Citrus Sinensis ID: 032259

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140----
MVKSGESTSRVLLILCNLAASNEGRSAILDANGVSILVGMLKESGSDSEATRENCVAALFALGHGNLRFKGLAKEARAAEVLREVEERGSQRAKEKAKRILGMLKGREDDDEDVDWEGVLDSGGPTRSRYRVGMTGYGSNSTNF
ccccccHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccc
ccccccHHHHHHHHHHHHHHcHHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHccccccHcccHHHHHcccccccccEEccccccccccccc
MVKSGESTSRVLLILCNLAASNEGRSAILDANGVSILVGMLkesgsdseaTRENCVAALFALGHGNLRFKGLAKEARAAEVLREVEERGSQRAKEKAKRILGMLkgredddedvdwegvldsggptrsryrvgmtgygsnstnf
MVKSGESTSRVLLILCNLAASNEGRSAILDANGVSILVGMLKESGSDSEATRENCVAALFALGHGNLRFKGLAKEARAAEVLReveergsqrakekakrilgmlkgredddedvdwegvldsggptrsryrvgmtgygsnstnf
MVKSGESTSRVLLILCNLAASNEGRSAILDANGVSILVGMLKESGSDSEATRENCVAALFALGHGNLRFKGlakearaaevlreveerGSQRAKEKAKRILGMLKGRedddedvdweGVLDSGGPTRSRYRVGMTGYGSNSTNF
*********RVLLILCNLAASNEGRSAILDANGVSILVGML***********ENCVAALFALGHGNLRFKGLAK**********************************************************************
*******TSRVLLILCNLAASNEGRSAILDANGVSILVGMLKESG***EATRENCVAALFALGHGNLRFKGLAKEARAAEVLREVEER****AKEKAKRILGML****************************************
*********RVLLILCNLAASNEGRSAILDANGVSILVGMLK*********RENCVAALFALGHGNLRFKGLAKEARAAE****************AKRILGMLKGREDDDEDVDWEGVLDSGGPTRSRYRVGMTGYGSNSTNF
*****ESTSRVLLILCNLAASNEGRSAILDANGVSILVGMLKESGSDSEATRENCVAALFALGHGNLRFKGLAKEARAAEVLREVEERGSQRAKE***RILGMLKGRE*****VDWEGVLD***********************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVKSGESTSRVLLILCNLAASNEGRSAILDANGVSILVGMLKESGSDSEATRENCVAALFALGHGNLRFKGLAKEARAAEVLREVEERGSQRAKEKAKRILGMLKGREDDDEDVDWEGVLDSGGPTRSRYRVGMTGYGSNSTNF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query144 2.2.26 [Sep-21-2011]
Q9FJP6556 U-box domain-containing p yes no 0.923 0.239 0.616 6e-44
Q0WUF6559 U-box domain-containing p no no 1.0 0.257 0.5 2e-32
Q9FL17550 U-box domain-containing p no no 1.0 0.261 0.486 3e-30
Q9STT1509 U-box domain-containing p no no 0.881 0.249 0.532 2e-21
Q8VZ40632 U-box domain-containing p no no 0.652 0.148 0.350 1e-07
Q8GWV5760 U-box domain-containing p no no 0.701 0.132 0.307 1e-05
O22193826 U-box domain-containing p no no 0.659 0.115 0.326 7e-05
Q5VRH9611 U-box domain-containing p no no 0.722 0.170 0.308 0.0002
>sp|Q9FJP6|PUB38_ARATH U-box domain-containing protein 38 OS=Arabidopsis thaliana GN=PUB38 PE=1 SV=1 Back     alignment and function desciption
 Score =  176 bits (445), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 90/146 (61%), Positives = 114/146 (78%), Gaps = 13/146 (8%)

Query: 1   MVKSGESTSRVLLILCNLAASNEGRSAILDANGVSILVGMLKESGSD-------SEATRE 53
           MV+SGES SR LL++CNLA  +EGRSA+LDAN V+ILVG L+E  ++       S + RE
Sbjct: 398 MVRSGESASRALLVICNLACCSEGRSAMLDANAVAILVGKLREEWTEEPTEARSSSSARE 457

Query: 54  NCVAALFALGHGNLRFKGLAKEARAAEVLREVEERGSQRAKEKAKRILGMLKGR--EDDD 111
           NCVAALFAL H +LRFKGLAKEARA EVL+EVEERG++RA+EKAK+IL +++ R  EDD+
Sbjct: 458 NCVAALFALSHESLRFKGLAKEARAVEVLKEVEERGTERAREKAKKILQLMRERVPEDDE 517

Query: 112 ED----VDWEGVLDSGGPTRSRYRVG 133
           ED    +DW+ V+DS G  RSR+RVG
Sbjct: 518 EDGEGSIDWDRVIDSNGSIRSRFRVG 543
Functions as an E3 ubiquitin ligase.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q0WUF6|PUB41_ARATH U-box domain-containing protein 41 OS=Arabidopsis thaliana GN=PUB41 PE=2 SV=1 Back     alignment and function description
>sp|Q9FL17|PUB40_ARATH U-box domain-containing protein 40 OS=Arabidopsis thaliana GN=PUB40 PE=2 SV=2 Back     alignment and function description
>sp|Q9STT1|PUB39_ARATH U-box domain-containing protein 39 OS=Arabidopsis thaliana GN=PUB39 PE=2 SV=1 Back     alignment and function description
>sp|Q8VZ40|PUB14_ARATH U-box domain-containing protein 14 OS=Arabidopsis thaliana GN=PUB14 PE=1 SV=1 Back     alignment and function description
>sp|Q8GWV5|PUB3_ARATH U-box domain-containing protein 3 OS=Arabidopsis thaliana GN=PUB3 PE=2 SV=2 Back     alignment and function description
>sp|O22193|PUB4_ARATH U-box domain-containing protein 4 OS=Arabidopsis thaliana GN=PUB4 PE=1 SV=3 Back     alignment and function description
>sp|Q5VRH9|PUB12_ORYSJ U-box domain-containing protein 12 OS=Oryza sativa subsp. japonica GN=PUB12 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query144
224133420 537 predicted protein [Populus trichocarpa] 1.0 0.268 0.705 3e-51
255540785 518 ubiquitin-protein ligase, putative [Rici 0.965 0.268 0.721 2e-50
225457140 523 PREDICTED: U-box domain-containing prote 0.993 0.273 0.641 2e-45
297797543 547 armadillo/beta-catenin repeat family pro 0.923 0.243 0.623 1e-42
15238366 556 U-box domain-containing protein 38 [Arab 0.923 0.239 0.616 4e-42
356516704 518 PREDICTED: U-box domain-containing prote 0.986 0.274 0.587 4e-37
356508645 525 PREDICTED: U-box domain-containing prote 0.916 0.251 0.586 1e-35
449469681 540 PREDICTED: U-box domain-containing prote 0.937 0.25 0.598 6e-35
449528657 540 PREDICTED: U-box domain-containing prote 0.937 0.25 0.598 6e-35
224119222 477 predicted protein [Populus trichocarpa] 0.722 0.218 0.714 1e-34
>gi|224133420|ref|XP_002321563.1| predicted protein [Populus trichocarpa] gi|222868559|gb|EEF05690.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  206 bits (523), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 103/146 (70%), Positives = 123/146 (84%), Gaps = 2/146 (1%)

Query: 1   MVKSGESTSRVLLILCNLAASNEGRSAILDANGVSILVGMLKESGS-DSEATRENCVAAL 59
           MVKSG+  SR+LL+LCNLAA NEGRSA+LDAN V+ILVG+L+E G  DSE  RENCVAAL
Sbjct: 392 MVKSGDLASRLLLVLCNLAACNEGRSAMLDANAVAILVGILREGGGGDSEVIRENCVAAL 451

Query: 60  FALGHGNLRFKGLAKEARAAEVLREVEERGSQRAKEKAKRILGMLKGREDDDEDVDWEGV 119
           FAL HG++RFKGLAKEARA EVLRE+EERGS RA+EKAKRIL M++GR+++DED+ WE V
Sbjct: 452 FALSHGSMRFKGLAKEARAVEVLREIEERGSNRAREKAKRILMMMRGRDEEDEDICWEEV 511

Query: 120 LDSGGPTRSRYRVGMTGY-GSNSTNF 144
           L+SGG +R+RYR G     G NSTNF
Sbjct: 512 LESGGISRTRYRAGGRNLPGPNSTNF 537

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255540785|ref|XP_002511457.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223550572|gb|EEF52059.1| ubiquitin-protein ligase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225457140|ref|XP_002283638.1| PREDICTED: U-box domain-containing protein 38-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297797543|ref|XP_002866656.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297312491|gb|EFH42915.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15238366|ref|NP_201323.1| U-box domain-containing protein 38 [Arabidopsis thaliana] gi|75262568|sp|Q9FJP6.1|PUB38_ARATH RecName: Full=U-box domain-containing protein 38; AltName: Full=Plant U-box protein 38 gi|10178181|dbj|BAB11655.1| unnamed protein product [Arabidopsis thaliana] gi|51536474|gb|AAU05475.1| At5g65200 [Arabidopsis thaliana] gi|52421297|gb|AAU45218.1| At5g65200 [Arabidopsis thaliana] gi|332010633|gb|AED98016.1| U-box domain-containing protein 38 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356516704|ref|XP_003527033.1| PREDICTED: U-box domain-containing protein 38-like [Glycine max] Back     alignment and taxonomy information
>gi|356508645|ref|XP_003523065.1| PREDICTED: U-box domain-containing protein 38-like [Glycine max] Back     alignment and taxonomy information
>gi|449469681|ref|XP_004152547.1| PREDICTED: U-box domain-containing protein 38-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449528657|ref|XP_004171320.1| PREDICTED: U-box domain-containing protein 38-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224119222|ref|XP_002318018.1| predicted protein [Populus trichocarpa] gi|222858691|gb|EEE96238.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query144
TAIR|locus:2171810556 PUB38 "plant U-box 38" [Arabid 0.923 0.239 0.472 1.5e-25
TAIR|locus:2154124559 AT5G62560 [Arabidopsis thalian 1.0 0.257 0.414 4.9e-23
TAIR|locus:2100372509 PUB39 "PLANT U-BOX 39" [Arabid 0.923 0.261 0.439 7.5e-22
TAIR|locus:2173742550 AT5G40140 [Arabidopsis thalian 1.0 0.261 0.38 5e-19
TAIR|locus:2082682632 PUB14 "plant U-box 14" [Arabid 0.680 0.155 0.287 0.00017
TAIR|locus:2102455760 AT3G54790 [Arabidopsis thalian 0.687 0.130 0.284 0.00021
TAIR|locus:2045334829 PUB4 "plant U-box 4" [Arabidop 0.659 0.114 0.306 0.0003
TAIR|locus:2130699472 AT4G16490 "AT4G16490" [Arabido 0.645 0.197 0.295 0.00051
TAIR|locus:2171810 PUB38 "plant U-box 38" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 296 (109.3 bits), Expect = 1.5e-25, P = 1.5e-25
 Identities = 69/146 (47%), Positives = 89/146 (60%)

Query:     1 MVKSGESTSRVLLILCNLAASNEGRSAILDANGVSILVGMLKESGSD-------SEATRE 53
             MV+SGES SR LL++CNLA  +EGRSA+LDAN V+ILVG L+E  ++       S + RE
Sbjct:   398 MVRSGESASRALLVICNLACCSEGRSAMLDANAVAILVGKLREEWTEEPTEARSSSSARE 457

Query:    54 NCVAALFALGHGNLRFKGXXXXXXXXXXXXXXXXXGSQRAKEKAKRILGMLKGRXXXXXX 113
             NCVAALFAL H +LRFKG                 G++RA+EKAK+IL +++ R      
Sbjct:   458 NCVAALFALSHESLRFKGLAKEARAVEVLKEVEERGTERAREKAKKILQLMRERVPEDDE 517

Query:   114 XXXXG------VLDSGGPTRSRYRVG 133
                 G      V+DS G  RSR+RVG
Sbjct:   518 EDGEGSIDWDRVIDSNGSIRSRFRVG 543
GO:0000151 "ubiquitin ligase complex" evidence=IEA
GO:0004842 "ubiquitin-protein ligase activity" evidence=IEA;IDA
GO:0005634 "nucleus" evidence=ISM
GO:0005871 "kinesin complex" evidence=IEA
GO:0016567 "protein ubiquitination" evidence=IEA;IDA
GO:0019894 "kinesin binding" evidence=IEA
GO:0070696 "transmembrane receptor protein serine/threonine kinase binding" evidence=IPI
TAIR|locus:2154124 AT5G62560 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2100372 PUB39 "PLANT U-BOX 39" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2173742 AT5G40140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082682 PUB14 "plant U-box 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102455 AT3G54790 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045334 PUB4 "plant U-box 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130699 AT4G16490 "AT4G16490" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query144
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 5e-04
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information 
 Score = 35.5 bits (83), Expect = 5e-04
 Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 8/47 (17%)

Query: 21 SNEGRSAILDANGVSILVGMLKESGSDSEATRENCVAALFALGHGNL 67
          S E + A+++A  V  LV +L    S  E  +E    AL      NL
Sbjct: 1  SPENKQAVIEAGAVPPLVQLLS---SPDEEVQEEAAWAL-----SNL 39

Approx. 40 amino acid repeat. Tandem repeats form super-helix of helices that is proposed to mediate interaction of beta-catenin with its ligands. CAUTION: This family does not contain all known armadillo repeats. Length = 41

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 144
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.2
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.16
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.1
KOG4224 550 consensus Armadillo repeat protein VAC8 required f 98.78
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 98.57
KOG4224 550 consensus Armadillo repeat protein VAC8 required f 98.5
PF05804 708 KAP: Kinesin-associated protein (KAP) 98.34
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 98.32
KOG0166 514 consensus Karyopherin (importin) alpha [Intracellu 98.17
PF05804 708 KAP: Kinesin-associated protein (KAP) 98.07
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 98.0
COG5064 526 SRP1 Karyopherin (importin) alpha [Intracellular t 97.73
PF05536 543 Neurochondrin: Neurochondrin 97.7
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 97.62
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 97.39
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 97.35
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 97.3
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 97.27
KOG1048 717 consensus Neural adherens junction protein Plakoph 97.18
KOG4199461 consensus Uncharacterized conserved protein [Funct 97.17
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 97.12
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 97.03
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 97.02
KOG4646173 consensus Uncharacterized conserved protein, conta 96.98
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 96.97
PF05536 543 Neurochondrin: Neurochondrin 96.94
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 96.91
KOG2160 342 consensus Armadillo/beta-catenin-like repeat-conta 96.69
KOG1048717 consensus Neural adherens junction protein Plakoph 96.53
PF12031257 DUF3518: Domain of unknown function (DUF3518); Int 96.52
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 96.37
COG5064 526 SRP1 Karyopherin (importin) alpha [Intracellular t 96.19
KOG3036293 consensus Protein involved in cell differentiation 96.16
KOG4199461 consensus Uncharacterized conserved protein [Funct 96.15
cd00256 429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 95.88
KOG4646173 consensus Uncharacterized conserved protein, conta 95.84
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 94.92
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 94.49
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 94.34
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 94.22
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 94.19
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 93.84
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 93.71
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 92.88
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 92.65
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 92.56
COG5209315 RCD1 Uncharacterized protein involved in cell diff 91.83
KOG4500 604 consensus Rho/Rac GTPase guanine nucleotide exchan 91.79
PF08045257 CDC14: Cell division control protein 14, SIN compo 91.56
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 91.54
KOG1293 678 consensus Proteins containing armadillo/beta-caten 90.59
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 90.42
PF11841160 DUF3361: Domain of unknown function (DUF3361) 89.62
PF11841160 DUF3361: Domain of unknown function (DUF3361) 88.86
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 88.14
PF10165 446 Ric8: Guanine nucleotide exchange factor synembryn 87.72
KOG1222 791 consensus Kinesin associated protein KAP [Intracel 87.45
PF10165 446 Ric8: Guanine nucleotide exchange factor synembryn 87.44
PRK09687280 putative lyase; Provisional 86.12
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 86.08
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 85.35
KOG1222 791 consensus Kinesin associated protein KAP [Intracel 85.13
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 84.56
KOG1293 678 consensus Proteins containing armadillo/beta-caten 84.43
KOG4500 604 consensus Rho/Rac GTPase guanine nucleotide exchan 83.66
KOG3036293 consensus Protein involved in cell differentiation 83.57
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 83.5
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 83.32
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 82.93
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 82.39
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 81.21
cd03567139 VHS_GGA VHS domain family, GGA subfamily; GGA (Gol 80.82
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information 
Probab=99.20  E-value=1.4e-10  Score=115.15  Aligned_cols=100  Identities=13%  Similarity=0.124  Sum_probs=89.5

Q ss_pred             cch-HHHHHHHHHHhcCChhhHHHHHhcCc-HHHHHHHhhcCCCCChHHHHHHHHHHHHHhccChHHHHHHHHcCcHHHH
Q 032259            5 GES-TSRVLLILCNLAASNEGRSAILDANG-VSILVGMLKESGSDSEATRENCVAALFALGHGNLRFKGLAKEARAAEVL   82 (144)
Q Consensus         5 ~~~-~E~AlavL~~La~~~egr~aI~~~g~-I~~LV~lL~~G~~~S~~~kE~Ava~L~~Lc~~~~~~~~~a~~~Gai~~L   82 (144)
                      ... .|.|+.+|..|+.|++||+++.++++ ||.++ ++..+   |+..+|.|+.+||.||...+.++..+.+.|++..|
T Consensus      1372 ~~~~~E~Al~vLd~Lc~~eegre~~~~h~a~vplV~-~ilrv---S~~a~E~AV~aL~kl~~~~~~v~~Emv~~G~~~kl 1447 (2102)
T PLN03200       1372 SSTAQEAGVCALDRLLDDEQLAELVAAHGAVVPLVG-LVVGT---NYVLHEAAISALIKLGKDRPPCKLDMVKAGIIERV 1447 (2102)
T ss_pred             CchHHHHHHHHHHHHhcCHhhHHHHHHcCChhhHHH-HHHcC---CHHHHHHHHHHHHHHhCCChHHHHHHHHhCHHHHH
Confidence            344 89999999999999999999998775 55555 55554   89999999999999998888889999999999999


Q ss_pred             HHHHHhCCHHHHHHHHHHHHHhhcCC
Q 032259           83 REVEERGSQRAKEKAKRILGMLKGRE  108 (144)
Q Consensus        83 ~~Ll~~Gt~raK~kA~~lL~~L~~~~  108 (144)
                      +.+++..+.+.|+||+.+|++|+...
T Consensus      1448 lllLQ~c~~~lkekAaeLLrlL~~~~ 1473 (2102)
T PLN03200       1448 LDILPEAPDSLCSAIAELLRILTNNS 1473 (2102)
T ss_pred             HHHHHcCCHHHHHHHHHHHHHhccch
Confidence            99999999999999999999999865

>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>COG5209 RCD1 Uncharacterized protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03567 VHS_GGA VHS domain family, GGA subfamily; GGA (Golgi-localized, Gamma-ear-containing, Arf-binding) comprise a subfamily of ubiquitously expressed, monomeric, motif-binding cargo/clathrin adaptor proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query144
3nmz_A458 APC variant protein; protein-protein complex, arma 3e-10
3nmz_A 458 APC variant protein; protein-protein complex, arma 8e-05
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 1e-09
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-08
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-06
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 1e-05
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 2e-09
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 2e-08
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 2e-06
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 4e-06
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 4e-06
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 7e-06
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 2e-09
3nmw_A 354 APC variant protein; ARMADIILO repeats domain, cel 5e-05
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-09
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 1e-07
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-07
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 1e-06
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 5e-06
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 1e-05
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 1e-06
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 6e-06
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 1e-05
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 9e-06
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 1e-05
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 3e-05
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 7e-05
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 9e-05
3gjx_A1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 1e-04
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 2e-04
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 7e-04
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
 Score = 55.7 bits (134), Expect = 3e-10
 Identities = 15/88 (17%), Positives = 32/88 (36%), Gaps = 3/88 (3%)

Query: 14  ILCNLAASNEGRSAILDANGVSILVGMLKESGSDSEATRENCVAALFALGHGNLRFKGLA 73
           +   +A + + R  + + N +  L+  LK   S S     N    L+ L   N + +   
Sbjct: 361 VSSLIATNEDHRQILRENNCLQTLLQHLK---SHSLTIVSNACGTLWNLSARNPKDQEAL 417

Query: 74  KEARAAEVLREVEERGSQRAKEKAKRIL 101
            +  A  +L+ +     +     +   L
Sbjct: 418 WDMGAVSMLKNLIHSKHKMIAMGSAAAL 445
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Length = 1073 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query144
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.46
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.46
3nmz_A458 APC variant protein; protein-protein complex, arma 99.39
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.31
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.29
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.26
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.26
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.25
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.24
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.23
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.19
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.17
3nmz_A458 APC variant protein; protein-protein complex, arma 99.17
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.16
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.15
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.13
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.05
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.04
1xqr_A 296 HSPBP1 protein; armadillo repeat, superhelical twi 99.01
3ul1_B 510 Importin subunit alpha-2; arm repeat, armadillo re 98.99
3ul1_B 510 Importin subunit alpha-2; arm repeat, armadillo re 98.97
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 98.94
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 98.87
3tpo_A 529 Importin subunit alpha-2; nuclear import, protein 98.87
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 98.82
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 98.8
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 98.78
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 98.73
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 98.7
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 98.69
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 98.67
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 98.67
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 98.66
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 98.66
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 98.64
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 98.59
3opb_A 778 SWI5-dependent HO expression protein 4; heat and a 98.5
3opb_A 778 SWI5-dependent HO expression protein 4; heat and a 98.16
3grl_A 651 General vesicular transport factor P115; vesicle t 97.31
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 97.23
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 97.01
3grl_A 651 General vesicular transport factor P115; vesicle t 95.96
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 95.73
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 95.58
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 95.4
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 95.19
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 95.13
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 95.04
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 94.27
1oyz_A 280 Hypothetical protein YIBA; structural genomics, PS 93.81
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 92.85
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 92.79
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 92.54
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 92.3
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 90.96
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 87.48
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 87.3
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 87.29
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 87.05
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 84.91
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 84.22
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 82.94
1qgr_A 876 Protein (importin beta subunit); transport recepto 81.13
1qgr_A 876 Protein (importin beta subunit); transport recepto 80.54
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
Probab=99.46  E-value=5.6e-13  Score=106.33  Aligned_cols=99  Identities=18%  Similarity=0.141  Sum_probs=90.4

Q ss_pred             chHHHHHHHHHHhcC-ChhhHHHHHhcCcHHHHHHHhhcCCCCChHHHHHHHHHHHHHhccChHHHHHHHHcCcHHHHHH
Q 032259            6 ESTSRVLLILCNLAA-SNEGRSAILDANGVSILVGMLKESGSDSEATRENCVAALFALGHGNLRFKGLAKEARAAEVLRE   84 (144)
Q Consensus         6 ~~~E~AlavL~~La~-~~egr~aI~~~g~I~~LV~lL~~G~~~S~~~kE~Ava~L~~Lc~~~~~~~~~a~~~Gai~~L~~   84 (144)
                      .+...|+..|.+|+. ++++|..|.+.|+||+||++|+++   ++..|++|+.+|.+|+.+++..+..+.+.|+||+|+.
T Consensus        25 ~~q~~Aa~~l~~L~~~~~~~r~~I~~~G~Ip~LV~lL~s~---~~~vq~~Aa~aL~nLa~~~~~nk~~I~~~GaI~~Lv~  101 (233)
T 3tt9_A           25 SRISAAATFIQHECFQKSEARKRVNQLRGILKLLQLLKVQ---NEDVQRAVCGALRNLVFEDNDNKLEVAELNGVPRLLQ  101 (233)
T ss_dssp             HHHHHHHHHHHHHHHHCHHHHHHHHHTTHHHHHHHGGGCC---CHHHHHHHHHHHHHHHTTCHHHHHHHHHTTHHHHHHH
T ss_pred             HHHHHHHHHHHHHHcCCcHHHHHHHHcCCHHHHHHHHcCC---CHHHHHHHHHHHHHHHhCCHHHHHHHHHcCCHHHHHH
Confidence            345678899999994 899999999999999999999987   8999999999999999977777888889999999999


Q ss_pred             HHHh-CCHHHHHHHHHHHHHhhcC
Q 032259           85 VEER-GSQRAKEKAKRILGMLKGR  107 (144)
Q Consensus        85 Ll~~-Gt~raK~kA~~lL~~L~~~  107 (144)
                      |+.. +++..++.|+.+|+.|+..
T Consensus       102 lL~~~~~~~~~e~a~~aL~nLS~~  125 (233)
T 3tt9_A          102 VLKQTRDLETKKQITGLLWNLSSN  125 (233)
T ss_dssp             HHHHCCCHHHHHHHHHHHHHHHTS
T ss_pred             HHccCCCHHHHHHHHHHHHHHHcC
Confidence            9984 7999999999999999875
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 144
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 6e-09
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 2e-07
d1xm9a1 457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 4e-06
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: beta-Catenin
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 51.0 bits (120), Expect = 6e-09
 Identities = 19/103 (18%), Positives = 31/103 (30%), Gaps = 4/103 (3%)

Query: 2   VKSGESTSRVLLILCNLAASNEGRSAILDANGVSILVGMLKESGSDSEATRENCVAALFA 61
           V+  E        L  LA     R  I   N + + V +L    S  E  +      L  
Sbjct: 430 VRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLY---SPIENIQRVAAGVLCE 486

Query: 62  LGHGNLRFKGLAKEARAAEVLREVEERGSQRAKEKAKRILGML 104
           L   +       +   A   L E+    ++     A  +L  +
Sbjct: 487 LAQ-DKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRM 528
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query144
d1xm9a1 457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.24
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.17
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.03
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.0
d1xm9a1 457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 98.81
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 98.79
d1q1sc_ 434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 98.68
d1wa5b_ 503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 98.6
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 98.42
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 98.21
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 94.77
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 94.24
d1qbkb_ 888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 87.61
d1oyza_ 276 Hypothetical protein YibA {Escherichia coli [TaxId 87.0
d1oyza_ 276 Hypothetical protein YibA {Escherichia coli [TaxId 86.87
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 85.25
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Plakophilin 1 helical region
domain: Plakophilin 1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.24  E-value=5.5e-11  Score=91.32  Aligned_cols=102  Identities=12%  Similarity=0.149  Sum_probs=92.4

Q ss_pred             CcchHHHHHHHHHHhcC-ChhhHHHHHhcCcHHHHHHHhhcCCCCChHHHHHHHHHHHHHhccChHHHHHHHHcCcHHHH
Q 032259            4 SGESTSRVLLILCNLAA-SNEGRSAILDANGVSILVGMLKESGSDSEATRENCVAALFALGHGNLRFKGLAKEARAAEVL   82 (144)
Q Consensus         4 ~~~~~E~AlavL~~La~-~~egr~aI~~~g~I~~LV~lL~~G~~~S~~~kE~Ava~L~~Lc~~~~~~~~~a~~~Gai~~L   82 (144)
                      +..+...|+..|.+||. ++++|..|.+.|+||+|+++|++.   ++..|++|+.+|.+|+..++..+..+.+.|+++.|
T Consensus        15 ~~~~~~~a~~~l~~l~~~~~~~~~~i~~~g~i~~Lv~lL~~~---~~~v~~~a~~aL~~L~~~~~~~~~~i~~~g~v~~l   91 (457)
T d1xm9a1          15 DEKYQAIGAYYIQHTCFQDESAKQQVYQLGGICKLVDLLRSP---NQNVQQAAAGALRNLVFRSTTNKLETRRQNGIREA   91 (457)
T ss_dssp             CTHHHHHHHHHHHHHTSSCSSHHHHHHHTTHHHHHHHHTTSS---CHHHHHHHHHHHHHHHSSCHHHHHHHHHTTCHHHH
T ss_pred             CHHHHHHHHHHHHHHHcCCHHHHHHHHHCCcHHHHHHHHCCC---CHHHHHHHHHHHHHHHcCCHHHHHHHHHCCChHHH
Confidence            45678999999999995 789999999999999999999986   89999999999999999888888888999999999


Q ss_pred             HHHHHh-CCHHHHHHHHHHHHHhhcCC
Q 032259           83 REVEER-GSQRAKEKAKRILGMLKGRE  108 (144)
Q Consensus        83 ~~Ll~~-Gt~raK~kA~~lL~~L~~~~  108 (144)
                      +.++.. .++..+..|..+|..|....
T Consensus        92 i~~l~~~~~~~~~~~a~~~l~~l~~~~  118 (457)
T d1xm9a1          92 VSLLRRTGNAEIQKQLTGLLWNLSSTD  118 (457)
T ss_dssp             HHHHTTCCCHHHHHHHHHHHHHHHTSS
T ss_pred             HHHHhccCcHHHHHHHHHHHHHHHhhh
Confidence            999865 58999999999999998753
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure