Citrus Sinensis ID: 032398


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-
MGEEGNPKSCDRSERKQRKKKENFLVEITGKTDEEDEASRVENNLKSNVAEIGEADVIGKEKELNLMEEGKQEELNLKKRRSQSIVKSKKKQRLLEEAAKADRCGICYLSRIPAHMDPVKLRQILSQYGEIQRIYLAPEDP
ccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHcccccccccccccccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccccccccHHHHHHHHHHHccccEEEEccccc
cccccccccccccccccccccccccccccccccHHcccccccccHHHcHHHcccccccccccHcccHHHccHHHccccccccHcHcccHHHHHHHHHHHHHcccEEEEEEcccccccHHHHHHHHHHcccccEEEEccccc
mgeegnpkscdrseRKQRKKKENFLVEItgktdeedeASRVENNLKSNvaeigeadvigkekelnLMEEGKQEELNLKKRRSQSIVKSKKKQRLLEEAAKAdrcgicylsripahmdpvKLRQILSQYGEIqriylapedp
mgeegnpkscdrserkqrkkkenflveitgktdeedeasrvennlksnvaeigeadvigkekelnlmeegkqeelnlkkrrsqsivkskkkqrlleeaakadrcgICYLsripahmdpVKLRQILSQYgeiqriylapedp
MGEEGNPKSCDRSERKQRKKKENFLVEITGKTDEEDEASRVENNLKSNVAEIGEADVIGKEKELNLMEEGKQEELNLKKRRSQSIVKSKKKQRLLEEAAKADRCGICYLSRIPAHMDPVKLRQILSQYGEIQRIYLAPEDP
***************************************************************************************************KADRCGICYLSRIPAHMDPVKLRQILSQYGEIQRIY******
********************************************************************************************************GICYLSRIPAHMDPVKLRQILSQYGEIQRIYLAP***
*******************KKENFLVEITGK*********VENNLKSNVAEIGEADVIGKEKELNLMEEGKQEE***********************AAKADRCGICYLSRIPAHMDPVKLRQILSQYGEIQRIYLAPEDP
***********************************************************************************SIVKSKKKQRLLEEAAKADRCGICYLSRIPAHMDPVKLRQILSQYGEIQRIYLAP***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGEEGNPKSCDRSERKQRKKKENFLVEITGKTDEEDEASRVENNLKSNVAEIGEADVIGKEKELNLMEEGKQEELNLKKRRSQSIVKSKKKQRLLEEAAKADRCGICYLSRIPAHMDPVKLRQILSQYGEIQRIYLAPEDP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query141 2.2.26 [Sep-21-2011]
Q59YL9 320 Pre-rRNA-processing prote N/A no 0.340 0.15 0.541 5e-12
Q4HZ47 321 Pre-rRNA-processing prote yes no 0.404 0.177 0.473 1e-10
O74362 334 Pre-rRNA-processing prote yes no 0.262 0.110 0.702 2e-10
Q6BSS5 303 Pre-rRNA-processing prote yes no 0.517 0.240 0.390 2e-10
A3LVD5 347 Pre-rRNA-processing prote yes no 0.390 0.158 0.472 4e-10
Q2GZQ4 332 Pre-rRNA-processing prote N/A no 0.404 0.171 0.473 6e-10
Q7S8W7 340 Pre-rRNA-processing prote N/A no 0.368 0.152 0.5 1e-09
Q6FWS2 309 Pre-rRNA-processing prote yes no 0.269 0.122 0.578 2e-08
Q0UM32 326 Pre-rRNA-processing prote N/A no 0.297 0.128 0.476 2e-07
Q6CSP8 293 Pre-rRNA-processing prote yes no 0.269 0.129 0.5 2e-07
>sp|Q59YL9|ESF2_CANAL Pre-rRNA-processing protein ESF2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ESF2 PE=3 SV=2 Back     alignment and function desciption
 Score = 69.7 bits (169), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%)

Query: 94  LLEEAAKADRCGICYLSRIPAHMDPVKLRQILSQYGEIQRIYLAPEDP 141
           L +E  +  R G+CYLSR+P +M P KLR +LS++GEI R++L PEDP
Sbjct: 113 LAKEQKRIKRTGVCYLSRVPPYMKPAKLRSVLSRFGEIDRLFLKPEDP 160




Involved in the small subunit (SSU) processome assembly and function, and in the 18S rRNA synthesis. Required for the early cleavages at sites A0, A1 and A2.
Candida albicans (strain SC5314 / ATCC MYA-2876) (taxid: 237561)
>sp|Q4HZ47|ESF2_GIBZE Pre-rRNA-processing protein ESF2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ESF2 PE=3 SV=1 Back     alignment and function description
>sp|O74362|ESF2_SCHPO Pre-rRNA-processing protein esf2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=esf2 PE=1 SV=1 Back     alignment and function description
>sp|Q6BSS5|ESF2_DEBHA Pre-rRNA-processing protein ESF2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ESF2 PE=3 SV=2 Back     alignment and function description
>sp|A3LVD5|ESF2_PICST Pre-rRNA-processing protein ESF2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ESF2 PE=3 SV=2 Back     alignment and function description
>sp|Q2GZQ4|ESF2_CHAGB Pre-rRNA-processing protein ESF2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ESF2 PE=3 SV=2 Back     alignment and function description
>sp|Q7S8W7|ESF2_NEUCR Pre-rRNA-processing protein esf-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=esf-2 PE=3 SV=1 Back     alignment and function description
>sp|Q6FWS2|ESF2_CANGA Pre-rRNA-processing protein ESF2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ESF2 PE=3 SV=1 Back     alignment and function description
>sp|Q0UM32|ESF2_PHANO Pre-rRNA-processing protein ESF2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ESF2 PE=3 SV=1 Back     alignment and function description
>sp|Q6CSP8|ESF2_KLULA Pre-rRNA-processing protein ESF2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ESF2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query141
449450052 380 PREDICTED: pre-rRNA-processing protein E 0.382 0.142 0.777 1e-17
449530761 326 PREDICTED: pre-rRNA-processing protein e 0.382 0.165 0.777 2e-17
225456507 257 PREDICTED: pre-rRNA-processing protein E 0.319 0.175 0.844 8e-16
297734519 344 unnamed protein product [Vitis vinifera] 0.319 0.130 0.844 9e-16
147860851 486 hypothetical protein VITISV_022556 [Viti 0.319 0.092 0.844 2e-15
255570173 406 Activator of basal transcription, putati 0.304 0.105 0.813 1e-13
30694465 257 RNA recognition motif-containing protein 0.304 0.167 0.744 2e-12
297820414 256 hypothetical protein ARALYDRAFT_486092 [ 0.304 0.167 0.720 4e-12
7594529 266 putative protein [Arabidopsis thaliana] 0.297 0.157 0.738 1e-11
357496967 314 Pre-rRNA-processing protein esf2 [Medica 0.255 0.114 0.805 1e-11
>gi|449450052|ref|XP_004142778.1| PREDICTED: pre-rRNA-processing protein ESF2-like [Cucumis sativus] Back     alignment and taxonomy information
 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 42/54 (77%), Positives = 49/54 (90%)

Query: 87  KSKKKQRLLEEAAKADRCGICYLSRIPAHMDPVKLRQILSQYGEIQRIYLAPED 140
           K K+K++LL+EAA AD  GICYLSR+P HMDP+KLRQILSQ+GEIQRIYLAPED
Sbjct: 154 KIKRKKQLLKEAANADMRGICYLSRVPPHMDPLKLRQILSQHGEIQRIYLAPED 207




Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449530761|ref|XP_004172361.1| PREDICTED: pre-rRNA-processing protein esf2-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|225456507|ref|XP_002284683.1| PREDICTED: pre-rRNA-processing protein ESF2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297734519|emb|CBI15766.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147860851|emb|CAN83161.1| hypothetical protein VITISV_022556 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255570173|ref|XP_002526047.1| Activator of basal transcription, putative [Ricinus communis] gi|223534628|gb|EEF36324.1| Activator of basal transcription, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|30694465|ref|NP_191210.2| RNA recognition motif-containing protein [Arabidopsis thaliana] gi|79315331|ref|NP_001030873.1| RNA recognition motif-containing protein [Arabidopsis thaliana] gi|38564304|gb|AAR23731.1| At3g56510 [Arabidopsis thaliana] gi|45592922|gb|AAS68115.1| At3g56510 [Arabidopsis thaliana] gi|110736352|dbj|BAF00145.1| hypothetical protein [Arabidopsis thaliana] gi|332646008|gb|AEE79529.1| RNA recognition motif-containing protein [Arabidopsis thaliana] gi|332646009|gb|AEE79530.1| RNA recognition motif-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297820414|ref|XP_002878090.1| hypothetical protein ARALYDRAFT_486092 [Arabidopsis lyrata subsp. lyrata] gi|297323928|gb|EFH54349.1| hypothetical protein ARALYDRAFT_486092 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|7594529|emb|CAB88054.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357496967|ref|XP_003618772.1| Pre-rRNA-processing protein esf2 [Medicago truncatula] gi|355493787|gb|AES74990.1| Pre-rRNA-processing protein esf2 [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query141
TAIR|locus:2102594 257 AT3G56510 [Arabidopsis thalian 0.574 0.315 0.535 2e-17
CGD|CAL0002361 320 orf19.3161 [Candida albicans ( 0.758 0.334 0.362 1.5e-12
POMBASE|SPBC28E12.05 334 esf2 "U3 snoRNP-associated pro 0.971 0.410 0.302 1.7e-10
SGD|S000005337 316 ESF2 "Essential nucleolar prot 0.985 0.439 0.273 8.8e-10
UNIPROTKB|G4N0U5 330 MGG_05815 "Pre-rRNA-processing 0.773 0.330 0.310 7.3e-08
DICTYBASE|DDB_G0293576 296 esf2 "U3 snoRNP-associated pro 0.808 0.385 0.301 1.6e-07
FB|FBgn0052708 239 CG32708 [Drosophila melanogast 0.290 0.171 0.536 5.5e-07
ZFIN|ZDB-GENE-050522-127 305 abt1 "activator of basal trans 0.773 0.357 0.327 7.8e-07
TAIR|locus:2168143292 AT5G60030 [Arabidopsis thalian 0.709 0.342 0.330 5.4e-06
GENEDB_PFALCIPARUM|PFL1595w135 PFL1595w "hypothetical protein 0.609 0.637 0.354 1.9e-05
TAIR|locus:2102594 AT3G56510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 213 (80.0 bits), Expect = 2.0e-17, P = 2.0e-17
 Identities = 45/84 (53%), Positives = 61/84 (72%)

Query:    60 KEKELNLMEEGKQEELNLKKR-RSQSIVKSKKK--QRLLEEAAKADRCGICYLSRIPAHM 116
             + +E + + +G  EE   K+  +SQ   + KKK  ++LL+EA+KAD  G+CYLSRIP HM
Sbjct:     2 QSEESHELTDGISEEKESKETMKSQKADRKKKKLKEKLLKEASKADNRGVCYLSRIPPHM 61

Query:   117 DPVKLRQILSQYGEIQRIYLAPED 140
             D V+LR IL+QYGE+ RIYLAPED
Sbjct:    62 DHVRLRHILAQYGELGRIYLAPED 85




GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0017025 "TBP-class protein binding" evidence=ISS
CGD|CAL0002361 orf19.3161 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
POMBASE|SPBC28E12.05 esf2 "U3 snoRNP-associated protein Esf2 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
SGD|S000005337 ESF2 "Essential nucleolar protein involved in pre-18S rRNA processing" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|G4N0U5 MGG_05815 "Pre-rRNA-processing protein ESF2" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0293576 esf2 "U3 snoRNP-associated protein Esf2" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
FB|FBgn0052708 CG32708 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050522-127 abt1 "activator of basal transcription 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2168143 AT5G60030 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PFL1595w PFL1595w "hypothetical protein, conserved" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00018051001
SubName- Full=Chromosome chr17 scaffold_16, whole genome shotgun sequence; (257 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00034559001
SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (840 aa)
     0.736
GSVIVG00007719001
SubName- Full=Chromosome chr3 scaffold_199, whole genome shotgun sequence; (387 aa)
      0.705
GSVIVG00000661001
SubName- Full=Chromosome chr8 scaffold_106, whole genome shotgun sequence; (701 aa)
     0.658
GSVIVG00037695001
SubName- Full=Chromosome undetermined scaffold_91, whole genome shotgun sequence; (245 aa)
     0.655
GSVIVG00019376001
SubName- Full=Chromosome chr7 scaffold_20, whole genome shotgun sequence; (1041 aa)
      0.634
GSVIVG00038815001
SubName- Full=Chromosome chr5 scaffold_98, whole genome shotgun sequence; (1139 aa)
     0.608
GSVIVG00000597001
SubName- Full=Chromosome chr8 scaffold_106, whole genome shotgun sequence; (926 aa)
      0.590
GSVIVG00038090001
SubName- Full=Chromosome chr14 scaffold_9, whole genome shotgun sequence; (182 aa)
       0.585
GSVIVG00013990001
SubName- Full=Chromosome chr16 scaffold_10, whole genome shotgun sequence; (900 aa)
     0.579
GSVIVG00033408001
SubName- Full=Chromosome chr19 scaffold_66, whole genome shotgun sequence; (430 aa)
       0.555

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query141
cd1226398 cd12263, RRM_ABT1_like, RNA recognition motif foun 1e-17
>gnl|CDD|240709 cd12263, RRM_ABT1_like, RNA recognition motif found in activator of basal transcription 1 (ABT1) and similar proteins Back     alignment and domain information
 Score = 72.2 bits (178), Expect = 1e-17
 Identities = 28/37 (75%), Positives = 31/37 (83%)

Query: 105 GICYLSRIPAHMDPVKLRQILSQYGEIQRIYLAPEDP 141
           GI YLSRIP  M+P KLRQ+LSQYGE+ RIYL PEDP
Sbjct: 1   GIVYLSRIPPRMNPAKLRQLLSQYGEVGRIYLQPEDP 37


This subfamily corresponds to the RRM of novel nuclear proteins termed ABT1 and its homologous counterpart, pre-rRNA-processing protein ESF2 (eighteen S factor 2), from yeast. ABT1 associates with the TATA-binding protein (TBP) and enhances basal transcription activity of class II promoters. Meanwhile, ABT1 could be a transcription cofactor that can bind to DNA in a sequence-independent manner. The yeast ABT1 homolog, ESF2, is a component of 90S preribosomes and 5' ETS-based RNPs. It is previously identified as a putative partner of the TATA-element binding protein. However, it is primarily localized to the nucleolus and physically associates with pre-rRNA processing factors. ESF2 may play a role in ribosome biogenesis. It is required for normal pre-rRNA processing, as well as for SSU processome assembly and function. Both ABT1 and ESF2 contain an RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain). . Length = 98

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 141
KOG3152 278 consensus TBP-binding protein, activator of basal 99.74
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 98.23
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 98.04
KOG4208 214 consensus Nucleolar RNA-binding protein NIFK [Gene 98.03
smart0036272 RRM_2 RNA recognition motif. 97.96
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 97.73
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 97.29
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 97.24
smart0036071 RRM RNA recognition motif. 97.08
COG0724 306 RNA-binding proteins (RRM domain) [General functio 96.97
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 96.67
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 96.56
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 96.35
KOG0148 321 consensus Apoptosis-promoting RNA-binding protein 96.33
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 96.32
KOG0113 335 consensus U1 small nuclear ribonucleoprotein (RRM 96.32
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 96.29
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 96.11
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 96.09
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 96.01
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 96.0
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 95.98
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 95.85
KOG0122270 consensus Translation initiation factor 3, subunit 95.52
PLN03213 759 repressor of silencing 3; Provisional 95.2
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 95.18
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 95.11
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 94.65
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 94.53
KOG0114124 consensus Predicted RNA-binding protein (RRM super 94.37
KOG0121153 consensus Nuclear cap-binding protein complex, sub 94.19
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 93.87
KOG0126 219 consensus Predicted RNA-binding protein (RRM super 93.87
KOG0145 360 consensus RNA-binding protein ELAV/HU (RRM superfa 93.71
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 93.64
KOG0107 195 consensus Alternative splicing factor SRp20/9G8 (R 93.25
KOG4205 311 consensus RNA-binding protein musashi/mRNA cleavag 92.38
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 91.72
KOG0149 247 consensus Predicted RNA-binding protein SEB4 (RRM 91.46
KOG0125 376 consensus Ataxin 2-binding protein (RRM superfamil 91.36
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 90.91
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 90.73
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 88.9
KOG0533 243 consensus RRM motif-containing protein [RNA proces 88.42
KOG1548 382 consensus Transcription elongation factor TAT-SF1 85.87
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 85.7
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 85.22
KOG0124 544 consensus Polypyrimidine tract-binding protein PUF 84.64
KOG0132 894 consensus RNA polymerase II C-terminal domain-bind 83.96
KOG0108 435 consensus mRNA cleavage and polyadenylation factor 83.86
PF1551362 DUF4651: Domain of unknown function (DUF4651) 80.71
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
Probab=99.74  E-value=1.3e-18  Score=147.12  Aligned_cols=58  Identities=55%  Similarity=0.884  Sum_probs=47.5

Q ss_pred             hhhhhhhHHHHHHHHhhcCCcceEEecCCCCCCCHHHHHHHhhccCccceEEeccCCC
Q 032398           84 SIVKSKKKQRLLEEAAKADRCGICYLSRIPAHMDPVKLRQILSQYGEIQRIYLAPEDP  141 (141)
Q Consensus        84 ~~~kkkkkK~L~~~~~k~~k~GVIYLSrIPpgM~p~kLR~~fsqfGeV~RIyL~pEd~  141 (141)
                      +..+.++...+....++..++||||||||||+|+|.+||+||++||+||||||+||+.
T Consensus        54 ~~l~~~k~~~~~~a~~kkrk~GVvylS~IPp~m~~~rlReil~~yGeVGRvylqpE~~  111 (278)
T KOG3152|consen   54 KELKEKKLTELSEAKAKKRKTGVVYLSNIPPYMDPVRLREILSQYGEVGRVYLQPEDD  111 (278)
T ss_pred             hhhhhhhhcccchhhhhhccceEEEeccCCCccCHHHHHHHHHhccccceEEecchhh
Confidence            3344444445555555566999999999999999999999999999999999999973



>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>PF15513 DUF4651: Domain of unknown function (DUF4651) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query141
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 4e-06
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
 Score = 43.6 bits (102), Expect = 4e-06
 Identities = 15/70 (21%), Positives = 30/70 (42%), Gaps = 2/70 (2%)

Query: 34  EEDEASRVENNLKSNVAEIGEADVIGKEKELNLMEEGKQEELNLKKRRSQSIVKSKKKQR 93
           +E E+ R     +     + E D   K  E    E+ K++     +R+S+ + K+K   R
Sbjct: 82  QEPESIRKWR--EEQRKRLQELDAASKVMEQEWREKAKKDLEEWNQRQSEQVEKNKINNR 139

Query: 94  LLEEAAKADR 103
           + ++A     
Sbjct: 140 IADKAFYQQP 149


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query141
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 98.12
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 98.11
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 98.08
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 98.08
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 98.07
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 98.06
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 98.06
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 98.05
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 98.04
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 98.04
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 98.04
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 98.03
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 98.03
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 98.03
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 98.03
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 98.02
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 98.0
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 98.0
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 98.0
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 98.0
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 97.99
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 97.99
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 97.99
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 97.99
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 97.98
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 97.98
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 97.98
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 97.98
1x4e_A85 RNA binding motif, single-stranded interacting pro 97.97
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 97.97
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 97.97
2cph_A107 RNA binding motif protein 19; RNA recognition moti 97.97
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 97.96
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 97.96
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 97.96
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 97.96
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 97.95
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 97.95
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 97.94
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 97.93
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 97.93
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 97.93
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 97.93
2cpj_A99 Non-POU domain-containing octamer-binding protein; 97.92
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 97.92
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 97.91
2div_A99 TRNA selenocysteine associated protein; structural 97.91
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 97.91
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 97.9
2krb_A81 Eukaryotic translation initiation factor 3 subunit 97.9
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 97.9
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 97.9
2cqd_A116 RNA-binding region containing protein 1; RNA recog 97.9
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 97.9
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 97.9
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 97.89
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 97.89
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 97.89
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 97.88
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 97.88
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 97.88
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 97.88
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 97.87
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 97.87
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 97.87
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 97.87
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 97.86
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 97.86
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 97.86
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 97.85
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 97.85
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 97.85
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 97.85
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 97.84
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 97.84
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 97.84
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 97.83
1x5o_A114 RNA binding motif, single-stranded interacting pro 97.83
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 97.81
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 97.81
2i2y_A150 Fusion protein consists of immunoglobin G- binding 97.81
2la6_A99 RNA-binding protein FUS; structural genomics, nort 97.81
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 97.81
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 97.81
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 97.8
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 97.8
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 97.8
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 97.8
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 97.79
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 97.79
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 97.79
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 97.78
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 97.78
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 97.77
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 97.77
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 97.76
2dis_A109 Unnamed protein product; structural genomics, RRM 97.74
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 97.74
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 97.74
4f02_A 213 Polyadenylate-binding protein 1; mRNA, eukaryotic 97.74
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 97.74
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 97.73
2kt5_A124 RNA and export factor-binding protein 2; chaperone 97.72
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 97.71
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 97.71
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 97.71
3p5t_L90 Cleavage and polyadenylation specificity factor S; 97.69
1l3k_A 196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 97.69
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 97.68
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 97.67
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 97.67
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 97.66
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 97.64
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 97.62
2qfj_A 216 FBP-interacting repressor; protein-DNA complex; HE 97.61
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 97.61
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 97.61
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 97.6
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 97.59
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 97.59
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 97.59
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 97.58
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 97.56
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 97.56
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 97.54
2dnl_A114 Cytoplasmic polyadenylation element binding protei 97.54
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 97.54
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 97.52
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 97.52
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 97.51
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 97.49
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 97.48
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 97.47
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 97.46
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 97.45
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 97.44
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 97.43
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 97.43
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 97.43
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 97.42
2adc_A 229 Polypyrimidine tract-binding protein 1; RBD, RRM, 97.41
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 97.41
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 97.4
3n9u_C156 Cleavage and polyadenylation specificity factor S; 97.39
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 97.37
2f3j_A177 RNA and export factor binding protein 2; RRM domai 97.37
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 97.36
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 97.36
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 97.34
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 97.33
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 97.3
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 97.29
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 97.28
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 97.27
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 97.27
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 97.26
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 97.26
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 97.26
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 97.25
3q2s_C 229 Cleavage and polyadenylation specificity factor S; 97.25
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 97.24
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 97.22
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 97.21
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 97.21
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 97.21
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 96.27
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 97.19
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 97.19
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 97.13
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 97.09
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 97.09
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 97.03
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 97.0
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 96.97
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 96.96
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 96.87
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 96.84
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 96.79
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 96.7
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 96.59
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 96.58
1x5p_A97 Negative elongation factor E; structure genomics, 96.57
1fje_B 175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 96.35
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 96.35
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 96.02
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 95.29
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 95.25
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 95.07
2dit_A112 HIV TAT specific factor 1 variant; structural geno 95.04
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 94.24
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 93.02
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 92.27
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 90.73
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 90.52
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 89.27
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 88.05
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 87.72
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 85.51
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 82.01
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 81.31
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 80.89
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
Probab=98.12  E-value=3.2e-06  Score=54.65  Aligned_cols=39  Identities=10%  Similarity=0.336  Sum_probs=35.0

Q ss_pred             cCCcceEEecCCCCCCCHHHHHHHhhccCccceEEeccC
Q 032398          101 ADRCGICYLSRIPAHMDPVKLRQILSQYGEIQRIYLAPE  139 (141)
Q Consensus       101 ~~k~GVIYLSrIPpgM~p~kLR~~fsqfGeV~RIyL~pE  139 (141)
                      ...+-.|||+.||+.+++..|+++|++||.|.++++.+.
T Consensus         8 ~~~~~~l~V~nlp~~~t~~~l~~~F~~~G~i~~v~i~~~   46 (87)
T 3s7r_A            8 EEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMD   46 (87)
T ss_dssp             CSCTTEEEEECCCTTCCHHHHHHHHTTTSCEEEEEEEEC
T ss_pred             CCCCCEEEEeCCCCCCCHHHHHHHHHhCCCEEEEEEeec
Confidence            456778999999999999999999999999999998643



>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query141
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.37
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 98.32
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 98.28
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 98.27
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 98.24
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 98.23
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.21
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 98.21
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 98.2
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 98.2
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 98.19
d2cpja186 Non-POU domain-containing octamer-binding protein, 98.19
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 98.18
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 98.17
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 98.17
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 98.16
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 98.16
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.15
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 98.14
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 98.13
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 98.13
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 98.13
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 98.12
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 98.12
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 98.11
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 98.11
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 98.08
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 98.08
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 98.08
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 98.07
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 98.07
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 98.07
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.07
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 98.06
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.05
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 98.05
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.04
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.04
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 98.03
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 98.03
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 98.01
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 97.98
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 97.98
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 97.98
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 97.95
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 97.93
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 97.92
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 97.92
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 97.89
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 97.89
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 97.87
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 97.87
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 97.86
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 97.85
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 97.85
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 97.85
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 97.83
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 97.81
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 97.8
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 97.78
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 97.78
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 97.72
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 97.7
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 97.65
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 97.64
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 97.63
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 97.63
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 97.59
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 97.59
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 97.56
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 97.54
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 97.5
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 97.46
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 97.42
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 97.4
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 97.21
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 97.2
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 96.99
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 96.98
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 96.48
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 96.4
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 96.17
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 94.88
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 93.93
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 90.03
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 89.44
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 86.07
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Probable RNA-binding protein 19, Rbm19
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=98.37  E-value=1.5e-07  Score=62.83  Aligned_cols=34  Identities=18%  Similarity=0.441  Sum_probs=32.2

Q ss_pred             ceEEecCCCCCCCHHHHHHHhhccCccceEEecc
Q 032398          105 GICYLSRIPAHMDPVKLRQILSQYGEIQRIYLAP  138 (141)
Q Consensus       105 GVIYLSrIPpgM~p~kLR~~fsqfGeV~RIyL~p  138 (141)
                      -+|||++||+.+++..|+.+|++||+|.+|+|.+
T Consensus        11 ~~l~V~nLp~~~t~~~L~~~F~~fG~I~~v~l~~   44 (111)
T d1whxa_          11 TVILAKNLPAGTLAAEIQETFSRFGSLGRVLLPE   44 (111)
T ss_dssp             EEEEEESCCTTCCHHHHHHHHHTTSCEEEEECCS
T ss_pred             CEEEEECCCCCCCHHHHHhhhhccCCccEEEeec
Confidence            4899999999999999999999999999999865



>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure