Citrus Sinensis ID: 032222

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-----
MADLYALDFDGVLCDSCGESSLSAVKAAKVRWPGLFDGVDSVIEDWIVDQMHILRPVVETGYENLLLVRLLLEIRMPSIRKSSVSEGLTVEGILENWSKIKPVIMEDWSENRDALVDLFGKVRDEWMDKDLTTWIGANRYFKQAF
cccEEEEEcccccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHccccccccccHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcHHHHHHccccccccc
cccEEEEEcccEEcccHHHHHHHHHHHHHHHcHHHccccccccHHHHHHHHHHcccHHcccHHHHHHHHHHHHHHcHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcHHHHHHHHHHHHHHHHHcHccHHcc
MADLYALdfdgvlcdscgessLSAVKAAKvrwpglfdgvdSVIEDWIVDQMHILRPVVETGYENLLLVRLLLEIRmpsirkssvsegltvegilenwskikpvimedwSENRDALVDLFGKVRDEWMDKDLTTWIGANRYFKQAF
madlyaldFDGVLCDSCGESSLSAVKAAKVRWPGLFDGVDSVIEDWIVDQMHILRPVVETGYENLLLVRLLLEIRMPSirkssvsegltvegilenwskikPVIMEDWSENRDALVDLFGKVRDEWMDKDLTTWIGAnryfkqaf
MADLYALDFDGVLCDSCGESSLSAVKAAKVRWPGLFDGVDSVIEDWIVDQMHILRPVVETGYENlllvrlllEIRMPSIRKSSVSEGLTVEGILENWSKIKPVIMEDWSENRDALVDLFGKVRDEWMDKDLTTWIGANRYFKQAF
***LYALDFDGVLCDSCGESSLSAVKAAKVRWPGLFDGVDSVIEDWIVDQMHILRPVVETGYENLLLVRLLLEIRMPSIRKSSVSEGLTVEGILENWSKIKPVIMEDWSENRDALVDLFGKVRDEWMDKDLTTWIGANRYF****
MADLYALDFDGVLCDSCGESSLSAVKAAKVRWPGLFDGVDSVIEDWIVDQMHILRPVVETGYENLLLVRLLLEIRMPS*R***VSEGLTVEGILENWSKIKPVIMEDWSENRDALVDLFGKVRDEWMDKDLTTWIGANRYFKQAF
MADLYALDFDGVLCDSCGESSLSAVKAAKVRWPGLFDGVDSVIEDWIVDQMHILRPVVETGYENLLLVRLLLEIRMPSIRKSSVSEGLTVEGILENWSKIKPVIMEDWSENRDALVDLFGKVRDEWMDKDLTTWIGANRYFKQAF
*ADLYALDFDGVLCDSCGESSLSAVKAAKVRWPGLFDGVDSVIEDWIVDQMHILRPVVETGYENLLLVRLLLEIRMPSIRKSSVSEGLTVEGILENWSKIKPVIMEDWSENRDALVDLFGKVRDEWMDKDLTTWIGANRYFKQAF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADLYALDFDGVLCDSCGESSLSAVKAAKVRWPGLFDGVDSVIEDWIVDQMHILRPVVETGYENLLLVRLLLEIRMPSIRKSSVSEGLTVEGILENWSKIKPVIMEDWSENRDALVDLFGKVRDEWMDKDLTTWIGANRYFKQAF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query145
358249046 268 uncharacterized protein LOC100810003 [Gl 0.972 0.526 0.794 2e-63
255541628 268 conserved hypothetical protein [Ricinus 0.972 0.526 0.858 2e-62
224127704 268 predicted protein [Populus trichocarpa] 0.972 0.526 0.858 4e-62
297824659 268 hypothetical protein ARALYDRAFT_904052 [ 0.972 0.526 0.836 1e-60
79324923 263 uncharacterized protein [Arabidopsis tha 0.972 0.536 0.836 3e-60
18406942 268 uncharacterized protein [Arabidopsis tha 0.972 0.526 0.836 3e-60
79324925210 uncharacterized protein [Arabidopsis tha 0.972 0.671 0.836 4e-60
388500274 268 unknown [Lotus japonicus] 0.972 0.526 0.808 2e-59
388520247212 unknown [Lotus japonicus] 0.972 0.665 0.808 2e-59
449441454 268 PREDICTED: uncharacterized protein LOC10 0.972 0.526 0.836 6e-59
>gi|358249046|ref|NP_001239728.1| uncharacterized protein LOC100810003 [Glycine max] gi|255647823|gb|ACU24371.1| unknown [Glycine max] Back     alignment and taxonomy information
 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 129/141 (91%)

Query: 1   MADLYALDFDGVLCDSCGESSLSAVKAAKVRWPGLFDGVDSVIEDWIVDQMHILRPVVET 60
           M +LYALDFDGV+CDSCGESSLSA+KAAKVRWPGLFDGVDS  E+WI+DQMH +RPVVET
Sbjct: 1   MGELYALDFDGVICDSCGESSLSALKAAKVRWPGLFDGVDSTTENWIIDQMHTVRPVVET 60

Query: 61  GYENLLLVRLLLEIRMPSIRKSSVSEGLTVEGILENWSKIKPVIMEDWSENRDALVDLFG 120
           GYEN+LLVRLLLE R P+IRKSSV+EGLTVEGILENWSK+KP+IME+W E RD L+DLFG
Sbjct: 61  GYENVLLVRLLLESRTPTIRKSSVAEGLTVEGILENWSKLKPIIMEEWDEKRDDLIDLFG 120

Query: 121 KVRDEWMDKDLTTWIGANRYF 141
           KVRDEW+++D  TWIGANR +
Sbjct: 121 KVRDEWLEQDFATWIGANRLY 141

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255541628|ref|XP_002511878.1| conserved hypothetical protein [Ricinus communis] gi|223549058|gb|EEF50547.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|224127704|ref|XP_002320140.1| predicted protein [Populus trichocarpa] gi|222860913|gb|EEE98455.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297824659|ref|XP_002880212.1| hypothetical protein ARALYDRAFT_904052 [Arabidopsis lyrata subsp. lyrata] gi|297326051|gb|EFH56471.1| hypothetical protein ARALYDRAFT_904052 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|79324923|ref|NP_001031546.1| uncharacterized protein [Arabidopsis thaliana] gi|330255535|gb|AEC10629.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18406942|ref|NP_566060.1| uncharacterized protein [Arabidopsis thaliana] gi|30690184|ref|NP_850443.1| uncharacterized protein [Arabidopsis thaliana] gi|3702346|gb|AAC62903.1| expressed protein [Arabidopsis thaliana] gi|15292713|gb|AAK92725.1| unknown protein [Arabidopsis thaliana] gi|20197209|gb|AAM14973.1| expressed protein [Arabidopsis thaliana] gi|21280859|gb|AAM45106.1| unknown protein [Arabidopsis thaliana] gi|222423162|dbj|BAH19560.1| AT2G45990 [Arabidopsis thaliana] gi|330255533|gb|AEC10627.1| uncharacterized protein [Arabidopsis thaliana] gi|330255534|gb|AEC10628.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|79324925|ref|NP_001031547.1| uncharacterized protein [Arabidopsis thaliana] gi|330255536|gb|AEC10630.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|388500274|gb|AFK38203.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|388520247|gb|AFK48185.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|449441454|ref|XP_004138497.1| PREDICTED: uncharacterized protein LOC101221288 [Cucumis sativus] gi|449529778|ref|XP_004171875.1| PREDICTED: uncharacterized LOC101221288 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query145
TAIR|locus:2050730 268 AT2G45990 "AT2G45990" [Arabido 0.972 0.526 0.780 7.3e-59
TAIR|locus:2050730 AT2G45990 "AT2G45990" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 604 (217.7 bits), Expect = 7.3e-59, P = 7.3e-59
 Identities = 110/141 (78%), Positives = 126/141 (89%)

Query:     1 MADLYALDFDGVLCDSCGESSLSAVKAAKVRWPGLFDGVDSVIEDWIVDQMHILRPVVET 60
             M DLYALDFDGVLCDSCGESSLSAVKAAKVRWP LF+GVDS +E+WIVDQMHI+RPVVET
Sbjct:     1 MGDLYALDFDGVLCDSCGESSLSAVKAAKVRWPDLFEGVDSALEEWIVDQMHIVRPVVET 60

Query:    61 GYENXXXXXXXXEIRMPSIRKSSVSEGLTVEGILENWSKIKPVIMEDWSENRDALVDLFG 120
             GYEN        E ++PSIRKSSV+EGLTV+GILE+W+K KPVIME W E+RDALVDLFG
Sbjct:    61 GYENLLLVRLLLETKIPSIRKSSVAEGLTVDGILESWAKFKPVIMEAWDEDRDALVDLFG 120

Query:   121 KVRDEWMDKDLTTWIGANRYF 141
             KVRD+W++KDLTTWIGANR++
Sbjct:   121 KVRDDWINKDLTTWIGANRFY 141


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.319   0.136   0.427    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      145       137   0.00091  102 3  11 22  0.43    31
                                                     30  0.45    33


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  611 (65 KB)
  Total size of DFA:  158 KB (2091 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:01
  No. of threads or processors used:  24
  Search cpu time:  12.78u 0.19s 12.97t   Elapsed:  00:00:00
  Total cpu time:  12.78u 0.19s 12.97t   Elapsed:  00:00:01
  Start:  Mon May 20 17:38:23 2013   End:  Mon May 20 17:38:24 2013
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0010207 "photosystem II assembly" evidence=RCA
GO:0010264 "myo-inositol hexakisphosphate biosynthetic process" evidence=RCA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 145
PRK13225273 phosphoglycolate phosphatase; Provisional 96.46
PRK10748238 flavin mononucleotide phosphatase; Provisional 96.29
PHA02597197 30.2 hypothetical protein; Provisional 96.07
COG0546220 Gph Predicted phosphatases [General function predi 95.8
PRK13226229 phosphoglycolate phosphatase; Provisional 95.75
PLN03243260 haloacid dehalogenase-like hydrolase; Provisional 95.75
COG0637221 Predicted phosphatase/phosphohexomutase [General f 94.93
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 94.89
TIGR02009185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 94.7
PRK13288214 pyrophosphatase PpaX; Provisional 94.54
PLN02779 286 haloacid dehalogenase-like hydrolase family protei 94.53
PRK13478 267 phosphonoacetaldehyde hydrolase; Provisional 94.23
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 94.21
TIGR01491201 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa 94.18
PRK10725188 fructose-1-P/6-phosphogluconate phosphatase; Provi 94.17
PRK13222226 phosphoglycolate phosphatase; Provisional 94.12
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 94.11
PRK09552219 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp 94.09
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 93.64
PRK10563221 6-phosphogluconate phosphatase; Provisional 93.61
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 93.56
PLN02954224 phosphoserine phosphatase 93.52
TIGR01993184 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These 93.17
PLN02575 381 haloacid dehalogenase-like hydrolase 93.14
TIGR00338219 serB phosphoserine phosphatase SerB. Phosphoserine 93.13
PRK11587218 putative phosphatase; Provisional 92.77
TIGR01990185 bPGM beta-phosphoglucomutase. The enzyme from L. l 92.59
PRK13223 272 phosphoglycolate phosphatase; Provisional 92.48
TIGR01422 253 phosphonatase phosphonoacetaldehyde hydrolase. Thi 92.38
TIGR02254224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 92.22
PLN02770248 haloacid dehalogenase-like hydrolase family protei 91.97
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 91.63
PRK01158230 phosphoglycolate phosphatase; Provisional 91.47
TIGR01489188 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent 91.25
TIGR02247211 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li 90.93
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 90.84
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 90.79
TIGR01545210 YfhB_g-proteo haloacid dehalogenase superfamily, s 90.71
TIGR01549154 HAD-SF-IA-v1 haloacid dehalogenase superfamily, su 90.58
PF06941191 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol 90.56
PRK13582205 thrH phosphoserine phosphatase; Provisional 90.0
TIGR02726169 phenyl_P_delta phenylphosphate carboxylase, delta 89.38
PRK09456199 ?-D-glucose-1-phosphatase; Provisional 89.3
PLN02940 382 riboflavin kinase 89.13
PRK11590211 hypothetical protein; Provisional 89.08
PF06888234 Put_Phosphatase: Putative Phosphatase; InterPro: I 88.63
TIGR01488177 HAD-SF-IB Haloacid Dehalogenase superfamily, subfa 88.23
PRK14988224 GMP/IMP nucleotidase; Provisional 88.07
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 88.04
KOG3120 256 consensus Predicted haloacid dehalogenase-like hyd 87.87
TIGR01509183 HAD-SF-IA-v3 haloacid dehalogenase superfamily, su 87.37
PRK06698459 bifunctional 5'-methylthioadenosine/S-adenosylhomo 87.35
PLN02423245 phosphomannomutase 87.16
PRK10976 266 putative hydrolase; Provisional 87.09
TIGR03333214 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl 86.65
TIGR01493175 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su 86.55
PF13419176 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 86.01
PRK15126 272 thiamin pyrimidine pyrophosphate hydrolase; Provis 85.99
TIGR01487215 SPP-like sucrose-phosphate phosphatase-like hydrol 85.97
TIGR01428198 HAD_type_II 2-haloalkanoic acid dehalogenase, type 85.94
PRK09449224 dUMP phosphatase; Provisional 85.46
PRK10530 272 pyridoxal phosphate (PLP) phosphatase; Provisional 84.71
COG0560212 SerB Phosphoserine phosphatase [Amino acid transpo 84.32
PRK10513 270 sugar phosphate phosphatase; Provisional 84.12
TIGR01689126 EcbF-BcbF capsule biosynthesis phosphatase. Due to 83.99
TIGR01484204 HAD-SF-IIB HAD-superfamily hydrolase, subfamily II 83.47
TIGR00685244 T6PP trehalose-phosphatase. At least 18 distinct s 83.2
PTZ00174247 phosphomannomutase; Provisional 83.18
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 83.15
TIGR01482225 SPP-subfamily Sucrose-phosphate phosphatase subfam 82.7
PRK10187 266 trehalose-6-phosphate phosphatase; Provisional 82.27
TIGR00099 256 Cof-subfamily Cof subfamily of IIB subfamily of ha 81.94
TIGR01490202 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol 81.13
PF12710192 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P 80.55
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information 
Probab=96.46  E-value=0.02  Score=47.60  Aligned_cols=26  Identities=31%  Similarity=0.373  Sum_probs=18.6

Q ss_pred             ceeEEecCccccCCchhhHHHHHHHHH
Q 032222            3 DLYALDFDGVLCDSCGESSLSAVKAAK   29 (145)
Q Consensus         3 ~llalDFDGVIcDg~~E~~~sa~~a~~   29 (145)
                      +.+.|||||||+|+..=+.. +|+.+.
T Consensus        63 k~vIFDlDGTLiDS~~~~~~-a~~~~~   88 (273)
T PRK13225         63 QAIIFDFDGTLVDSLPTVVA-IANAHA   88 (273)
T ss_pred             CEEEECCcCccccCHHHHHH-HHHHHH
Confidence            35799999999999865544 454433

>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>PLN02954 phosphoserine phosphatase Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase Back     alignment and domain information
>PLN02575 haloacid dehalogenase-like hydrolase Back     alignment and domain information
>TIGR00338 serB phosphoserine phosphatase SerB Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>TIGR01990 bPGM beta-phosphoglucomutase Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB Back     alignment and domain information
>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit Back     alignment and domain information
>PRK09456 ?-D-glucose-1-phosphatase; Provisional Back     alignment and domain information
>PLN02940 riboflavin kinase Back     alignment and domain information
>PRK11590 hypothetical protein; Provisional Back     alignment and domain information
>PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] Back     alignment and domain information
>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like Back     alignment and domain information
>PRK14988 GMP/IMP nucleotidase; Provisional Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>PLN02423 phosphomannomutase Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase Back     alignment and domain information
>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase Back     alignment and domain information
>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A Back     alignment and domain information
>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional Back     alignment and domain information
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal Back     alignment and domain information
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>PRK09449 dUMP phosphatase; Provisional Back     alignment and domain information
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10513 sugar phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase Back     alignment and domain information
>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB Back     alignment and domain information
>TIGR00685 T6PP trehalose-phosphatase Back     alignment and domain information
>PTZ00174 phosphomannomutase; Provisional Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily Back     alignment and domain information
>PRK10187 trehalose-6-phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 Back     alignment and domain information
>PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query145
3vay_A230 HAD-superfamily hydrolase; rossmann fold, haloacid 97.05
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 96.41
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 96.17
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 96.09
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 95.91
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 95.71
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 95.53
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 95.47
3k1z_A 263 Haloacid dehalogenase-like hydrolase domain-conta 95.38
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 95.25
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 95.14
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 95.09
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 95.08
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 95.04
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 95.04
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 95.04
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 95.02
1te2_A226 Putative phosphatase; structural genomics, phospha 95.0
3sd7_A240 Putative phosphatase; structural genomics, haloaci 94.92
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 94.92
3fzq_A 274 Putative hydrolase; YP_001086940.1, putative haloa 94.83
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 94.75
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 94.71
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 94.69
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 94.69
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 94.68
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 94.66
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 94.65
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 94.56
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 94.52
2hsz_A243 Novel predicted phosphatase; structural genomics, 94.36
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 94.35
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 94.35
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 94.32
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 94.3
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 94.3
3umc_A254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 94.27
3bwv_A180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 94.11
3iru_A 277 Phoshonoacetaldehyde hydrolase like protein; phosp 93.99
3umg_A254 Haloacid dehalogenase; defluorinase, hydrolase; 2. 93.99
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 93.91
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 93.9
1wr8_A231 Phosphoglycolate phosphatase; alpha / beta core do 93.86
4ap9_A201 Phosphoserine phosphatase; hydrolase, haloacid deh 93.8
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid 93.73
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 93.71
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 93.65
2p11_A231 Hypothetical protein; putative haloacid dehalogena 93.61
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 93.56
1swv_A 267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 93.53
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 93.5
2fea_A236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 93.45
2rbk_A 261 Putative uncharacterized protein; HAD-like phospha 93.39
2pq0_A 258 Hypothetical conserved protein GK1056; hyopthetica 93.32
2c4n_A 250 Protein NAGD; nucleotide phosphatase, HAD superfam 93.28
4dw8_A 279 Haloacid dehalogenase-like hydrolase; HAD, putativ 93.27
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 93.24
3mpo_A 279 Predicted hydrolase of the HAD superfamily; SGX, P 93.18
3pgv_A 285 Haloacid dehalogenase-like hydrolase; structural g 93.17
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 93.09
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 93.0
3um9_A230 Haloacid dehalogenase, type II; haloacid dehalogen 92.96
3r4c_A 268 Hydrolase, haloacid dehalogenase-like hydrolase; h 92.94
3dnp_A 290 Stress response protein YHAX; structural PSI-2, pr 92.9
1rkq_A 282 Hypothetical protein YIDA; two domain structure wi 92.88
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 92.84
1nrw_A 288 Hypothetical protein, haloacid dehalogenase-like h 92.83
1qq5_A 253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 92.6
1q92_A197 5(3)-deoxyribonucleotidase; alpha-beta rossman fol 92.57
3l7y_A 304 Putative uncharacterized protein SMU.1108C; hydrol 92.48
4gib_A250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 92.47
1rku_A206 Homoserine kinase; phosphoserine phosphatase, phos 92.4
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 92.2
2i7d_A193 5'(3')-deoxyribonucleotidase, cytosolic type; hydr 92.19
3fvv_A232 Uncharacterized protein; unknown function, structu 92.16
3gyg_A 289 NTD biosynthesis operon putative hydrolase NTDB; P 92.16
2x4d_A 271 HLHPP, phospholysine phosphohistidine inorganic py 92.09
2zg6_A220 Putative uncharacterized protein ST2620, probable 92.09
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 92.05
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 91.88
3pdw_A 266 Uncharacterized hydrolase YUTF; structural genomic 91.75
1xpj_A126 Hypothetical protein; structural genomics, MCSG, p 91.51
3umb_A233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 91.37
3skx_A 280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 91.27
2no4_A240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 91.26
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 91.22
3mn1_A189 Probable YRBI family phosphatase; structural genom 91.18
3dao_A 283 Putative phosphatse; structural genomics, joint ce 91.14
2obb_A142 Hypothetical protein; structural genomics, PSI-2, 90.92
1nf2_A 268 Phosphatase; structural proteomics, HAD NEW fold, 90.86
3mmz_A176 Putative HAD family hydrolase; structural genomics 90.53
3ij5_A211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 90.32
2ho4_A 259 Haloacid dehalogenase-like hydrolase domain contai 90.23
3f9r_A246 Phosphomannomutase; trypanosome glycobiology struc 90.17
2b30_A 301 Pvivax hypothetical protein; SGPP, structural geno 90.11
2g80_A253 Protein UTR4; YEL038W, UTR4 protein (unknown trans 89.94
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 89.58
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 89.56
1y8a_A 332 Hypothetical protein AF1437; structural genomics, 89.12
3epr_A 264 Hydrolase, haloacid dehalogenase-like family; stru 88.48
1u02_A239 Trehalose-6-phosphate phosphatase related protein; 88.42
1rlm_A 271 Phosphatase; HAD family, rossman fold, hydrolase; 88.34
2b82_A211 APHA, class B acid phosphatase; DDDD acid phosphat 88.27
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 88.2
1yv9_A 264 Hydrolase, haloacid dehalogenase family; hypotheti 88.19
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 88.03
2amy_A246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 87.93
3a1c_A 287 Probable copper-exporting P-type ATPase A; ATP-bin 87.61
2r8e_A188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 87.55
3zx4_A 259 MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd 87.4
1yns_A 261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 87.16
2fue_A 262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 87.02
1l6r_A227 Hypothetical protein TA0175; structural genomics, 85.89
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 85.75
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 85.39
1vjr_A 271 4-nitrophenylphosphatase; TM1742, structural genom 84.46
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 83.64
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural 83.51
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 83.12
1xvi_A 275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 82.59
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 82.42
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 82.16
3n1u_A191 Hydrolase, HAD superfamily, subfamily III A; struc 81.63
1s2o_A244 SPP, sucrose-phosphatase; phosphohydrolase, HAD su 80.1
>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} Back     alignment and structure
Probab=97.05  E-value=0.0051  Score=45.05  Aligned_cols=21  Identities=29%  Similarity=0.419  Sum_probs=17.4

Q ss_pred             CCceeEEecCccccCCchhhH
Q 032222            1 MADLYALDFDGVLCDSCGESS   21 (145)
Q Consensus         1 ~~~llalDFDGVIcDg~~E~~   21 (145)
                      |-++++||+|||++|+-....
T Consensus         1 mik~i~fDlDGTL~~~~~~~~   21 (230)
T 3vay_A            1 MIKLVTFDLDDTLWDTAPAIV   21 (230)
T ss_dssp             CCCEEEECCBTTTBCSHHHHH
T ss_pred             CeeEEEecCcccCcCCchHHH
Confidence            668999999999999975433
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Back     alignment and structure
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure
>2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 Back     alignment and structure
>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A Back     alignment and structure
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure
>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Back     alignment and structure
>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 Back     alignment and structure
>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query145
d2hcfa1228 Hypothetical protein CT1708 {Chlorobium tepidum [T 96.14
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 95.95
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 95.86
d2b0ca1197 Putative phosphatase YihX {Escherichia coli [TaxId 95.82
d2fdra1222 Hypothetical protein Atu0790 {Agrobacterium tumefa 95.08
d1j97a_210 Phosphoserine phosphatase {Archaeon Methanococcus 94.65
d1l6ra_225 Phosphoglycolate phosphatase, PGPase {Archaeon The 94.62
d2feaa1226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 94.23
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 94.19
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 93.85
d1u02a_229 Trehalose-6-phosphate phosphatase related protein 93.65
d1swva_ 257 Phosphonoacetaldehyde hydrolase {Bacillus cereus [ 93.63
d1o08a_221 beta-Phosphoglucomutase {Lactococcus lactis [TaxId 93.58
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 93.2
d1wr8a_230 Phosphoglycolate phosphatase, PGPase {Pyrococcus h 92.98
d2fi1a1187 Putative hydrolase SP0805 {Streptococcus pneumonia 92.91
d1nf2a_ 267 Hypothetical protein TM0651 {Thermotoga maritima [ 92.62
d1x42a1230 Hypothetical protein PH0459 {Archaeon Pyrococcus h 92.56
d1k1ea_177 Probable phosphatase YrbI {Haemophilus influenzae, 92.38
d2obba1122 Hypothetical protein BT0820 {Bacteroides thetaiota 92.37
d2amya1243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 92.13
d1xpja_124 Hypothetical protein VC0232 {Vibrio cholerae [TaxI 91.14
d1nrwa_ 285 Hypothetical protein YwpJ {Bacillus subtilis [TaxI 90.96
d1zs9a1 253 E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} 90.67
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 90.55
d1qq5a_245 L-2-Haloacid dehalogenase, HAD {Xanthobacter autot 90.36
d2g80a1225 Protein UTR4 {Baker's yeast (Saccharomyces cerevis 90.07
d1rkqa_ 271 Hypothetical protein YidA {Escherichia coli [TaxId 89.23
d1rlma_ 269 Sugar phosphatase SupH (YbiV) {Escherichia coli [T 89.15
d1rkua_206 Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta 88.82
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 88.6
d1zd3a1225 Epoxide hydrolase, N-terminal domain {Human (Homo 88.27
d1cr6a1222 Epoxide hydrolase, N-terminal domain {Mouse (Mus m 88.19
d1s2oa1244 Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 87.94
d1nnla_217 Phosphoserine phosphatase {Human (Homo sapiens) [T 87.78
d2gfha1247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 87.38
d1wzca1243 Putative mannosyl-3-phosphoglycerate phosphatase M 86.95
d1zrna_220 L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s 86.35
d2b30a1 283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 85.98
d1q92a_195 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo 85.71
d2fuea1244 Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 85.31
d1xvia_232 Putative mannosyl-3-phosphoglycerate phosphatase M 85.29
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: beta-Phosphoglucomutase-like
domain: Hypothetical protein CT1708
species: Chlorobium tepidum [TaxId: 1097]

Probab=96.14  E-value=0.0028  Score=45.61  Aligned_cols=18  Identities=28%  Similarity=0.353  Sum_probs=15.2

Q ss_pred             ceeEEecCccccCCchhh
Q 032222            3 DLYALDFDGVLCDSCGES   20 (145)
Q Consensus         3 ~llalDFDGVIcDg~~E~   20 (145)
                      +|+.|||||||+|+-.-+
T Consensus         3 klviFD~DGTL~d~~~~~   20 (228)
T d2hcfa1           3 TLVLFDIDGTLLKVESMN   20 (228)
T ss_dssp             EEEEECCBTTTEEECTHH
T ss_pred             eEEEEeCCCCcccCHHHH
Confidence            689999999999986544
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} Back     information, alignment and structure
>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure