Citrus Sinensis ID: 032238

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140----
MYGELQGLNKQETAERYGKELVHGWRRSYDIPPPNGESLEMCSKQAVAYFREHIEPQLQSGKHVMVAAHGNSLRSIIMYLDKLTSQEVINLELSTGIPLLYIYKEGRFMKRGSPVGPTEAGVYAYTETLALYRQELDEMSQRTS
cccccccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHccccccccccHHHHcccEEEEEEcHHHHHHHHHHHccccHHHHHHcccccccEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccc
ccHHHcccEHHHHHHHHcHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcHHHHHHccccEEEEEcHHHHHHHHHHHHcccccHHHHccccccccEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccc
mygelqglnkqETAERYGKELVhgwrrsydipppngesleMCSKQAVAYFREHiepqlqsgkHVMVAAHGNSLRSIIMYLDKLTSQEVINLElstgipllyiykegrfmkrgspvgpteagvYAYTETLALYRQELDEMSQRTS
mygelqglnkqeTAERYGKELVHGWRRSYDIPPPNGESLEMCSKQAVAYFREHIEPQLQSGKHVMVAAHGNSLRSIIMYLDKLTSQEVINLELSTGIPLLYIYKEGRFMKRGSPVGPTEAGVYAYTETLALYRQELDEMSQRTS
MYGELQGLNKQETAERYGKELVHGWRRSYDIPPPNGESLEMCSKQAVAYFREHIEPQLQSGKHVMVAAHGNSLRSIIMYLDKLTSQEVINLELSTGIPLLYIYKEGRFMKRGSPVGPTEAGVYAYTETLALYRQELDEMSQRTS
*******************ELVHGWRRSYD**********MCSKQAVAYFREHIEPQLQSGKHVMVAAHGNSLRSIIMYLDKLTSQEVINLELSTGIPLLYIYKEGRFMKRGSPVGPTEAGVYAYTETLALYR***********
MYGELQGLNKQETAERYGKELVHGWRRSYDIPPPNGESLEMCSKQAVAYFREHIEPQLQSGKHVMVAAHGNSLRSIIMYLDKLTSQEVINLELSTGIPLLYIYKEGRFMKRGSPVGPTEAGVYAYTETLALYRQ**********
MYGELQGLNKQETAERYGKELVHGWRRSYDIPPPNGESLEMCSKQAVAYFREHIEPQLQSGKHVMVAAHGNSLRSIIMYLDKLTSQEVINLELSTGIPLLYIYKEGRFMKRGSPVGPTEAGVYAYTETLALYRQE*********
MYG*LQGLNKQETAERYGKELVHGWRRSYDIPPPNGESLEMCSKQAVAYFREHIEPQLQSGKHVMVAAHGNSLRSIIMYLDKLTSQEVINLELSTGIPLLYIYKEGRFMKRGSPVGPTEAGVYAYTETLALYRQELDEM*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYGELQGLNKQETAERYGKELVHGWRRSYDIPPPNGESLEMCSKQAVAYFREHIEPQLQSGKHVMVAAHGNSLRSIIMYLDKLTSQEVINLELSTGIPLLYIYKEGRFMKRGSPVGPTEAGVYAYTETLALYRQELDEMSQRTS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query144 2.2.26 [Sep-21-2011]
Q6MEW4226 2,3-bisphosphoglycerate-d yes no 0.770 0.491 0.549 1e-34
Q256A6227 2,3-bisphosphoglycerate-d yes no 0.805 0.511 0.551 3e-31
Q9PLK4226 2,3-bisphosphoglycerate-d yes no 0.805 0.513 0.534 1e-30
Q15SN0227 2,3-bisphosphoglycerate-d yes no 0.694 0.440 0.55 1e-29
Q9Z743228 2,3-bisphosphoglycerate-d yes no 0.763 0.482 0.554 2e-29
A7HZ35210 2,3-bisphosphoglycerate-d yes no 0.694 0.476 0.53 5e-29
Q821N6227 2,3-bisphosphoglycerate-d yes no 0.805 0.511 0.525 5e-29
B0BAH7226 2,3-bisphosphoglycerate-d yes no 0.805 0.513 0.517 7e-29
O84727226 2,3-bisphosphoglycerate-d yes no 0.805 0.513 0.517 7e-29
Q3KKX2226 2,3-bisphosphoglycerate-d yes no 0.805 0.513 0.517 7e-29
>sp|Q6MEW4|GPMA_PARUW 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Protochlamydia amoebophila (strain UWE25) GN=gpmA PE=3 SV=1 Back     alignment and function desciption
 Score =  144 bits (364), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 61/111 (54%), Positives = 86/111 (77%)

Query: 1   MYGELQGLNKQETAERYGKELVHGWRRSYDIPPPNGESLEMCSKQAVAYFREHIEPQLQS 60
           MYGELQG+NK+E A++YG E VH WRRS+D+PPPNGESL+M + + + YF   I P L+ 
Sbjct: 114 MYGELQGINKEEMAKKYGAEQVHIWRRSFDVPPPNGESLQMTAARTIPYFENTIVPHLKE 173

Query: 61  GKHVMVAAHGNSLRSIIMYLDKLTSQEVINLELSTGIPLLYIYKEGRFMKR 111
            K++ +AAHGNSLRSIIM LD LT+ +V+ LEL+TG+P++Y +    ++K+
Sbjct: 174 KKNIFIAAHGNSLRSIIMKLDGLTTDQVVKLELATGVPVIYDFNHDEYIKQ 224
Catalyzes the interconversion of 2-phosphoglycerate and 3-phosphoglycerate.
Protochlamydia amoebophila (strain UWE25) (taxid: 264201)
EC: 5EC: .EC: 4EC: .EC: 2EC: .EC: 1
>sp|Q256A6|GPMA_CHLFF 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydophila felis (strain Fe/C-56) GN=gpmA PE=3 SV=1 Back     alignment and function description
>sp|Q9PLK4|GPMA_CHLMU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=gpmA PE=3 SV=1 Back     alignment and function description
>sp|Q15SN0|GPMA_PSEA6 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=gpmA PE=3 SV=1 Back     alignment and function description
>sp|Q9Z743|GPMA_CHLPN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydia pneumoniae GN=gpmA PE=3 SV=1 Back     alignment and function description
>sp|A7HZ35|GPMA_PARL1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=gpmA PE=3 SV=1 Back     alignment and function description
>sp|Q821N6|GPMA_CHLCV 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydophila caviae (strain GPIC) GN=gpmA PE=3 SV=1 Back     alignment and function description
>sp|B0BAH7|GPMA_CHLTB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=gpmA PE=3 SV=1 Back     alignment and function description
>sp|O84727|GPMA_CHLTR 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=gpmA PE=3 SV=1 Back     alignment and function description
>sp|Q3KKX2|GPMA_CHLTA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydia trachomatis serovar A (strain HAR-13 / ATCC VR-571B) GN=gpmA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query144
359492836 345 PREDICTED: 2,3-bisphosphoglycerate-depen 0.965 0.402 0.841 3e-67
255638308 314 unknown [Glycine max] 0.979 0.449 0.829 6e-67
356548228 338 PREDICTED: 2,3-bisphosphoglycerate-depen 0.979 0.417 0.829 1e-66
449508490 340 PREDICTED: LOW QUALITY PROTEIN: 2,3-bisp 0.965 0.408 0.834 3e-66
356515810 345 PREDICTED: 2,3-bisphosphoglycerate-depen 0.979 0.408 0.822 3e-66
224063203 345 predicted protein [Populus trichocarpa] 0.965 0.402 0.834 3e-66
449465964 339 PREDICTED: 2,3-bisphosphoglycerate-depen 0.965 0.410 0.834 4e-66
356508122 345 PREDICTED: 2,3-bisphosphoglycerate-depen 0.979 0.408 0.822 4e-66
449504825 351 PREDICTED: 2,3-bisphosphoglycerate-depen 0.972 0.398 0.842 3e-65
255545652 347 phosphoglycerate mutase, putative [Ricin 0.965 0.400 0.827 3e-65
>gi|359492836|ref|XP_002284225.2| PREDICTED: 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase-like [Vitis vinifera] gi|302141930|emb|CBI19133.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 134/139 (96%)

Query: 1   MYGELQGLNKQETAERYGKELVHGWRRSYDIPPPNGESLEMCSKQAVAYFREHIEPQLQS 60
           MYGELQGLNKQETA+RYGKE VH WRRSYDIPPPNGESLEMC+++AVAYFREHIEPQL S
Sbjct: 205 MYGELQGLNKQETADRYGKEQVHEWRRSYDIPPPNGESLEMCAERAVAYFREHIEPQLLS 264

Query: 61  GKHVMVAAHGNSLRSIIMYLDKLTSQEVINLELSTGIPLLYIYKEGRFMKRGSPVGPTEA 120
           GKH+M+AAHGNSLRSIIMYLDKLTSQEVI+LELSTGIP+LYI+KEG+F++RGSP+GP EA
Sbjct: 265 GKHIMIAAHGNSLRSIIMYLDKLTSQEVISLELSTGIPMLYIFKEGKFIRRGSPIGPAEA 324

Query: 121 GVYAYTETLALYRQELDEM 139
           GVYAYT++LA YRQ+LD+M
Sbjct: 325 GVYAYTKSLAQYRQKLDDM 343

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255638308|gb|ACU19466.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356548228|ref|XP_003542505.1| PREDICTED: 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase-like [Glycine max] Back     alignment and taxonomy information
>gi|449508490|ref|XP_004163326.1| PREDICTED: LOW QUALITY PROTEIN: 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356515810|ref|XP_003526591.1| PREDICTED: 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase-like [Glycine max] Back     alignment and taxonomy information
>gi|224063203|ref|XP_002301039.1| predicted protein [Populus trichocarpa] gi|222842765|gb|EEE80312.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449465964|ref|XP_004150697.1| PREDICTED: 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356508122|ref|XP_003522809.1| PREDICTED: 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase-like [Glycine max] Back     alignment and taxonomy information
>gi|449504825|ref|XP_004162305.1| PREDICTED: 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255545652|ref|XP_002513886.1| phosphoglycerate mutase, putative [Ricinus communis] gi|223546972|gb|EEF48469.1| phosphoglycerate mutase, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query144
TAIR|locus:2015021334 AT1G22170 [Arabidopsis thalian 0.979 0.422 0.815 6.4e-60
TAIR|locus:2029371332 PGM "phosphoglycerate/bisphosp 0.951 0.412 0.766 4.8e-55
POMBASE|SPAC26F1.06211 gpm1 "monomeric 2,3-bisphospho 0.763 0.521 0.459 5.2e-26
UNIPROTKB|P62707250 gpmA "2,3-bisphosphoglycerate- 0.541 0.312 0.405 1.9e-24
TIGR_CMR|GSU_1612247 GSU_1612 "phosphoglycerate mut 0.229 0.133 0.818 4.7e-24
GENEDB_PFALCIPARUM|PF11_0208250 PF11_0208 "phosphoglycerate mu 0.472 0.272 0.411 4.8e-24
UNIPROTKB|Q8IIG6250 PF11_0208 "Phosphoglycerate mu 0.472 0.272 0.411 4.8e-24
UNIPROTKB|H9GW55253 PGAM2 "Uncharacterized protein 0.472 0.268 0.441 1.3e-23
UNIPROTKB|P15259253 PGAM2 "Phosphoglycerate mutase 0.5 0.284 0.438 1.3e-23
ZFIN|ZDB-GENE-030131-5376254 pgam1b "phosphoglycerate mutas 0.472 0.267 0.441 2.6e-23
TAIR|locus:2015021 AT1G22170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 614 (221.2 bits), Expect = 6.4e-60, P = 6.4e-60
 Identities = 115/141 (81%), Positives = 133/141 (94%)

Query:     1 MYGELQGLNKQETAERYGKELVHGWRRSYDIPPPNGESLEMCSKQAVAYFREHIEPQLQS 60
             MYGELQGLNKQETAERYGKE VH WRRSYDIPPP GESLEMC+++AVAYF+++IEP+L +
Sbjct:   190 MYGELQGLNKQETAERYGKEQVHEWRRSYDIPPPKGESLEMCAERAVAYFQDNIEPKLAA 249

Query:    61 GKHVMVAAHGNSLRSIIMYLDKLTSQEVINLELSTGIPLLYIYKEGRFMKRGSPVGPTEA 120
             GK+VM+AAHGNSLRSIIMYLDKLT QEVI+LELSTGIPLLYI+KEG+FMKRGSPVGPTEA
Sbjct:   250 GKNVMIAAHGNSLRSIIMYLDKLTCQEVISLELSTGIPLLYIFKEGKFMKRGSPVGPTEA 309

Query:   121 GVYAYTETLALYRQELDEMSQ 141
             GVYAYT+ LA YRQ+L++ S+
Sbjct:   310 GVYAYTKRLAQYRQKLEDDSE 330
GO:0003824 "catalytic activity" evidence=IEA;ISS
GO:0006096 "glycolysis" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0016868 "intramolecular transferase activity, phosphotransferases" evidence=IEA
TAIR|locus:2029371 PGM "phosphoglycerate/bisphosphoglycerate mutase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
POMBASE|SPAC26F1.06 gpm1 "monomeric 2,3-bisphosphoglycerate (BPG)-dependent phosphoglycerate mutase (PGAM), Gpm1" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|P62707 gpmA "2,3-bisphosphoglycerate-dependent phosphoglycerate mutase monomer" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1612 GSU_1612 "phosphoglycerate mutase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF11_0208 PF11_0208 "phosphoglycerate mutase, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IIG6 PF11_0208 "Phosphoglycerate mutase, putative" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
UNIPROTKB|H9GW55 PGAM2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P15259 PGAM2 "Phosphoglycerate mutase 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5376 pgam1b "phosphoglycerate mutase 1b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer5.4.2.1LOW CONFIDENCE prediction!
3rd Layer5.4.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query144
PRK01112228 PRK01112, PRK01112, phosphoglyceromutase; Provisio 1e-56
PRK01295206 PRK01295, PRK01295, phosphoglyceromutase; Provisio 5e-44
PRK14115247 PRK14115, gpmA, phosphoglyceromutase; Provisional 2e-43
COG0588230 COG0588, GpmA, Phosphoglycerate mutase 1 [Carbohyd 5e-41
PTZ00123236 PTZ00123, PTZ00123, phosphoglycerate mutase like-p 6e-41
TIGR01258245 TIGR01258, pgm_1, phosphoglycerate mutase, BPG-dep 4e-39
PRK14116228 PRK14116, gpmA, phosphoglyceromutase; Provisional 3e-32
PRK14120249 PRK14120, gpmA, phosphoglyceromutase; Provisional 9e-32
PRK14118227 PRK14118, gpmA, phosphoglyceromutase; Provisional 1e-29
PRK14119228 PRK14119, gpmA, phosphoglyceromutase; Provisional 4e-28
PRK14117230 PRK14117, gpmA, phosphoglyceromutase; Provisional 5e-24
smart00855158 smart00855, PGAM, Phosphoglycerate mutase family 1e-16
pfam00300154 pfam00300, His_Phos_1, Histidine phosphatase super 5e-11
COG0406208 COG0406, phoE, Broad specificity phosphatase PhoE 9e-11
cd07067153 cd07067, HP_PGM_like, Histidine phosphatase domain 2e-09
cd07040153 cd07040, HP, Histidine phosphatase domain found in 5e-09
TIGR03162177 TIGR03162, ribazole_cobC, alpha-ribazole phosphata 3e-04
PRK07238372 PRK07238, PRK07238, bifunctional RNase H/acid phos 6e-04
>gnl|CDD|234902 PRK01112, PRK01112, phosphoglyceromutase; Provisional Back     alignment and domain information 
 Score =  175 bits (446), Expect = 1e-56
 Identities = 63/116 (54%), Positives = 83/116 (71%)

Query: 1   MYGELQGLNKQETAERYGKELVHGWRRSYDIPPPNGESLEMCSKQAVAYFREHIEPQLQS 60
           MYGELQG NK ETAE++G+E V  WRRSY   PP GESLE   ++ + YF+  I P LQ 
Sbjct: 113 MYGELQGKNKAETAEKFGEEQVKLWRRSYKTAPPQGESLEDTGQRTLPYFQNRILPHLQQ 172

Query: 61  GKHVMVAAHGNSLRSIIMYLDKLTSQEVINLELSTGIPLLYIYKEGRFMKRGSPVG 116
           GK+V V+AHGNSLRS+IM L+KL+ +EV++LEL TG P++Y +   +F K    +G
Sbjct: 173 GKNVFVSAHGNSLRSLIMDLEKLSEEEVLSLELPTGKPIVYEWTGQKFEKHKEVLG 228

Length = 228
>gnl|CDD|167205 PRK01295, PRK01295, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|184516 PRK14115, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|223661 COG0588, GpmA, Phosphoglycerate mutase 1 [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|240280 PTZ00123, PTZ00123, phosphoglycerate mutase like-protein; Provisional Back     alignment and domain information
>gnl|CDD|213596 TIGR01258, pgm_1, phosphoglycerate mutase, BPG-dependent, family 1 Back     alignment and domain information
>gnl|CDD|172606 PRK14116, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|184519 PRK14120, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|172608 PRK14118, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|184518 PRK14119, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|184517 PRK14117, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|214859 smart00855, PGAM, Phosphoglycerate mutase family Back     alignment and domain information
>gnl|CDD|215845 pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1) Back     alignment and domain information
>gnl|CDD|223483 COG0406, phoE, Broad specificity phosphatase PhoE and related phosphatases [General function prediction only] Back     alignment and domain information
>gnl|CDD|132718 cd07067, HP_PGM_like, Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>gnl|CDD|132716 cd07040, HP, Histidine phosphatase domain found in a functionally diverse set of proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>gnl|CDD|234131 TIGR03162, ribazole_cobC, alpha-ribazole phosphatase Back     alignment and domain information
>gnl|CDD|180903 PRK07238, PRK07238, bifunctional RNase H/acid phosphatase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 144
PRK01112228 phosphoglyceromutase; Provisional 99.91
PRK14117230 gpmA phosphoglyceromutase; Provisional 99.91
PRK14118227 gpmA phosphoglyceromutase; Provisional 99.9
PRK14119228 gpmA phosphoglyceromutase; Provisional 99.9
PRK14116228 gpmA phosphoglyceromutase; Provisional 99.89
PRK14115247 gpmA phosphoglyceromutase; Provisional 99.88
PRK01295206 phosphoglyceromutase; Provisional 99.88
TIGR01258245 pgm_1 phosphoglycerate mutase, BPG-dependent, fami 99.87
PRK14120249 gpmA phosphoglyceromutase; Provisional 99.87
PTZ00123236 phosphoglycerate mutase like-protein; Provisional 99.87
PRK13463203 phosphatase PhoE; Provisional 99.87
PRK15004199 alpha-ribazole phosphatase; Provisional 99.86
COG0588230 GpmA Phosphoglycerate mutase 1 [Carbohydrate trans 99.85
PRK13462203 acid phosphatase; Provisional 99.84
COG0406208 phoE Broad specificity phosphatase PhoE and relate 99.82
TIGR03848204 MSMEG_4193 probable phosphomutase, MSMEG_4193 fami 99.81
TIGR03162177 ribazole_cobC alpha-ribazole phosphatase. Members 99.8
PRK03482215 phosphoglycerate mutase; Provisional 99.8
PRK07238372 bifunctional RNase H/acid phosphatase; Provisional 99.78
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.76
KOG0235214 consensus Phosphoglycerate mutase [Carbohydrate tr 99.68
PF00300158 His_Phos_1: Histidine phosphatase superfamily (bra 99.52
smart00855155 PGAM Phosphoglycerate mutase family. Phosphoglycer 99.52
KOG0234438 consensus Fructose-6-phosphate 2-kinase/fructose-2 99.34
PTZ00122299 phosphoglycerate mutase; Provisional 99.03
cd07067153 HP_PGM_like Histidine phosphatase domain found in 98.59
cd07040153 HP Histidine phosphatase domain found in a functio 98.33
KOG3734272 consensus Predicted phosphoglycerate mutase [Carbo 97.68
KOG4609284 consensus Predicted phosphoglycerate mutase [Gener 97.41
PRK06193206 hypothetical protein; Provisional 96.88
TIGR00249152 sixA phosphohistidine phosphatase SixA. 96.28
KOG4754248 consensus Predicted phosphoglycerate mutase [Carbo 94.08
PRK10848159 phosphohistidine phosphatase; Provisional 93.83
PRK15416201 lipopolysaccharide core heptose(II)-phosphate phos 93.66
PF12048310 DUF3530: Protein of unknown function (DUF3530); In 81.99
>PRK01112 phosphoglyceromutase; Provisional Back     alignment and domain information 
Probab=99.91  E-value=4.5e-24  Score=159.80  Aligned_cols=111  Identities=56%  Similarity=0.947  Sum_probs=98.7

Q ss_pred             CcccCCCCCHHHHHHHhhHHHHHhhhhCCCCCCCCCCCHHHHHHHHHHHHHHhhchhccCCCeEEEEeehHHHHHHHHHH
Q 032238            1 MYGELQGLNKQETAERYGKELVHGWRRSYDIPPPNGESLEMCSKQAVAYFREHIEPQLQSGKHVMVAAHGNSLRSIIMYL   80 (144)
Q Consensus         1 ~~G~wEG~~~~ei~~~~p~~~~~~~~~~~~~~~pgGES~~~~~~Rv~~~l~~l~~~~~~~~~~VLvVsHG~vir~ll~~l   80 (144)
                      +||.|||++++|+.++||+.+...|.+++..++|+|||+.++.+|+.+++++++.+....+++|||||||++||++++++
T Consensus       113 ~~G~~eG~~~~ei~~~~~~~~~~~w~~~~~~~~p~GES~~d~~~Rv~~~l~~~~~~~~~~~~~ilVVsHg~vir~l~~~l  192 (228)
T PRK01112        113 MYGELQGKNKAETAEKFGEEQVKLWRRSYKTAPPQGESLEDTGQRTLPYFQNRILPHLQQGKNVFVSAHGNSLRSLIMDL  192 (228)
T ss_pred             cccccCCCCHHHHHHHCcHHHHHHHhCcCCCCCCCCCCHHHHHHHHHHHHHHHHHHHhcCCCeEEEEeCHHHHHHHHHHH
Confidence            68999999999999999988788898877788999999999999999999987542223578999999999999999999


Q ss_pred             hCCCccceeeeeecCCcEEEEEEcCCceeec
Q 032238           81 DKLTSQEVINLELSTGIPLLYIYKEGRFMKR  111 (144)
Q Consensus        81 ~~~~~~~~~~~~~~~g~~~i~~~~~~~~~~~  111 (144)
                      ++++.+.++.+.+++|+..+++++.+++-.+
T Consensus       193 l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  223 (228)
T PRK01112        193 EKLSEEEVLSLELPTGKPIVYEWTGQKFEKH  223 (228)
T ss_pred             hCCCHHHHhhcccCCcceEEEEECCCCcccc
Confidence            9999999999999999999999998876653

>PRK14117 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK14118 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK14119 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK14116 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK14115 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK01295 phosphoglyceromutase; Provisional Back     alignment and domain information
>TIGR01258 pgm_1 phosphoglycerate mutase, BPG-dependent, family 1 Back     alignment and domain information
>PRK14120 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PTZ00123 phosphoglycerate mutase like-protein; Provisional Back     alignment and domain information
>PRK13463 phosphatase PhoE; Provisional Back     alignment and domain information
>PRK15004 alpha-ribazole phosphatase; Provisional Back     alignment and domain information
>COG0588 GpmA Phosphoglycerate mutase 1 [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13462 acid phosphatase; Provisional Back     alignment and domain information
>COG0406 phoE Broad specificity phosphatase PhoE and related phosphatases [General function prediction only] Back     alignment and domain information
>TIGR03848 MSMEG_4193 probable phosphomutase, MSMEG_4193 family Back     alignment and domain information
>TIGR03162 ribazole_cobC alpha-ribazole phosphatase Back     alignment and domain information
>PRK03482 phosphoglycerate mutase; Provisional Back     alignment and domain information
>PRK07238 bifunctional RNase H/acid phosphatase; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0235 consensus Phosphoglycerate mutase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00300 His_Phos_1: Histidine phosphatase superfamily (branch 1); InterPro: IPR013078 The histidine phosphatase superfamily is so named because catalysis centres on a conserved His residue that is transiently phosphorylated during the catalytic cycle Back     alignment and domain information
>smart00855 PGAM Phosphoglycerate mutase family Back     alignment and domain information
>KOG0234 consensus Fructose-6-phosphate 2-kinase/fructose-2,6-biphosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00122 phosphoglycerate mutase; Provisional Back     alignment and domain information
>cd07067 HP_PGM_like Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>cd07040 HP Histidine phosphatase domain found in a functionally diverse set of proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>KOG3734 consensus Predicted phosphoglycerate mutase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4609 consensus Predicted phosphoglycerate mutase [General function prediction only] Back     alignment and domain information
>PRK06193 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00249 sixA phosphohistidine phosphatase SixA Back     alignment and domain information
>KOG4754 consensus Predicted phosphoglycerate mutase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10848 phosphohistidine phosphatase; Provisional Back     alignment and domain information
>PRK15416 lipopolysaccharide core heptose(II)-phosphate phosphatase; Provisional Back     alignment and domain information
>PF12048 DUF3530: Protein of unknown function (DUF3530); InterPro: IPR022529 This family of proteins is functionally uncharacterised Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query144
1fzt_A211 Solution Structure And Dynamics Of An Open B-Sheet, 7e-28
1xq9_A258 Structure Of Phosphoglycerate Mutase From Plasmodiu 8e-24
1e58_A249 E.Coli Cofactor-Dependent Phosphoglycerate Mutase L 3e-23
1e59_A249 E.Coli Cofactor-Dependent Phosphoglycerate Mutase C 3e-23
3kkk_A258 Y92c Catalytic Residue Mutant Of Phosphoglycerate M 5e-23
4emb_A274 Crystal Structure Of A Phosphoglycerate Mutase Gpma 2e-22
3fdz_B257 Crystal Structure Of Phosphoglyceromutase From Burk 5e-22
3ezn_A257 Crystal Structure Of Phosphoglyceromutase From Burk 6e-22
3lnt_A250 Crystal Structure Of Phosphoglyceromutase From Burk 6e-22
4eo9_A268 Crystal Structure Of A Phosphoglycerate Mutase Gpm1 2e-21
1rii_A265 Crystal Structure Of Phosphoglycerate Mutase From M 3e-21
1yfk_A262 Crystal Structure Of Human B Type Phosphoglycerate 3e-19
3d8h_A267 Crystal Structure Of Phosphoglycerate Mutase From C 4e-19
1qhf_A240 Yeast Phosphoglycerate Mutase-3pg Complex Structure 4e-18
4pgm_A246 Saccharomyces Cerevisiae Phosphoglycerate Mutase Le 5e-18
2hhj_A267 Human Bisphosphoglycerate Mutase Complexed With 2,3 6e-16
1t8p_A267 Crystal Structure Of Human Erythrocyte 2,3- Bisphos 6e-16
3pgm_A244 The Structure Of Yeast Phosphoglycerate Mutase At 0 5e-12
>pdb|1FZT|A Chain A, Solution Structure And Dynamics Of An Open B-Sheet, Glycolytic Enzyme-Monomeric 23.7 Kda Phosphoglycerate Mutase From Schizosaccharomyces Pombe Length = 211 Back     alignment and structure 
Iteration: 1

 Score =  119 bits (298), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 51/111 (45%), Positives = 83/111 (74%), Gaps = 1/111 (0%)
Query: 2   YGELQGLNKQETAERYGKELVHGWRRSYDIPPPNGESLEMCSKQAVAYFREHIEPQLQSG 61
           YG+LQGLNK +  +++G E V  WRRSYDI PPNGESL+  +++ + Y++  I P +  G
Sbjct: 96  YGDLQGLNKDDARKKWGAEQVQIWRRSYDIAPPNGESLKDTAERVLPYYKSTIVPHILKG 155
Query: 62  KHVMVAAHGNSLRSIIMYLDKLTSQEVINLELSTGIPLLY-IYKEGRFMKR 111
           + V++AAHGNSLR++IM L+ LT  +++  EL+TG+P++Y + K+G+++ +
Sbjct: 156 EKVLIAAHGNSLRALIMDLEGLTGDQIVKRELATGVPIVYHLDKDGKYVSK 206
>pdb|1XQ9|A Chain A, Structure Of Phosphoglycerate Mutase From Plasmodium Falciparum At 2.6 Resolution Length = 258 Back     alignment and structure
>pdb|1E58|A Chain A, E.Coli Cofactor-Dependent Phosphoglycerate Mutase Length = 249 Back     alignment and structure
>pdb|1E59|A Chain A, E.Coli Cofactor-Dependent Phosphoglycerate Mutase Complexed With Vanadate Length = 249 Back     alignment and structure
>pdb|3KKK|A Chain A, Y92c Catalytic Residue Mutant Of Phosphoglycerate Mutase From Plasmodium Falciparum Length = 258 Back     alignment and structure
>pdb|4EMB|A Chain A, Crystal Structure Of A Phosphoglycerate Mutase Gpma From Borrelia Burgdorferi B31 Length = 274 Back     alignment and structure
>pdb|3FDZ|B Chain B, Crystal Structure Of Phosphoglyceromutase From Burkholderia Pseudomallei 1710b With Bound 2,3-Diphosphoglyceric Acid And 3- Phosphoglyceric Acid Length = 257 Back     alignment and structure
>pdb|3EZN|A Chain A, Crystal Structure Of Phosphoglyceromutase From Burkholderia Pseudomallei 1710b Length = 257 Back     alignment and structure
>pdb|3LNT|A Chain A, Crystal Structure Of Phosphoglyceromutase From Burkholderia Pseudomallei 1710b With Bound Malonic Acid Length = 250 Back     alignment and structure
>pdb|4EO9|A Chain A, Crystal Structure Of A Phosphoglycerate Mutase Gpm1 From Mycobacterium Leprae Length = 268 Back     alignment and structure
>pdb|1RII|A Chain A, Crystal Structure Of Phosphoglycerate Mutase From M. Tuberculosis Length = 265 Back     alignment and structure
>pdb|1YFK|A Chain A, Crystal Structure Of Human B Type Phosphoglycerate Mutase Length = 262 Back     alignment and structure
>pdb|3D8H|A Chain A, Crystal Structure Of Phosphoglycerate Mutase From Cryptosporidium Parvum, Cgd7_4270 Length = 267 Back     alignment and structure
>pdb|1QHF|A Chain A, Yeast Phosphoglycerate Mutase-3pg Complex Structure To 1.7 A Length = 240 Back     alignment and structure
>pdb|4PGM|A Chain A, Saccharomyces Cerevisiae Phosphoglycerate Mutase Length = 246 Back     alignment and structure
>pdb|2HHJ|A Chain A, Human Bisphosphoglycerate Mutase Complexed With 2,3- Bisphosphoglycerate (15 Days) Length = 267 Back     alignment and structure
>pdb|1T8P|A Chain A, Crystal Structure Of Human Erythrocyte 2,3- Bisphosphoglycerate Mutase Length = 267 Back     alignment and structure
>pdb|3PGM|A Chain A, The Structure Of Yeast Phosphoglycerate Mutase At 0.28 Nm Resolution Length = 244 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query144
1fzt_A211 Phosphoglycerate mutase; open B-sheet-helices, iso 4e-60
1e58_A249 Phosphoglycerate mutase; phosphohistidine, glycoly 3e-50
1qhf_A240 Protein (phosphoglycerate mutase); transferase (ph 5e-50
1rii_A265 2,3-bisphosphoglycerate-dependent phosphoglycerat; 6e-50
4eo9_A268 2,3-bisphosphoglycerate-dependent phosphoglycerat; 8e-50
3kkk_A258 Phosphoglycerate mutase; PGAM, glycolysis, malaria 9e-50
3gp3_A257 2,3-bisphosphoglycerate-dependent phosphoglycerat; 1e-49
3d8h_A267 Glycolytic phosphoglycerate mutase; structural gen 2e-49
1yfk_A262 Phosphoglycerate mutase 1; alpha/beta, isomerase, 3e-49
2hhj_A267 Bisphosphoglycerate mutase; isomerase; HET: NEP DG 5e-49
4emb_A274 2,3-bisphosphoglycerate-dependent phosphoglycerat; 5e-49
3f3k_A265 Uncharacterized protein YKR043C; structural genomi 4e-36
3r7a_A237 Phosphoglycerate mutase, putative; structural geno 1e-24
3dcy_A275 Regulator protein; OMIM 610775, C12ORF5, tigar, TP 7e-24
3mbk_A264 Ubiquitin-associated and SH3 domain-containing PR; 5e-21
2a6p_A208 Possible phosphoglycerate mutase GPM2; predicted p 2e-19
2axn_A520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 5e-18
1v37_A177 Phosphoglycerate mutase; riken structu genomics/pr 3e-17
1h2e_A207 Phosphatase, YHFR; hydrolase, broad specificity ph 1e-16
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 7e-16
3e9c_A265 ZGC:56074; histidine phosphatase, hydrolase; 2.00A 3e-14
3hjg_A213 Putative alpha-ribazole-5'-phosphate phosphatase C 2e-10
3d4i_A273 STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domai 6e-10
3c7t_A263 Ecdysteroid-phosphate phosphatase; ecdysone, 2H-ph 4e-09
2qni_A219 AGR_C_517P, uncharacterized protein ATU0299; MCSG, 6e-05
>1fzt_A Phosphoglycerate mutase; open B-sheet-helices, isomerase; NMR {Schizosaccharomyces pombe} SCOP: c.60.1.1 Length = 211 Back     alignment and structure
 Score =  183 bits (467), Expect = 4e-60
 Identities = 51/112 (45%), Positives = 82/112 (73%), Gaps = 1/112 (0%)

Query: 1   MYGELQGLNKQETAERYGKELVHGWRRSYDIPPPNGESLEMCSKQAVAYFREHIEPQLQS 60
            YG+LQGLNK +  +++G E V  WRRSYDI PPNGESL+  +++ + Y++  I P +  
Sbjct: 95  YYGDLQGLNKDDARKKWGAEQVQIWRRSYDIAPPNGESLKDTAERVLPYYKSTIVPHILK 154

Query: 61  GKHVMVAAHGNSLRSIIMYLDKLTSQEVINLELSTGIPLLYIY-KEGRFMKR 111
           G+ V++AAHGNSLR++IM L+ LT  +++  EL+TG+P++Y   K+G+++ +
Sbjct: 155 GEKVLIAAHGNSLRALIMDLEGLTGDQIVKRELATGVPIVYHLDKDGKYVSK 206
>1e58_A Phosphoglycerate mutase; phosphohistidine, glycolysis and gluconeogenesis, isomerase; HET: NEP; 1.25A {Escherichia coli} SCOP: c.60.1.1 PDB: 1e59_A* Length = 249 Back     alignment and structure
>1qhf_A Protein (phosphoglycerate mutase); transferase (phosphoryl); HET: 3PG; 1.70A {Saccharomyces cerevisiae} SCOP: c.60.1.1 PDB: 5pgm_D 1bq3_D* 1bq4_D 4pgm_A 3pgm_A* Length = 240 Back     alignment and structure
>1rii_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyerate mutase, SH3 domain binding, structural genom TBSGC; 1.70A {Mycobacterium tuberculosis} SCOP: c.60.1.1 Length = 265 Back     alignment and structure
>4eo9_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.45A {Mycobacterium leprae} Length = 268 Back     alignment and structure
>3kkk_A Phosphoglycerate mutase; PGAM, glycolysis, malaria, structural genomics, medical STRU genomics of pathogenic protozoa, MSGPP; 2.08A {Plasmodium falciparum 3D7} PDB: 1xq9_A Length = 258 Back     alignment and structure
>3gp3_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyceromutase, decode, SBRI, niaid, UWPPG, glycolysis isomerase; HET: PG4 SEP; 1.50A {Burkholderia pseudomallei} PDB: 3fdz_A* 3ezn_A* 3gp5_A* 3gw8_A* 3lnt_A Length = 257 Back     alignment and structure
>3d8h_A Glycolytic phosphoglycerate mutase; structural genomics, malaria, glycolysis, I structural genomics consortium, SGC; 2.01A {Cryptosporidium parvum} Length = 267 Back     alignment and structure
>1yfk_A Phosphoglycerate mutase 1; alpha/beta, isomerase, hydrolase; HET: CIT; 2.70A {Homo sapiens} PDB: 1yjx_A* Length = 262 Back     alignment and structure
>2hhj_A Bisphosphoglycerate mutase; isomerase; HET: NEP DG2 3PG; 1.50A {Homo sapiens} SCOP: c.60.1.1 PDB: 1t8p_A* 2f90_A* 2a9j_A* 2h4z_A* 2h52_A* 2h4x_A* 3nfy_A Length = 267 Back     alignment and structure
>4emb_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.30A {Borrelia burgdorferi} Length = 274 Back     alignment and structure
>3f3k_A Uncharacterized protein YKR043C; structural genomics,, PSI-2, prote structure initiative; 1.75A {Saccharomyces cerevisiae} PDB: 3lg2_A 3oi7_A* 3ll4_A* Length = 265 Back     alignment and structure
>3r7a_A Phosphoglycerate mutase, putative; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE EPE; 1.84A {Bacillus anthracis} Length = 237 Back     alignment and structure
>3dcy_A Regulator protein; OMIM 610775, C12ORF5, tigar, TP53-induced glycolysis and apoptosis regulator, CAsp target, structural genomics medical relevance; HET: MSE; 1.75A {Homo sapiens} Length = 275 Back     alignment and structure
>3mbk_A Ubiquitin-associated and SH3 domain-containing PR; PGM, STS-1, signaling protein, low PH, alternative splicing, cytoplasm, nucleus, phosphoprotein; 1.35A {Mus musculus} PDB: 2ikq_A 2h0q_A Length = 264 Back     alignment and structure
>2a6p_A Possible phosphoglycerate mutase GPM2; predicted phosphoglycerate mutase, structural genomics, PSI, structure initiative; 2.20A {Mycobacterium tuberculosis} Length = 208 Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Length = 520 Back     alignment and structure
>1v37_A Phosphoglycerate mutase; riken structu genomics/proteomics initiative, RSGI, structural genomics,; 1.40A {Thermus thermophilus} SCOP: c.60.1.1 PDB: 1v7q_A 2hia_A 2pa0_A 2p2y_A 2p77_A 2p6m_A 2p9y_A 2p30_A 2ekz_A 2p9f_A 2p79_A 2p78_A 2p2z_A 2p75_A 2owe_A 2enu_A 2ekb_A 2p6o_A 2owd_A 2enw_A ... Length = 177 Back     alignment and structure
>1h2e_A Phosphatase, YHFR; hydrolase, broad specificity phosphatase, DPGM homolog; 1.69A {Bacillus stearothermophilus} SCOP: c.60.1.1 PDB: 1h2f_A* 1ebb_A Length = 207 Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Length = 469 Back     alignment and structure
>3e9c_A ZGC:56074; histidine phosphatase, hydrolase; 2.00A {Danio rerio} PDB: 3e9d_A 3e9e_A Length = 265 Back     alignment and structure
>3hjg_A Putative alpha-ribazole-5'-phosphate phosphatase COBC; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 2.80A {Vibrio parahaemolyticus} Length = 213 Back     alignment and structure
>3d4i_A STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domain, hydrolase; 1.95A {Mus musculus} PDB: 3d6a_A 3db1_A Length = 273 Back     alignment and structure
>3c7t_A Ecdysteroid-phosphate phosphatase; ecdysone, 2H-phosphatase, PGM, hydrolase; 1.76A {Bombyx mori} Length = 263 Back     alignment and structure
>2qni_A AGR_C_517P, uncharacterized protein ATU0299; MCSG, in SITU proteolysis, structural genomics, PSI protein structure initiative; 1.80A {Agrobacterium tumefaciens str} Length = 219 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query144
1fzt_A211 Phosphoglycerate mutase; open B-sheet-helices, iso 99.86
1h2e_A207 Phosphatase, YHFR; hydrolase, broad specificity ph 99.85
1qhf_A240 Protein (phosphoglycerate mutase); transferase (ph 99.84
3kkk_A258 Phosphoglycerate mutase; PGAM, glycolysis, malaria 99.84
4eo9_A268 2,3-bisphosphoglycerate-dependent phosphoglycerat; 99.84
4emb_A274 2,3-bisphosphoglycerate-dependent phosphoglycerat; 99.84
3gp3_A257 2,3-bisphosphoglycerate-dependent phosphoglycerat; 99.83
1rii_A265 2,3-bisphosphoglycerate-dependent phosphoglycerat; 99.83
1e58_A249 Phosphoglycerate mutase; phosphohistidine, glycoly 99.82
1yfk_A262 Phosphoglycerate mutase 1; alpha/beta, isomerase, 99.81
2hhj_A267 Bisphosphoglycerate mutase; isomerase; HET: NEP DG 99.81
3d8h_A267 Glycolytic phosphoglycerate mutase; structural gen 99.81
3hjg_A213 Putative alpha-ribazole-5'-phosphate phosphatase C 99.79
2a6p_A208 Possible phosphoglycerate mutase GPM2; predicted p 99.79
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 99.76
3dcy_A275 Regulator protein; OMIM 610775, C12ORF5, tigar, TP 99.75
2qni_A219 AGR_C_517P, uncharacterized protein ATU0299; MCSG, 99.73
1v37_A177 Phosphoglycerate mutase; riken structu genomics/pr 99.73
2axn_A520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 99.72
3r7a_A237 Phosphoglycerate mutase, putative; structural geno 99.71
3mbk_A264 Ubiquitin-associated and SH3 domain-containing PR; 99.68
3d4i_A273 STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domai 99.68
3f3k_A265 Uncharacterized protein YKR043C; structural genomi 99.68
3c7t_A263 Ecdysteroid-phosphate phosphatase; ecdysone, 2H-ph 99.65
3e9c_A265 ZGC:56074; histidine phosphatase, hydrolase; 2.00A 99.64
3mxo_A202 Serine/threonine-protein phosphatase PGAM5, mitoc; 99.32
3eoz_A214 Putative phosphoglycerate mutase; PGAM, malaria, s 99.31
1ujc_A161 Phosphohistidine phosphatase SIXA; alpha-beta fold 98.88
3fjy_A364 Probable MUTT1 protein; dimer, protein structure i 97.9
2rfl_A173 Putative phosphohistidine phosphatase SIXA; alpha- 97.84
3f2i_A172 ALR0221 protein; alpha-beta protein, structural ge 96.69
4hbz_A186 Putative phosphohistidine phosphatase, SIXA; struc 80.96
>1fzt_A Phosphoglycerate mutase; open B-sheet-helices, isomerase; NMR {Schizosaccharomyces pombe} SCOP: c.60.1.1 Back     alignment and structure
Probab=99.86  E-value=3.3e-21  Score=140.93  Aligned_cols=106  Identities=46%  Similarity=0.912  Sum_probs=92.8

Q ss_pred             CcccCCCCCHHHHHHHhhHHHHHhhhhCCCCCCCCCCCHHHHHHHHHHHHHHhhchhccCCCeEEEEeehHHHHHHHHHH
Q 032238            1 MYGELQGLNKQETAERYGKELVHGWRRSYDIPPPNGESLEMCSKQAVAYFREHIEPQLQSGKHVMVAAHGNSLRSIIMYL   80 (144)
Q Consensus         1 ~~G~wEG~~~~ei~~~~p~~~~~~~~~~~~~~~pgGES~~~~~~Rv~~~l~~l~~~~~~~~~~VLvVsHG~vir~ll~~l   80 (144)
                      +||.|||++.+|+.+.+|...+..|..++.+.+|+|||+.++.+|+..++++++....+.+++|||||||++|+++++++
T Consensus        95 ~~G~~eg~~~~e~~~~~~~~~~~~w~~~~~~~~p~gEs~~~~~~R~~~~l~~l~~~~~~~~~~vlvVsHg~~i~~l~~~l  174 (211)
T 1fzt_A           95 YYGDLQGLNKDDARKKWGAEQVQIWRRSYDIAPPNGESLKDTAERVLPYYKSTIVPHILKGEKVLIAAHGNSLRALIMDL  174 (211)
T ss_dssp             CCGGGTTCBHHHHHHHHHHHHHHHHHSSSSCCSTTCCCHHHHHHHHHHHHHHHHTTHHHHTCCEEEESCHHHHHHHHHHH
T ss_pred             cCceecCCCHHHHHHhccHHHHHHHhhCCCcCCcCCCCHHHHHHHHHHHHHHHHhhhhcCCCeEEEEeChHHHHHHHHHH
Confidence            58999999999999999977678888766788999999999999999999998652113578999999999999999999


Q ss_pred             hCCCccceeeeeecCCcEEEEEEcCC
Q 032238           81 DKLTSQEVINLELSTGIPLLYIYKEG  106 (144)
Q Consensus        81 ~~~~~~~~~~~~~~~g~~~i~~~~~~  106 (144)
                      ++.+...++.+.++||+..++.++++
T Consensus       175 ~~~~~~~~~~~~~~~~~i~~l~~~~~  200 (211)
T 1fzt_A          175 EGLTGDQIVKRELATGVPIVYHLDKD  200 (211)
T ss_dssp             HTCCTTTSSSCCCCBSSCEEEEBCSS
T ss_pred             hCCCHHHHHhcCCCCCcEEEEEEcCC
Confidence            99988888888889999888888775
>1h2e_A Phosphatase, YHFR; hydrolase, broad specificity phosphatase, DPGM homolog; 1.69A {Bacillus stearothermophilus} SCOP: c.60.1.1 PDB: 1h2f_A* 1ebb_A Back     alignment and structure
>1qhf_A Protein (phosphoglycerate mutase); transferase (phosphoryl); HET: 3PG; 1.70A {Saccharomyces cerevisiae} SCOP: c.60.1.1 PDB: 5pgm_D 1bq3_D* 1bq4_D 4pgm_A 3pgm_A* Back     alignment and structure
>3kkk_A Phosphoglycerate mutase; PGAM, glycolysis, malaria, structural genomics, medical STRU genomics of pathogenic protozoa, MSGPP; 2.08A {Plasmodium falciparum 3D7} PDB: 1xq9_A Back     alignment and structure
>4eo9_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.45A {Mycobacterium leprae} Back     alignment and structure
>4emb_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.30A {Borrelia burgdorferi} Back     alignment and structure
>3gp3_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyceromutase, decode, SBRI, niaid, UWPPG, glycolysis isomerase; HET: PG4 SEP; 1.50A {Burkholderia pseudomallei} SCOP: c.60.1.1 PDB: 3fdz_A* 3ezn_A* 3gp5_A* 3gw8_A* 3lnt_A Back     alignment and structure
>1rii_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyerate mutase, SH3 domain binding, structural genom TBSGC; 1.70A {Mycobacterium tuberculosis} SCOP: c.60.1.1 Back     alignment and structure
>1e58_A Phosphoglycerate mutase; phosphohistidine, glycolysis and gluconeogenesis, isomerase; HET: NEP; 1.25A {Escherichia coli} SCOP: c.60.1.1 PDB: 1e59_A* Back     alignment and structure
>1yfk_A Phosphoglycerate mutase 1; alpha/beta, isomerase, hydrolase; HET: CIT; 2.70A {Homo sapiens} PDB: 1yjx_A* Back     alignment and structure
>2hhj_A Bisphosphoglycerate mutase; isomerase; HET: NEP DG2 3PG; 1.50A {Homo sapiens} SCOP: c.60.1.1 PDB: 1t8p_A* 2f90_A* 2a9j_A* 2h4z_A* 2h52_A* 2h4x_A* 3nfy_A Back     alignment and structure
>3d8h_A Glycolytic phosphoglycerate mutase; structural genomics, malaria, glycolysis, I structural genomics consortium, SGC; 2.01A {Cryptosporidium parvum} Back     alignment and structure
>3hjg_A Putative alpha-ribazole-5'-phosphate phosphatase COBC; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 2.80A {Vibrio parahaemolyticus} Back     alignment and structure
>2a6p_A Possible phosphoglycerate mutase GPM2; predicted phosphoglycerate mutase, structural genomics, PSI, structure initiative; 2.20A {Mycobacterium tuberculosis} Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>3dcy_A Regulator protein; OMIM 610775, C12ORF5, tigar, TP53-induced glycolysis and apoptosis regulator, CAsp target, structural genomics medical relevance; HET: MSE; 1.75A {Homo sapiens} Back     alignment and structure
>2qni_A AGR_C_517P, uncharacterized protein ATU0299; MCSG, in SITU proteolysis, structural genomics, PSI protein structure initiative; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>1v37_A Phosphoglycerate mutase; riken structu genomics/proteomics initiative, RSGI, structural genomics,; 1.40A {Thermus thermophilus} SCOP: c.60.1.1 PDB: 1v7q_A 2hia_A 2pa0_A 2p2y_A 2p77_A 2p6m_A 2p9y_A 2p30_A 2ekz_A 2p9f_A 2p79_A 2p78_A 2p2z_A 2p75_A 2owe_A 2enu_A 2ekb_A 2p6o_A 2owd_A 2enw_A ... Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>3r7a_A Phosphoglycerate mutase, putative; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE EPE; 1.84A {Bacillus anthracis} Back     alignment and structure
>3mbk_A Ubiquitin-associated and SH3 domain-containing PR; PGM, STS-1, signaling protein, low PH, alternative splicing, cytoplasm, nucleus, phosphoprotein; 1.35A {Mus musculus} PDB: 2ikq_A 2h0q_A Back     alignment and structure
>3d4i_A STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domain, hydrolase; 1.95A {Mus musculus} PDB: 3d6a_A 3db1_A Back     alignment and structure
>3f3k_A Uncharacterized protein YKR043C; structural genomics,, PSI-2, prote structure initiative; 1.75A {Saccharomyces cerevisiae} PDB: 3lg2_A 3oi7_A* 3ll4_A* Back     alignment and structure
>3c7t_A Ecdysteroid-phosphate phosphatase; ecdysone, 2H-phosphatase, PGM, hydrolase; 1.76A {Bombyx mori} Back     alignment and structure
>3e9c_A ZGC:56074; histidine phosphatase, hydrolase; 2.00A {Danio rerio} PDB: 3e9d_A 3e9e_A Back     alignment and structure
>3mxo_A Serine/threonine-protein phosphatase PGAM5, mitoc; phosphoglycerate mutase family member 5, BXLBV68, MGC protein, structural genomics consortium; HET: PG4 PGE PEG; 1.70A {Homo sapiens} PDB: 3o0t_A Back     alignment and structure
>3eoz_A Putative phosphoglycerate mutase; PGAM, malaria, structural genomics, isomerase, structural GE consortium, SGC; 2.40A {Plasmodium falciparum} Back     alignment and structure
>1ujc_A Phosphohistidine phosphatase SIXA; alpha-beta fold, hydrolase; 1.90A {Escherichia coli} PDB: 1ujb_A Back     alignment and structure
>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Back     alignment and structure
>2rfl_A Putative phosphohistidine phosphatase SIXA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 2.35A {Agrobacterium tumefaciens str} Back     alignment and structure
>3f2i_A ALR0221 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG, function; 2.00A {Nostoc SP} Back     alignment and structure
>4hbz_A Putative phosphohistidine phosphatase, SIXA; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, HP_PGM_LIKE; HET: PGE; 1.55A {Nakamurella multipartita} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 144
d1fzta_211 c.60.1.1 (A:) Phosphoglycerate mutase {Fission yea 3e-26
d1e58a_247 c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia 7e-19
d2hhja1248 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human 3e-17
d1xq9a_241 c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium 1e-16
d1riia_243 c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacteri 5e-14
d1qhfa_240 c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yea 1e-11
d1bifa2219 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fruc 2e-08
d1v37a_171 c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphat 2e-05
>d1fzta_ c.60.1.1 (A:) Phosphoglycerate mutase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 211 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Phosphoglycerate mutase-like
superfamily: Phosphoglycerate mutase-like
family: Cofactor-dependent phosphoglycerate mutase
domain: Phosphoglycerate mutase
species: Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]

 Score = 96.2 bits (238), Expect = 3e-26
 Identities = 51/112 (45%), Positives = 83/112 (74%), Gaps = 1/112 (0%)

Query: 1   MYGELQGLNKQETAERYGKELVHGWRRSYDIPPPNGESLEMCSKQAVAYFREHIEPQLQS 60
            YG+LQGLNK +  +++G E V  WRRSYDI PPNGESL+  +++ + Y++  I P +  
Sbjct: 95  YYGDLQGLNKDDARKKWGAEQVQIWRRSYDIAPPNGESLKDTAERVLPYYKSTIVPHILK 154

Query: 61  GKHVMVAAHGNSLRSIIMYLDKLTSQEVINLELSTGIPLLY-IYKEGRFMKR 111
           G+ V++AAHGNSLR++IM L+ LT  +++  EL+TG+P++Y + K+G+++ +
Sbjct: 155 GEKVLIAAHGNSLRALIMDLEGLTGDQIVKRELATGVPIVYHLDKDGKYVSK 206
>d1e58a_ c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia coli [TaxId: 562]} Length = 247 Back     information, alignment and structure
>d2hhja1 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 Back     information, alignment and structure
>d1xq9a_ c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium falciparum [TaxId: 5833]} Length = 241 Back     information, alignment and structure
>d1riia_ c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 243 Back     information, alignment and structure
>d1qhfa_ c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 240 Back     information, alignment and structure
>d1bifa2 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 219 Back     information, alignment and structure
>d1v37a_ c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphatase {Thermus thermophilus [TaxId: 274]} Length = 171 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query144
d1fzta_211 Phosphoglycerate mutase {Fission yeast (Schizosacc 99.9
d1e58a_247 Phosphoglycerate mutase {Escherichia coli [TaxId: 99.87
d1riia_243 Phosphoglycerate mutase {Mycobacterium tuberculosi 99.86
d1h2ea_207 Broad specificity phosphatase PhoE (YhfR) {Bacillu 99.85
d2hhja1248 Phosphoglycerate mutase {Human (Homo sapiens) [Tax 99.82
d1xq9a_241 Phosphoglycerate mutase {Plasmodium falciparum [Ta 99.82
d1bifa2219 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 99.8
d1qhfa_240 Phosphoglycerate mutase {Baker's yeast (Saccharomy 99.79
d1v37a_171 Alpha-ribazole-5'-phosphate phosphatase {Thermus t 99.78
>d1fzta_ c.60.1.1 (A:) Phosphoglycerate mutase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Phosphoglycerate mutase-like
superfamily: Phosphoglycerate mutase-like
family: Cofactor-dependent phosphoglycerate mutase
domain: Phosphoglycerate mutase
species: Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]

Probab=99.90  E-value=1.7e-23  Score=151.38  Aligned_cols=110  Identities=45%  Similarity=0.927  Sum_probs=97.3

Q ss_pred             CcccCCCCCHHHHHHHhhHHHHHhhhhCCCCCCCCCCCHHHHHHHHHHHHHHhhchhccCCCeEEEEeehHHHHHHHHHH
Q 032238            1 MYGELQGLNKQETAERYGKELVHGWRRSYDIPPPNGESLEMCSKQAVAYFREHIEPQLQSGKHVMVAAHGNSLRSIIMYL   80 (144)
Q Consensus         1 ~~G~wEG~~~~ei~~~~p~~~~~~~~~~~~~~~pgGES~~~~~~Rv~~~l~~l~~~~~~~~~~VLvVsHG~vir~ll~~l   80 (144)
                      +||.|||++.+++.+++|......|.+++++++|+|||+.++.+||..++++++.....++++|||||||++|+++++++
T Consensus        95 ~~G~~eG~~~~~~~~~~~~~~~~~~~~~~~~~~p~gEs~~~~~~Rv~~~~~~~~~~~~~~~~~iliVtHg~~ir~ll~~~  174 (211)
T d1fzta_          95 YYGDLQGLNKDDARKKWGAEQVQIWRRSYDIAPPNGESLKDTAERVLPYYKSTIVPHILKGEKVLIAAHGNSLRALIMDL  174 (211)
T ss_dssp             CCGGGTTCBHHHHHHHHHHHHHHHHHSSSSCCSTTCCCHHHHHHHHHHHHHHHHTTHHHHTCCEEEESCHHHHHHHHHHH
T ss_pred             ccccccCCCHHHHHHhchHHHHHHHhcCCcCCCcCCcCHHHHHHHHHHHHHHHHHHHhcCCCeEEEEcCCchHHHHHHHH
Confidence            68999999999999999987777788888899999999999999999999998763323678999999999999999999


Q ss_pred             hCCCccceeeeeecCCcEEEEEEcC-Cceee
Q 032238           81 DKLTSQEVINLELSTGIPLLYIYKE-GRFMK  110 (144)
Q Consensus        81 ~~~~~~~~~~~~~~~g~~~i~~~~~-~~~~~  110 (144)
                      ++++.+.++.+.++||.+.++.+++ ++++.
T Consensus       175 ~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~  205 (211)
T d1fzta_         175 EGLTGDQIVKRELATGVPIVYHLDKDGKYVS  205 (211)
T ss_dssp             HTCCTTTSSSCCCCBSSCEEEEBCSSSCBSS
T ss_pred             HCcCHHHHhhccCCCCCEEEEEEcCCCCEEE
Confidence            9999999999999999999988854 55554
>d1e58a_ c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1riia_ c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1h2ea_ c.60.1.1 (A:) Broad specificity phosphatase PhoE (YhfR) {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2hhja1 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xq9a_ c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1bifa2 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qhfa_ c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v37a_ c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphatase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure