 1fem_A* 1fen_A* 1hbp_A* 1fel_A* 1kt4_A* 1kt3_A* 1kt7_A* 1hbq_A 1aqb_A* 1kt5_A* 1rlb_E* 1rbp_A* 1brq_A 1brp_A* 1jyd_A 1jyj_A 2wqa_E* 3bsz_E* 1qab_E* ... Back     alignment and structure
>1i4u_A Crustacyanin; lipocalin fold, antiparallel beta barrel, transport protein; 1.15A {Synthetic} SCOP: b.60.1.1 PDB: 1obq_A 1obu_A 1s2p_A 1h91_A 1gka_A 1s44_A Back     alignment and structure
>3bx8_A Engineered human lipocalin 2; protein design, ligand binding protein, de novo protein, protein binding; HET: 1PE PE5; 2.00A {Homo sapiens} PDB: 3bx7_A* 3dtq_A 3dsz_A* 1l6m_A* 3tf6_A* 1x71_A* 1x89_A* 1x8u_A* 3fw4_A 3fw5_A 3k3l_A* 3pec_A* 3ped_A* 3tzs_A* 1ngl_A 1dfv_A* 1qqs_A* Back     alignment and structure
>2xst_A Lipocalin 15; transport protein, LCN15, MSFL2541; 1.63A {Homo sapiens} Back     alignment and structure
>2l5p_A Lipocalin 12; beta barrel, transport protein; NMR {Rattus norvegicus} Back     alignment and structure
>1bj7_A D 2; allergen, lipocalin; 1.80A {Bos taurus} SCOP: b.60.1.1 Back     alignment and structure
>1xki_A VON ebner'S gland protein; beta barrel, ligand binding protein, transport protein; 1.80A {Homo sapiens} SCOP: b.60.1.1 PDB: 3eyc_A Back     alignment and structure
>1ew3_A Allergen EQU C 1; lipocalin, beta barrel; 2.30A {Equus caballus} SCOP: b.60.1.1 Back     alignment and structure
>1epa_A Epididymal retinoic acid-binding protein; 2.10A {Rattus norvegicus} SCOP: b.60.1.1 PDB: 1epb_A* Back     alignment and structure
>1lf7_A Complement protein C8gamma; lipocalin, beta barrel, calyx, MAC, immune system; HET: CIT; 1.20A {Homo sapiens} SCOP: b.60.1.1 PDB: 1iw2_A* 2ovd_A* 2ove_A 2ova_A 2rd7_C 3ojy_C* 2qos_C Back     alignment and structure
>3o22_A Prostaglandin-H2 D-isomerase; lipocalin, prostaglandin synthase; HET: OLA PLM; 1.40A {Homo sapiens} PDB: 3o19_A* 3o2y_A* 2wwp_A 2czt_A 2czu_A 2rq0_A 2e4j_A 2ktd_A* Back     alignment and structure
>2ra6_A Trichosurin; lipocalin, beta barrel, glycoprotein, MILK protein, secreted, transport, transport protein; 1.50A {Trichosurus vulpecula} PDB: 2r73_A 2r74_A Back     alignment and structure
>2hlv_A Odorant-binding protein; domain swapping, transport protein; HET: LIK; 1.65A {Bos taurus} PDB: 1gt1_A* 1gt3_A* 1gt4_A* 1gt5_A* 1hn2_A* 1obp_A 1g85_A 1pbo_A* Back     alignment and structure
>1exs_A Beta-lactoglobulin; lipocalin fold, lipid-binding protein; 2.39A {Sus scrofa} SCOP: b.60.1.1 Back     alignment and structure
>1beb_A Beta-lactoglobulin; lipocalin, MILK WHEY protein, bovine, retinol-binding; 1.80A {Bos taurus} SCOP: b.60.1.1 PDB: 3nq3_A* 1b0o_A 1bsq_A 1gx8_A* 1gx9_A* 1gxa_A* 2gj5_A* 2r56_A* 3npo_A 1b8e_A* 3nq9_A* 3qzj_A* 3qzk_A* 3ueu_A* 3uev_A* 3uew_A* 3uex_A* 4dq3_A* 4dq4_A* 1qg5_A ... Back     alignment and structure
>1dzk_A PIG OBP, odorant-binding protein; lipocalin, transport, olfaction, sensory transduction; HET: PRZ; 1.48A {Sus scrofa} SCOP: b.60.1.1 PDB: 1dzj_A* 1dzm_A* 1dzp_A* 1e00_A* 1e02_A* 1e06_A* 1hqp_A* 1a3y_A Back     alignment and structure
>2a2u_A Protein (alpha-2U-globulin); lipid binding protein; 2.50A {Rattus norvegicus} SCOP: b.60.1.1 PDB: 2a2g_A Back     alignment and structure
>1e5p_A Aphrodisin; lipocalin, pheromone, hamster,; HET: MSE; 1.63A {Mesocricetus auratus} SCOP: b.60.1.1 Back     alignment and structure
>3qkg_A Protein AMBP; beta barrel, binding protein, bound chromophore, human plasm system; 2.30A {Homo sapiens} Back     alignment and structure
>3kff_A MUP 4, major urinary protein 4; pheromone, lipocalin, beta barrel, DI bond, pheromone-binding, secreted, transport, transport Pro; 0.96A {Mus musculus} SCOP: b.60.1.1 PDB: 3kfg_A 3kfh_A 3kfi_A 2l9c_A 2lb6_A 1i06_A 1i05_A* 1i04_A 1mup_A 1znd_A 1qy0_A* 1qy2_A* 1qy1_A 1zne_A 1zng_A 1znh_A 1znk_A* 1znl_A* 2dm5_A* 2ozq_A ... Back     alignment and structure
>3sao_A Extracellular fatty acid-binding protein; beta-barrel, siderophore binding protein, transport protein; HET: NKN DBH; 1.80A {Gallus gallus} SCOP: b.60.1.1 PDB: 1jzu_A 2kt4_B* 2lbv_A* Back     alignment and structure
>3l4r_A Allergen DOG 2, minor allergen CAN F 2; lipocalin allergen, disulfide bond, secreted, TRAN lipid binding protein; 1.45A {Canis familiaris} Back     alignment and structure
>3kq0_A Alpha-1-acid glycoprotein 1; plasma protein, polymorphism, acute phase protein, secreted, pyrrolidone carboxylic acid, lipocalin; 1.80A {Homo sapiens} PDB: 3apu_A* 3apv_A* 3apw_A* 3apx_A* Back     alignment and structure
>3fiq_A OBP1, RCG36470, odorant-binding protein 1F; lipocalin, oderant-binding protein, transport protein; 1.60A {Rattus norvegicus} SCOP: b.60.1.0 Back     alignment and structure
>1pm1_X Nitrophorin 2, NP2, prolixin-S; beta barrel, lipocalin, imidazole, ferric heme, blood clotting inhibitor; HET: HEM; 1.10A {Rhodnius prolixus} SCOP: b.60.1.1 PDB: 2all_X* 2amm_X* 2hys_A* 1euo_A* 1pee_A* 1t68_X* 2acp_X* 2ah7_X* 2al0_X* 2gtf_X* 2a3f_X* 2eu7_X* 2asn_X* Back     alignment and structure
>3ebk_A Allergen BLA G 4; beta barrel, cockroach, glycoprotein, secreted; 1.90A {Blattella germanica} Back     alignment and structure
>1x8p_A Nitrophorin 4, NP4; lipocalin, beta barrel, ferric heme, ligand binding protein; HET: HEM; 0.85A {Rhodnius prolixus} SCOP: b.60.1.1 PDB: 1d3s_A* 1eqd_A* 1erx_A* 1ike_A* 1ikj_A* 1d2u_A* 1ml7_A* 1np4_A* 1u0x_A* 1x8n_A* 1koi_A* 1x8o_A* 1x8q_A* 1ywa_A* 1ywb_A* 1ywc_A* 1ywd_A* 2at4_X* 2at5_X* 2at6_X* ... Back     alignment and structure
>4ge1_A Biogenic amine-binding protein; lipocalin binding protein, serotonin, norepinephrine, saliva amine-binding protein; HET: TSS; 2.15A {Rhodnius prolixus} PDB: 4get_A* 4hfo_A Back     alignment and structure
>3cqn_A Violaxanthin DE-epoxidase, chloroplast; lipocalin, enzyme, xanthophyll cycle, non photochemical quenching, NPQ, antheraxanthin, zeaxanthin; 2.00A {Arabidopsis thaliana} PDB: 3cqr_A Back     alignment and structure
>1avg_I Triabin; bovine thrombin, thrombin inhibitor, complex (blood coagulation/inhibitor); 2.60A {Triatoma pallidipennis} SCOP: b.60.1.3 Back     alignment and structure
>2yg2_A Apolipoprotein M; lipid transport, lipocalin, HDL; HET: S1P FLC; 1.70A {Homo sapiens} PDB: 2wex_A* 2wew_A* 2xkl_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 145
d1i4ua_181 b.60.1.1 (A:) Alpha-crustacyanin {European lobster 4e-26
d1qwda_167 b.60.1.1 (A:) Outer membrane lipoprotein Blc {Esch 6e-25
d1x71a1174 b.60.1.1 (A:4-177) Neutrophil gelatinase-associate 5e-21
d1lf7a_171 b.60.1.1 (A:) Complement protein C8gamma {Human (H 3e-20
d1epba_160 b.60.1.1 (A:) Retinoic acid-binding protein {Rat ( 2e-19
d1gkab_174 b.60.1.1 (B:) Alpha-crustacyanin {European lobster 1e-18
d1kt7a_175 b.60.1.1 (A:) Retinol binding protein {Cow (Bos ta 2e-18
d1kxoa_171 b.60.1.1 (A:) Bilin-binding protein {Cabbage butte 2e-17
d1z24a1189 b.60.1.1 (A:1-189) Insecticyanin {Tobacco hornworm 2e-17
d1ew3a_159 b.60.1.1 (A:) Lipocalin allergen {Horse (Equus cab 5e-17
d1gm6a_158 b.60.1.1 (A:) Salivary lipocalin {Pig (Sus scrofa) 6e-17
d1jzua_157 b.60.1.1 (A:) Lipocalin q83 {Common quail (Coturni 2e-15
d2a2ua_158 b.60.1.1 (A:) Major urinary protein/alpha-2u-globu 1e-14
d1beba_156 b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) 2e-14
d1exsa_160 b.60.1.1 (A:) beta-Lactoglobulin {Pig (Sus scrofa) 1e-13
d1znda1157 b.60.1.1 (A:1-157) Major urinary protein/alpha-2u- 5e-13
d1pm1x_180 b.60.1.1 (X:) Nitrophorin 2 (prolixin-s) {Rhodnius 4e-12
d1avgi_142 b.60.1.3 (I:) Thrombin inhibitor {Triatomine bug ( 5e-12
d1bj7a_150 b.60.1.1 (A:) Lipocalin allergen {Cow (Bos taurus) 2e-10
d1xkia_139 b.60.1.1 (A:) Von Ebner's gland protein (VEGP, tea 1e-07
d1x8qa_184 b.60.1.1 (A:) Nitrophorin 4 {Rhodnius prolixus [Ta 4e-07
d1gt1a_158 b.60.1.1 (A:) Odorant-binding protein {Cow (Bos ta 1e-05
>d1i4ua_ b.60.1.1 (A:) Alpha-crustacyanin {European lobster (Homarus gammarus) [TaxId: 6707]} Length = 181 Back     information, alignment and structure

class: All beta proteins
fold: Lipocalins
superfamily: Lipocalins
family: Retinol binding protein-like
domain: Alpha-crustacyanin
species: European lobster (Homarus gammarus) [TaxId: 6707]

 Score = 94.9 bits (235), Expect = 4e-26
 Identities = 21/166 (12%), Positives = 42/166 (25%), Gaps = 44/166 (26%)

Query: 5   KEMEVVRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWSDGKR 64
            ++   +  +   Y G WY+ A   +  Q       R  Y+ +    V        DG  
Sbjct: 18  NKLWAEQTPNRNSYAGVWYQFALTNNPYQ-LIEKCVRNEYSFDGKQFVIESTGIAYDGNL 76

Query: 65  GSIEGTAYKADPKSDEAKLK---------------------------------------- 84
               G  Y       E  L                                         
Sbjct: 77  LKRNGKLYPNPF--GEPHLSIDYENSFAAPLVILETDYSNYACLYSCIDYNFGYHSDFSF 134

Query: 85  ILCREPHMDEAIYNQLVEKATSEGYDVSKLHRTPQSDN-PPEAEES 129
           I  R  ++ +    +      +   D ++  +T Q  + P + +++
Sbjct: 135 IFSRSANLADQYVKKCEAAFKNINVDTTRFVKTVQGSSCPYDTQKT 180
>d1qwda_ b.60.1.1 (A:) Outer membrane lipoprotein Blc {Escherichia coli [TaxId: 562]} Length = 167 Back     information, alignment and structure
>d1x71a1 b.60.1.1 (A:4-177) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1lf7a_ b.60.1.1 (A:) Complement protein C8gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1epba_ b.60.1.1 (A:) Retinoic acid-binding protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 160 Back     information, alignment and structure
>d1gkab_ b.60.1.1 (B:) Alpha-crustacyanin {European lobster (Homarus gammarus) [TaxId: 6707]} Length = 174 Back     information, alignment and structure
>d1kt7a_ b.60.1.1 (A:) Retinol binding protein {Cow (Bos taurus) [TaxId: 9913]} Length = 175 Back     information, alignment and structure
>d1kxoa_ b.60.1.1 (A:) Bilin-binding protein {Cabbage butterfly (Pieris brassicae) [TaxId: 7116]} Length = 171 Back     information, alignment and structure
>d1z24a1 b.60.1.1 (A:1-189) Insecticyanin {Tobacco hornworm (Manduca sexta) [TaxId: 7130]} Length = 189 Back     information, alignment and structure
>d1ew3a_ b.60.1.1 (A:) Lipocalin allergen {Horse (Equus caballus), equ c 1 [TaxId: 9796]} Length = 159 Back     information, alignment and structure
>d1gm6a_ b.60.1.1 (A:) Salivary lipocalin {Pig (Sus scrofa) [TaxId: 9823]} Length = 158 Back     information, alignment and structure
>d1jzua_ b.60.1.1 (A:) Lipocalin q83 {Common quail (Coturnix coturnix) [TaxId: 9091]} Length = 157 Back     information, alignment and structure
>d2a2ua_ b.60.1.1 (A:) Major urinary protein/alpha-2u-globulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 158 Back     information, alignment and structure
>d1beba_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]} Length = 156 Back     information, alignment and structure
>d1exsa_ b.60.1.1 (A:) beta-Lactoglobulin {Pig (Sus scrofa) [TaxId: 9823]} Length = 160 Back     information, alignment and structure
>d1znda1 b.60.1.1 (A:1-157) Major urinary protein/alpha-2u-globulin {Mouse (Mus musculus) [TaxId: 10090]} Length = 157 Back     information, alignment and structure
>d1pm1x_ b.60.1.1 (X:) Nitrophorin 2 (prolixin-s) {Rhodnius prolixus [TaxId: 13249]} Length = 180 Back     information, alignment and structure
>d1avgi_ b.60.1.3 (I:) Thrombin inhibitor {Triatomine bug (Triatoma pallidipennis) [TaxId: 30077]} Length = 142 Back     information, alignment and structure
>d1bj7a_ b.60.1.1 (A:) Lipocalin allergen {Cow (Bos taurus), bos d 2 [TaxId: 9913]} Length = 150 Back     information, alignment and structure
>d1xkia_ b.60.1.1 (A:) Von Ebner's gland protein (VEGP, tear lipocalin) {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1x8qa_ b.60.1.1 (A:) Nitrophorin 4 {Rhodnius prolixus [TaxId: 13249]} Length = 184 Back     information, alignment and structure
>d1gt1a_ b.60.1.1 (A:) Odorant-binding protein {Cow (Bos taurus) [TaxId: 9913]} Length = 158 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query145
d1qwda_167 Outer membrane lipoprotein Blc {Escherichia coli [ 99.97
d1i4ua_181 Alpha-crustacyanin {European lobster (Homarus gamm 99.95
d1gkab_174 Alpha-crustacyanin {European lobster (Homarus gamm 99.95
d1kxoa_171 Bilin-binding protein {Cabbage butterfly (Pieris b 99.94
d1x71a1174 Neutrophil gelatinase-associated lipocalin (NGAL) 99.94
d1kt7a_175 Retinol binding protein {Cow (Bos taurus) [TaxId: 99.92
d1z24a1189 Insecticyanin {Tobacco hornworm (Manduca sexta) [T 99.92
d1lf7a_171 Complement protein C8gamma {Human (Homo sapiens) [ 99.92
d1epba_160 Retinoic acid-binding protein {Rat (Rattus norvegi 99.9
d1gm6a_158 Salivary lipocalin {Pig (Sus scrofa) [TaxId: 9823] 99.89
d1ew3a_159 Lipocalin allergen {Horse (Equus caballus), equ c 99.89
d1beba_156 beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913] 99.88
d1exsa_160 beta-Lactoglobulin {Pig (Sus scrofa) [TaxId: 9823] 99.87
d1jzua_157 Lipocalin q83 {Common quail (Coturnix coturnix) [T 99.85
d2a2ua_158 Major urinary protein/alpha-2u-globulin {Rat (Ratt 99.84
d1znda1157 Major urinary protein/alpha-2u-globulin {Mouse (Mu 99.83
d1pm1x_180 Nitrophorin 2 (prolixin-s) {Rhodnius prolixus [Tax 99.82
d1bj7a_150 Lipocalin allergen {Cow (Bos taurus), bos d 2 [Tax 99.72
d1x8qa_184 Nitrophorin 4 {Rhodnius prolixus [TaxId: 13249]} 99.71
d1xkia_139 Von Ebner's gland protein (VEGP, tear lipocalin) { 99.7
d1gt1a_158 Odorant-binding protein {Cow (Bos taurus) [TaxId: 99.65
d1avgi_142 Thrombin inhibitor {Triatomine bug (Triatoma palli 99.52
d1dzka_148 Odorant-binding protein {Pig (Sus scrofa) [TaxId: 99.4
d1e5pa_149 Aphrodisin, a sex pheromone {Golden hamster (Mesoc 99.29
d2hsga157 Glucose-resistance amylase regulator CcpA, N-termi 82.25
>d1qwda_ b.60.1.1 (A:) Outer membrane lipoprotein Blc {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All beta proteins
fold: Lipocalins
superfamily: Lipocalins
family: Retinol binding protein-like
domain: Outer membrane lipoprotein Blc
species: Escherichia coli [TaxId: 562]

Probab=99.97  E-value=6.3e-30  Score=184.16  Aligned_cols=117  Identities=37%  Similarity=0.618  Sum_probs=105.4

Q ss_pred             CCCCCcccCCCCccccceeeEEEeEeCCcCCCCCCcceEEEEEECCCCcEEEEEeEEe--CCeeeEEeeeEEEcCCCCCc
Q 032185            3 SKKEMEVVRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWS--DGKRGSIEGTAYKADPKSDE   80 (145)
Q Consensus         3 ~~p~v~~~~~Fdl~ry~G~WYeiar~p~~~e~~~~~c~~a~Y~~~~~g~i~V~n~~~~--~G~~~~~~G~a~~~~~~~~~   80 (145)
                      .||++++|+|||++||+|+|||||++|+.++..| .|+++.|++.++|.+.|.+.+..  ++....+.|.+++.+.. .+
T Consensus        15 p~~~v~~v~nFDl~rf~G~WYeia~~p~~~~~~~-~~~~~~y~~~~~~~i~v~~~~~~~~~~~~~~~~~~~~~~~~~-~~   92 (167)
T d1qwda_          15 PPRGVTVVNNFDAKRYLGTWYEIARFDHRFERGL-EKVTATYSLRDDGGLNVINKGYNPDRGMWQQSEGKAYFTGAP-TR   92 (167)
T ss_dssp             CTTCEEEESSCCHHHHCEEEEEEEECCCGGGTTC-EEEEEEEEECTTSCEEEEEEEEETTTTEEEEEEEEEEESSCT-TS
T ss_pred             CCCCCccCCCCCHHHcCeEeeEEEEcCCchhcCc-eeeEEEeeecCCCcEEEEEEEEcCCCCceEEeeeeEEeeCCC-CC
Confidence            4678999999999999999999999999999976 89999999999999999999987  66778888998887765 34


Q ss_pred             ceeE----------------------------------EeecCCCCCHHHHHHHHHHHHhcCCCCCCeEEcCCCC
Q 032185           81 AKLK----------------------------------ILCREPHMDEAIYNQLVEKATSEGYDVSKLHRTPQSD  121 (145)
Q Consensus        81 ~kl~----------------------------------IlsR~p~l~~~~~~~~~~~~~~~G~d~~~l~~~~q~~  121 (145)
                      +++.                                  ||||+|+|+++.+++++++|+++|||+++|++++|++
T Consensus        93 ~~~~~~~~~~~~~~y~v~~~d~dY~~~iv~~~~~~~~wIlsR~~~l~~~~~~~~~~~~~~~G~d~s~l~~v~Q~g  167 (167)
T d1qwda_          93 AALKVSFFGPFYGGYNVIALDREYRHALVCGPDRDYLWILSRTPTISDEVKQEMLAVATREGFDVSKFIWVQQPG  167 (167)
T ss_dssp             CEEEEEEETTEEEEEEEEEEBTTSSEEEEECSSTTCEEEEESSSSCCHHHHHHHHHHHHHTTCCGGGCEECCCCC
T ss_pred             cEEEEeccCccCCceEEEEEccCCCEEEEEecCCceEEEEEcCCCCCHHHHHHHHHHHHHhCCCHHHeEECCCCC
Confidence            4442                                  9999999999999999999999999999999999985
>d1i4ua_ b.60.1.1 (A:) Alpha-crustacyanin {European lobster (Homarus gammarus) [TaxId: 6707]} Back     information, alignment and structure
>d1gkab_ b.60.1.1 (B:) Alpha-crustacyanin {European lobster (Homarus gammarus) [TaxId: 6707]} Back     information, alignment and structure
>d1kxoa_ b.60.1.1 (A:) Bilin-binding protein {Cabbage butterfly (Pieris brassicae) [TaxId: 7116]} Back     information, alignment and structure
>d1x71a1 b.60.1.1 (A:4-177) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt7a_ b.60.1.1 (A:) Retinol binding protein {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1z24a1 b.60.1.1 (A:1-189) Insecticyanin {Tobacco hornworm (Manduca sexta) [TaxId: 7130]} Back     information, alignment and structure
>d1lf7a_ b.60.1.1 (A:) Complement protein C8gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1epba_ b.60.1.1 (A:) Retinoic acid-binding protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gm6a_ b.60.1.1 (A:) Salivary lipocalin {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ew3a_ b.60.1.1 (A:) Lipocalin allergen {Horse (Equus caballus), equ c 1 [TaxId: 9796]} Back     information, alignment and structure
>d1beba_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1exsa_ b.60.1.1 (A:) beta-Lactoglobulin {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jzua_ b.60.1.1 (A:) Lipocalin q83 {Common quail (Coturnix coturnix) [TaxId: 9091]} Back     information, alignment and structure
>d2a2ua_ b.60.1.1 (A:) Major urinary protein/alpha-2u-globulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1znda1 b.60.1.1 (A:1-157) Major urinary protein/alpha-2u-globulin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pm1x_ b.60.1.1 (X:) Nitrophorin 2 (prolixin-s) {Rhodnius prolixus [TaxId: 13249]} Back     information, alignment and structure
>d1bj7a_ b.60.1.1 (A:) Lipocalin allergen {Cow (Bos taurus), bos d 2 [TaxId: 9913]} Back     information, alignment and structure
>d1x8qa_ b.60.1.1 (A:) Nitrophorin 4 {Rhodnius prolixus [TaxId: 13249]} Back     information, alignment and structure
>d1xkia_ b.60.1.1 (A:) Von Ebner's gland protein (VEGP, tear lipocalin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gt1a_ b.60.1.1 (A:) Odorant-binding protein {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1avgi_ b.60.1.3 (I:) Thrombin inhibitor {Triatomine bug (Triatoma pallidipennis) [TaxId: 30077]} Back     information, alignment and structure
>d1dzka_ b.60.1.1 (A:) Odorant-binding protein {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1e5pa_ b.60.1.1 (A:) Aphrodisin, a sex pheromone {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2hsga1 a.35.1.5 (A:2-58) Glucose-resistance amylase regulator CcpA, N-terminal domain {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure