Citrus Sinensis ID: 032405

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-
MDVLKYADHPRMKPLVVVEGSAKEGCGAPPLGLYDIGVSDKAYLFRVSLPGARKDTSNLKCIIRRNGNVQIQGVMTEGDVAKNSSKVYKMLQQQLCPPGEFTVSFSLPGPVDPRLFHPQFRQDGILEGVVMKHRKAGKYLS
ccccccccccccccEEEEEEcccccccccccEEEEEEEcccEEEEEEEccccccccccEEEEEEEccEEEEEEEEEcccEEEEcccEEEEEEEEEcccccEEEEEEccccccccccccccccccEEEEEEEcccccccccc
cccccccccccccccEEEEcccccccccccEEEEEEcccccEEEEEEEccccccccccEEEEEccccEEEEEEEEccccEEEcccEEEEEEEEcccccccEEEEEEccccccHHHcccccccccEEEEEEEcccccccccc
mdvlkyadhprmkplvvvegsakegcgapplglydigvsdkayLFRVslpgarkdtsnlKCIIRRNgnvqiqgvmtegdvakNSSKVYKMLQQqlcppgeftvsfslpgpvdprlfhpqfrqdgiLEGVVMKHRKAGKYLS
mdvlkyadhprmkPLVVVEGSAKEGCGAPPLGLYDIGVSDKAYLFRVSLpgarkdtsnlkciirrngnvqiqgvmtEGDVAKNSSKVYKMLQQQLCPPGEFTVSFSLPGPVDPRLFHPQFRQDGILEGVVMKHRKAGKYLS
MDVLKYADHPRMKPLVVVEGSAKEGCGAPPLGLYDIGVSDKAYLFRVSLPGARKDTSNLKCIIRRNGNVQIQGVMTEGDVAKNSSKVYKMLQQQLCPPGEFTVSFSLPGPVDPRLFHPQFRQDGILEGVVMKHRKAGKYLS
**************LVVVEGSAKEGCGAPPLGLYDIGVSDKAYLFRVSLPGARKDTSNLKCIIRRNGNVQIQGVMTEGDVAKNSSKVYKMLQQQLCPPGEFTVSFSLPGPVDPRLFHPQFRQDGILEGVVM**********
*********************A***CGAPPLGLYDIGVSDKAYLFRVSLPGARKDTSNLKCIIRRNGNVQIQGVM*************KMLQQQLCPPGEFTVSFSLPGPVDPRLFHPQFRQDGILEGVVMKHR*******
MDVLKYADHPRMKPLVVVEGSAKEGCGAPPLGLYDIGVSDKAYLFRVSLPGARKDTSNLKCIIRRNGNVQIQGVMTEGDVAKNSSKVYKMLQQQLCPPGEFTVSFSLPGPVDPRLFHPQFRQDGILEGVVMKHRKAGKYLS
***LKYADHPRMKPLVVVEGSAKEGCGAPPLGLYDIGVSDKAYLFRVSLPGARKDTSNLKCIIRRNGNVQIQGVMTEGDVAKNSSKVYKMLQQQLCPPGEFTVSFSLPGPVDPRLFHPQFRQDGILEGVVMKHRK******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDVLKYADHPRMKPLVVVEGSAKEGCGAPPLGLYDIGVSDKAYLFRVSLPGARKDTSNLKCIIRRNGNVQIQGVMTEGDVAKNSSKVYKMLQQQLCPPGEFTVSFSLPGPVDPRLFHPQFRQDGILEGVVMKHRKAGKYLS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query141
224054659147 predicted protein [Populus trichocarpa] 0.950 0.911 0.607 1e-41
255539314143 conserved hypothetical protein [Ricinus 0.950 0.937 0.585 2e-39
449453005146 PREDICTED: uncharacterized protein LOC10 0.907 0.876 0.617 4e-37
122703610154 small heat shock protein [Nicotiana taba 0.943 0.863 0.559 2e-33
122703612154 small heat shock protein [Nicotiana bent 0.943 0.863 0.552 2e-32
297842405141 hypothetical protein ARALYDRAFT_476801 [ 0.893 0.893 0.523 1e-30
224061841 396 predicted protein [Populus trichocarpa] 0.843 0.300 0.512 2e-30
15223046143 alpha-crystallin domain of heat shock pr 0.893 0.881 0.523 3e-30
255539316 392 conserved hypothetical protein [Ricinus 0.843 0.303 0.504 3e-30
356558514 394 PREDICTED: uncharacterized protein LOC10 0.836 0.299 0.546 5e-30
>gi|224054659|ref|XP_002298345.1| predicted protein [Populus trichocarpa] gi|222845603|gb|EEE83150.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  174 bits (441), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 82/135 (60%), Positives = 104/135 (77%), Gaps = 1/135 (0%)

Query: 1   MDVLKYADHPRMKPLVVVEGSAKEGCGAPPLGLYDIGVSDKAYLFRVSLPGARKDTSNLK 60
           MD    A+ P++KPLV++ G+AKEG   PP+GL DIGVS+ AYLFRV+LPG R++ SNLK
Sbjct: 1   MDACDSANQPKLKPLVILSGTAKEGSAGPPIGLVDIGVSENAYLFRVALPGIRRNESNLK 60

Query: 61  CIIRRNGNVQIQGVMT-EGDVAKNSSKVYKMLQQQLCPPGEFTVSFSLPGPVDPRLFHPQ 119
           C I+ NG V I+GV+T +  + K+SS V++M  QQLCPPG FT+SF LPGPVDPRLF P 
Sbjct: 61  CDIQHNGTVHIKGVVTVDAGMLKDSSSVFQMRVQQLCPPGPFTISFKLPGPVDPRLFCPN 120

Query: 120 FRQDGILEGVVMKHR 134
           FR DG+LE  VMK+R
Sbjct: 121 FRNDGVLEVAVMKYR 135

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255539314|ref|XP_002510722.1| conserved hypothetical protein [Ricinus communis] gi|223551423|gb|EEF52909.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|449453005|ref|XP_004144249.1| PREDICTED: uncharacterized protein LOC101218704 isoform 1 [Cucumis sativus] gi|449453007|ref|XP_004144250.1| PREDICTED: uncharacterized protein LOC101218704 isoform 2 [Cucumis sativus] gi|449489360|ref|XP_004158289.1| PREDICTED: uncharacterized LOC101218704 isoform 1 [Cucumis sativus] gi|449489364|ref|XP_004158290.1| PREDICTED: uncharacterized LOC101218704 isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|122703610|dbj|BAF45120.1| small heat shock protein [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|122703612|dbj|BAF45121.1| small heat shock protein [Nicotiana benthamiana] Back     alignment and taxonomy information
>gi|297842405|ref|XP_002889084.1| hypothetical protein ARALYDRAFT_476801 [Arabidopsis lyrata subsp. lyrata] gi|297334925|gb|EFH65343.1| hypothetical protein ARALYDRAFT_476801 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224061841|ref|XP_002300625.1| predicted protein [Populus trichocarpa] gi|222842351|gb|EEE79898.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|15223046|ref|NP_177770.1| alpha-crystallin domain of heat shock protein-containing protein [Arabidopsis thaliana] gi|42572129|ref|NP_974155.1| alpha-crystallin domain of heat shock protein-containing protein [Arabidopsis thaliana] gi|79321321|ref|NP_001031287.1| alpha-crystallin domain of heat shock protein-containing protein [Arabidopsis thaliana] gi|6554475|gb|AAF16657.1|AC012394_6 hypothetical protein; 22462-23090 [Arabidopsis thaliana] gi|12323972|gb|AAG51943.1|AC015450_4 hypothetical protein; 19301-18673 [Arabidopsis thaliana] gi|22135998|gb|AAM91581.1| unknown protein [Arabidopsis thaliana] gi|23198326|gb|AAN15690.1| unknown protein [Arabidopsis thaliana] gi|222424494|dbj|BAH20202.1| AT1G76440 [Arabidopsis thaliana] gi|332197720|gb|AEE35841.1| alpha-crystallin domain of heat shock protein-containing protein [Arabidopsis thaliana] gi|332197721|gb|AEE35842.1| alpha-crystallin domain of heat shock protein-containing protein [Arabidopsis thaliana] gi|332197722|gb|AEE35843.1| alpha-crystallin domain of heat shock protein-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255539316|ref|XP_002510723.1| conserved hypothetical protein [Ricinus communis] gi|223551424|gb|EEF52910.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|356558514|ref|XP_003547550.1| PREDICTED: uncharacterized protein LOC100786407 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query141
TAIR|locus:2011696143 AT1G76440 "AT1G76440" [Arabido 0.879 0.867 0.532 1.1e-30
TAIR|locus:2037380463 AT1G20870 "AT1G20870" [Arabido 0.872 0.265 0.484 3e-27
TAIR|locus:2010945349 AT1G54840 "AT1G54840" [Arabido 0.780 0.315 0.522 3.3e-24
TAIR|locus:2010995206 AT1G54850 "AT1G54850" [Arabido 0.822 0.563 0.453 7.8e-23
TAIR|locus:2181803508 AT5G02480 "AT5G02480" [Arabido 0.787 0.218 0.306 4.7e-05
TAIR|locus:2011696 AT1G76440 "AT1G76440" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 338 (124.0 bits), Expect = 1.1e-30, P = 1.1e-30
 Identities = 66/124 (53%), Positives = 86/124 (69%)

Query:     9 HPRMKPLVVVEGSAKEGCGAPPLGLYDIGVSDKAYLFRVSLPGARKDTSNLKCIIRRNGN 68
             H ++   V   G+AK G   PP+GL DIGVS+ AY+FRVSLPG  K+   +KC I+R G 
Sbjct:    12 HSKVISHVFCTGTAKLGSVGPPIGLVDIGVSEVAYIFRVSLPGIEKNQDKIKCEIQREGR 71

Query:    69 VQIQGVMTEGDVAKNSSKVYKMLQQQLCPPGEFTVSFSLPGPVDPRLFHPQFRQDGILEG 128
             V IQGV+ E  +  ++  +Y+M  QQLCPPG F+++F+LPG VDPRLF P FR DGI E 
Sbjct:    72 VCIQGVIPEIAIPSDTGCLYRMQVQQLCPPGPFSITFNLPGQVDPRLFSPNFRSDGIFEV 131

Query:   129 VVMK 132
             VV+K
Sbjct:   132 VVVK 135
GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2037380 AT1G20870 "AT1G20870" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2010945 AT1G54840 "AT1G54840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2010995 AT1G54850 "AT1G54850" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181803 AT5G02480 "AT5G02480" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_LG_I1718
hypothetical protein (148 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query141
cd0646488 cd06464, ACD_sHsps-like, Alpha-crystallin domain ( 1e-05
>gnl|CDD|107221 cd06464, ACD_sHsps-like, Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information 
 Score = 40.6 bits (96), Expect = 1e-05
 Identities = 25/98 (25%), Positives = 44/98 (44%), Gaps = 10/98 (10%)

Query: 35  DIGVSDKAYLFRVSLPGARKDTSNLKCIIRRNGNVQIQGVMTEGDVAKNSSKVYKMLQQQ 94
           D+  +D AY+    LPG +K+  ++K +   +G + I G   E +  +      +   ++
Sbjct: 1   DVYETDDAYVVEADLPGFKKE--DIK-VEVEDGVLTISGEREEEEEEE------ENYLRR 51

Query: 95  LCPPGEFTVSFSLPGPVDPRLFHPQFRQDGILEGVVMK 132
               G F+ SF LP  VDP         +G+L   + K
Sbjct: 52  ERSYGSFSRSFRLPEDVDPDKIKASLE-NGVLTITLPK 88

sHsps are small stress induced proteins with monomeric masses between 12 -43 kDa, whose common feature is the Alpha-crystallin domain (ACD). sHsps are generally active as large oligomers consisting of multiple subunits, and are believed to be ATP-independent chaperones that prevent aggregation and are important in refolding in combination with other Hsps. Length = 88

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 141
cd0647292 ACD_ScHsp26_like Alpha crystallin domain (ACD) fou 99.95
PRK10743137 heat shock protein IbpA; Provisional 99.95
PRK11597142 heat shock chaperone IbpB; Provisional 99.95
COG0071146 IbpA Molecular chaperone (small heat shock protein 99.95
cd0647193 ACD_LpsHSP_like Group of bacterial proteins contai 99.94
cd0647090 ACD_IbpA-B_like Alpha-crystallin domain (ACD) foun 99.93
PF00011102 HSP20: Hsp20/alpha crystallin family This prints e 99.91
cd0649786 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domai 99.91
cd0647981 ACD_HspB7_like Alpha crystallin domain (ACD) found 99.91
cd0649884 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domai 99.9
cd0647586 ACD_HspB1_like Alpha crystallin domain (ACD) found 99.9
cd0647883 ACD_HspB4-5-6 Alpha-crystallin domain found in alp 99.9
cd0647683 ACD_HspB2_like Alpha crystallin domain (ACD) found 99.89
cd0648287 ACD_HspB10 Alpha crystallin domain (ACD) found in 99.89
cd0646488 ACD_sHsps-like Alpha-crystallin domain (ACD) of al 99.88
cd0648187 ACD_HspB9_like Alpha crystallin domain (ACD) found 99.88
cd0647783 ACD_HspB3_Like Alpha crystallin domain (ACD) found 99.87
cd0652683 metazoan_ACD Alpha-crystallin domain (ACD) of meta 99.86
cd0648091 ACD_HspB8_like Alpha-crystallin domain (ACD) found 99.75
KOG0710196 consensus Molecular chaperone (small heat-shock pr 99.74
cd0029880 ACD_sHsps_p23-like This domain family includes the 99.62
KOG3591173 consensus Alpha crystallins [Posttranslational mod 99.49
cd0646978 p23_DYX1C1_like p23_like domain found in proteins 99.41
PF05455177 GvpH: GvpH; InterPro: IPR008633 This family consis 99.23
cd0646384 p23_like Proteins containing this p23_like domain 99.14
cd0646684 p23_CS_SGT1_like p23_like domain similar to the C- 98.87
PF0496979 CS: CS domain; InterPro: IPR017447 The function of 98.32
PF08190328 PIH1: pre-RNA processing PIH1/Nop17 98.19
cd06465108 p23_hB-ind1_like p23_like domain found in human (h 98.12
cd0648984 p23_CS_hSgt1_like p23_like domain similar to the C 97.97
cd0646785 p23_NUDC_like p23_like domain of NUD (nuclear dist 97.89
cd0649385 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear 97.76
cd0648887 p23_melusin_like p23_like domain similar to the C- 97.72
cd0646892 p23_CacyBP p23_like domain found in proteins simil 97.53
cd0649493 p23_NUDCD2_like p23-like NUD (nuclear distribution 97.03
cd00237106 p23 p23 binds heat shock protein (Hsp)90 and parti 96.45
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 96.26
KOG1309 196 consensus Suppressor of G2 allele of skp1 [Signal 95.91
cd0649087 p23_NCB5OR p23_like domain found in NAD(P)H cytoch 95.5
cd0649287 p23_mNUDC_like p23-like NUD (nuclear distribution) 94.23
cd06495102 p23_NUDCD3_like p23-like NUD (nuclear distribution 89.97
>cd06472 ACD_ScHsp26_like Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins Back     alignment and domain information 
Probab=99.95  E-value=7e-28  Score=166.96  Aligned_cols=89  Identities=21%  Similarity=0.377  Sum_probs=80.2

Q ss_pred             ceeEEEcCCeEEEEEEcCCCCCCCeEEEEEeccC-CEEEEEEEEee--cccCCceeeEEEEeccccCCCeeEEEEEECCC
Q 032405           33 LYDIGVSDKAYLFRVSLPGARKDTSNLKCIIRRN-GNVQIQGVMTE--GDVAKNSSKVYKMLQQQLCPPGEFTVSFSLPG  109 (141)
Q Consensus        33 ~vDi~Et~~~y~v~~dLPGv~kedi~V~ve~~~~-~~L~I~G~~~~--~~~~~~~~~~er~~~~~~~~~G~F~R~~~LP~  109 (141)
                      ++||+|++++|+|.++||||+|+||+|++   ++ +.|+|+|+++.  +.....+++.||.       +|+|.|+|+||.
T Consensus         1 ~~dv~E~~~~~~i~~~lPGv~~edi~i~v---~~~~~L~I~g~~~~~~~~~~~~~~~~e~~-------~g~f~r~i~LP~   70 (92)
T cd06472           1 RVDWKETPEAHVFKADVPGVKKEDVKVEV---EDGRVLRISGERKKEEEKKGDDWHRVERS-------SGRFVRRFRLPE   70 (92)
T ss_pred             CccEEEcCCeEEEEEECCCCChHhEEEEE---eCCCEEEEEEEecccccccCCCEEEEEEe-------ccEEEEEEECCC
Confidence            48999999999999999999999999998   65 58999999872  2334567788888       999999999999


Q ss_pred             CCCCCCceeEeCCCCEEEEEEec
Q 032405          110 PVDPRLFHPQFRQDGILEGVVMK  132 (141)
Q Consensus       110 ~vd~~~I~A~~~~dGVL~I~vPK  132 (141)
                      +|+.++|+|+|+ ||||+|++||
T Consensus        71 ~v~~~~i~A~~~-nGvL~I~lPK   92 (92)
T cd06472          71 NADADEVKAFLE-NGVLTVTVPK   92 (92)
T ss_pred             CCCHHHCEEEEE-CCEEEEEecC
Confidence            999999999999 9999999998

sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. ScHsp26 is temperature-regulated, it switches from an inactive to a chaperone-active form upon elevation in temperature. It associates into large 24-mers storage forms which upon heat shock disassociate into dimers. These dimers initiate the interaction with non-native substrate proteins and re-assemble into large globular assemblies having one monomer of substrate bound per dimer. This group also contains Arabidopsis thaliana (Ath) Hsp15.7, a peroxisomal matrix protein which can complement the morphological phenotype of S. cerevisiae mutants deficient in Hsps26. AthHsp15.7 is minimally expressed under normal conditions and is strongly induced by heat and oxidative st
>PRK10743 heat shock protein IbpA; Provisional Back     alignment and domain information
>PRK11597 heat shock chaperone IbpB; Provisional Back     alignment and domain information
>COG0071 IbpA Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06471 ACD_LpsHSP_like Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18 Back     alignment and domain information
>cd06470 ACD_IbpA-B_like Alpha-crystallin domain (ACD) found in Escherichia coli inclusion body-associated proteins IbpA and IbpB, and similar proteins Back     alignment and domain information
>PF00011 HSP20: Hsp20/alpha crystallin family This prints entry is a subset of the Pfam entry Back     alignment and domain information
>cd06497 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaA-crystallin (HspB4, 20kDa) Back     alignment and domain information
>cd06479 ACD_HspB7_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB7, also known as cardiovascular small heat shock protein (cvHsp), and similar proteins Back     alignment and domain information
>cd06498 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaB-crystallin (HspB5, 20kDa) Back     alignment and domain information
>cd06475 ACD_HspB1_like Alpha crystallin domain (ACD) found in mammalian small (s)heat shock protein (Hsp)-27 (also denoted HspB1 in human) and similar proteins Back     alignment and domain information
>cd06478 ACD_HspB4-5-6 Alpha-crystallin domain found in alphaA-crystallin (HspB4), alphaB-crystallin (HspB5), and the small heat shock protein (sHsp) HspB6, also known as Hsp20 Back     alignment and domain information
>cd06476 ACD_HspB2_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB2/heat shock 27kDa protein 2 and similar proteins Back     alignment and domain information
>cd06482 ACD_HspB10 Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB10, also known as sperm outer dense fiber protein (ODFP), and similar proteins Back     alignment and domain information
>cd06464 ACD_sHsps-like Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>cd06481 ACD_HspB9_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB9 and similar proteins Back     alignment and domain information
>cd06477 ACD_HspB3_Like Alpha crystallin domain (ACD) found in mammalian HspB3, also known as heat-shock protein 27-like protein (HSPL27, 17-kDa) and similar proteins Back     alignment and domain information
>cd06526 metazoan_ACD Alpha-crystallin domain (ACD) of metazoan alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>cd06480 ACD_HspB8_like Alpha-crystallin domain (ACD) found in mammalian 21 Back     alignment and domain information
>KOG0710 consensus Molecular chaperone (small heat-shock protein Hsp26/Hsp42) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00298 ACD_sHsps_p23-like This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information
>KOG3591 consensus Alpha crystallins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06469 p23_DYX1C1_like p23_like domain found in proteins similar to dyslexia susceptibility 1 (DYX1) candidate 1 (C1) protein, DYX1C1 Back     alignment and domain information
>PF05455 GvpH: GvpH; InterPro: IPR008633 This family consists of archaeal GvpH proteins which are thought to be involved in gas vesicle synthesis [] Back     alignment and domain information
>cd06463 p23_like Proteins containing this p23_like domain include p23 and its Saccharomyces cerevisiae (Sc) homolog Sba1 Back     alignment and domain information
>cd06466 p23_CS_SGT1_like p23_like domain similar to the C-terminal CHORD-SGT1 (CS) domain of Sgt1 (suppressor of G2 allele of Skp1) Back     alignment and domain information
>PF04969 CS: CS domain; InterPro: IPR017447 The function of the CS domain is unknown Back     alignment and domain information
>PF08190 PIH1: pre-RNA processing PIH1/Nop17 Back     alignment and domain information
>cd06465 p23_hB-ind1_like p23_like domain found in human (h) butyrate-induced transcript 1 (B-ind1) and similar proteins Back     alignment and domain information
>cd06489 p23_CS_hSgt1_like p23_like domain similar to the C-terminal CS (CHORD-SGT1) domain of human (h) Sgt1 and related proteins Back     alignment and domain information
>cd06467 p23_NUDC_like p23_like domain of NUD (nuclear distribution) C and similar proteins Back     alignment and domain information
>cd06493 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear distribution) C-like domain found in human NUD (nuclear distribution) C domain-containing protein 1, NUDCD1 (also known as CML66), and similar proteins Back     alignment and domain information
>cd06488 p23_melusin_like p23_like domain similar to the C-terminal (tail) domain of vertebrate Melusin and related proteins Back     alignment and domain information
>cd06468 p23_CacyBP p23_like domain found in proteins similar to Calcyclin-Binding Protein(CacyBP)/Siah-1-interacting protein (SIP) Back     alignment and domain information
>cd06494 p23_NUDCD2_like p23-like NUD (nuclear distribution) C-like found in human NUDC domain-containing protein 2 (NUDCD2) and similar proteins Back     alignment and domain information
>cd00237 p23 p23 binds heat shock protein (Hsp)90 and participates in the folding of a number of Hsp90 clients, including the progesterone receptor Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG1309 consensus Suppressor of G2 allele of skp1 [Signal transduction mechanisms] Back     alignment and domain information
>cd06490 p23_NCB5OR p23_like domain found in NAD(P)H cytochrome b5 (NCB5) oxidoreductase (OR) and similar proteins Back     alignment and domain information
>cd06492 p23_mNUDC_like p23-like NUD (nuclear distribution) C-like domain of mammalian(m) NUDC and similar proteins Back     alignment and domain information
>cd06495 p23_NUDCD3_like p23-like NUD (nuclear distribution) C-like domain found in human NUDC domain-containing protein 3 (NUDCD3) and similar proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query141
3gla_A100 Low molecular weight heat shock protein; HSPA, SHP 99.97
4fei_A102 Heat shock protein-related protein; stress respons 99.96
4eld_A161 MJ16.5-P1, small heat shock protein HSP16.5; chape 99.94
3aab_A123 Putative uncharacterized protein ST1653; alpha-cry 99.94
1gme_A151 Heat shock protein 16.9B; small heat shock protein 99.94
2wj5_A101 Heat shock protein beta-6; chaperone, disulfide bo 99.93
3l1e_A106 Alpha-crystallin A chain; lens transparency, polyd 99.93
3q9p_A85 Heat shock protein beta-1; alpha-crystallin domain 99.93
2y1y_A90 Alpha-crystallin B chain,; small heat shock protei 99.9
2klr_A175 Alpha-crystallin B chain; protein, dimer, oligomer 99.88
2bol_A 314 TSP36, small heat shock protein; A-crystallin, mol 99.88
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 99.86
2xcm_C92 SGT1-like protein, cytosolic heat shock protein 90 99.12
1rl1_A114 Suppressor of G2 allele of SKP1 homolog; beta sand 99.12
2k8q_A134 Protein SHQ1; beta-sandwich, CS domain, nucleus, s 97.9
3eud_A115 Protein SHQ1; CS domain HSP20-like domain SHQ1 H/A 97.81
3igf_A374 ALL4481 protein; two-domained protein consisting o 97.74
1x5m_A127 Calcyclin-binding protein; CS domain, structural g 97.73
1wh0_A134 Ubiquitin carboxyl-terminal hydrolase 19; USP, CS 97.7
1wgv_A124 KIAA1068 protein; CS domain, HSP20-like fold, stru 97.54
3qor_A121 Nuclear migration protein NUDC; beta-sandwich, cha 97.42
1wfi_A131 Nuclear distribution gene C homolog; NUDC, riken s 97.39
2o30_A131 Nuclear movement protein; MCSG, structural genomic 97.29
1ejf_A125 Progesterone receptor P23; chaperone, CO-chaperone 97.21
2rh0_A157 NUDC domain-containing protein 2; 13542905, nuclea 97.12
2cg9_X134 CO-chaperone protein SBA1; chaperone complex, HSP9 96.87
2kmw_A150 Uncharacterized protein AT3G03773; protein structu 96.42
>3gla_A Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} PDB: 3gt6_A 3guf_A Back     alignment and structure
Probab=99.97  E-value=6.8e-30  Score=177.80  Aligned_cols=96  Identities=22%  Similarity=0.307  Sum_probs=84.6

Q ss_pred             CCcceeEEEcCCeEEEEEEcCCCCCCCeEEEEEeccCCEEEEEEEEee--cccCCceeeEEEEeccccCCCeeEEEEEEC
Q 032405           30 PLGLYDIGVSDKAYLFRVSLPGARKDTSNLKCIIRRNGNVQIQGVMTE--GDVAKNSSKVYKMLQQQLCPPGEFTVSFSL  107 (141)
Q Consensus        30 ~~~~vDi~Et~~~y~v~~dLPGv~kedi~V~ve~~~~~~L~I~G~~~~--~~~~~~~~~~er~~~~~~~~~G~F~R~~~L  107 (141)
                      +.|++||+|++++|+|.++|||+++++|+|++   +++.|+|+|+++.  +.....+++.||.       +|+|+|+|.|
T Consensus         3 ~~P~~di~e~~~~~~v~~~lPG~~~edi~v~~---~~~~L~I~g~~~~~~~~~~~~~~~~er~-------~g~f~r~~~L   72 (100)
T 3gla_A            3 WVPRVDIKEEVNHFVLYADLPGIDPSQIEVQM---DKGILSIRGERKSESSTETERFSRIERR-------YGSFHRRFAL   72 (100)
T ss_dssp             SCCCEEEEECSSEEEEEEECTTSCGGGCEEEE---ETTEEEEEEEECCGGGSSGGGEEEECCC-------CEEEEEEEEC
T ss_pred             ccCcEEEEECCCEEEEEEECCCCCHHHEEEEE---ECCEEEEEEEEcCcCccCCccEEEEeec-------ceEEEEEEEC
Confidence            55699999999999999999999999999999   8999999999983  2334567777776       9999999999


Q ss_pred             CCCCCCCCceeEeCCCCEEEEEEeccCCC
Q 032405          108 PGPVDPRLFHPQFRQDGILEGVVMKHRKA  136 (141)
Q Consensus       108 P~~vd~~~I~A~~~~dGVL~I~vPK~~~~  136 (141)
                      |.+||.++|+|+|+ ||||+|++||.+++
T Consensus        73 P~~vd~~~i~A~~~-~GvL~I~~pK~~~a  100 (100)
T 3gla_A           73 PDSADADGITAAGR-NGVLEIRIPKRPAA  100 (100)
T ss_dssp             CTTBCTTSCEEEEE-TTEEEEEEEBC---
T ss_pred             CCCcChHHeEEEEe-CCEEEEEEecCCCC
Confidence            99999999999999 99999999998764
>4fei_A Heat shock protein-related protein; stress response, alpha-crystallin domain fold, aggregates, C chaperone; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>4eld_A MJ16.5-P1, small heat shock protein HSP16.5; chaperone; 2.70A {Methanocaldococcus jannaschii} PDB: 1shs_A Back     alignment and structure
>3aab_A Putative uncharacterized protein ST1653; alpha-crystallin domain, chaperone; 1.85A {Sulfolobus tokodaii} PDB: 3aac_A Back     alignment and structure
>1gme_A Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} SCOP: b.15.1.1 PDB: 2h50_A 2h53_A 2byu_A Back     alignment and structure
>2wj5_A Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus} Back     alignment and structure
>3l1e_A Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A Back     alignment and structure
>3q9p_A Heat shock protein beta-1; alpha-crystallin domain, chaperone, charcot-marie-tooth DISE neuronopathy, IG-like fold, stress response; 2.00A {Homo sapiens} PDB: 3q9q_A Back     alignment and structure
>2y1y_A Alpha-crystallin B chain,; small heat shock protein, chaperone, stress protein, eye LEN protein, cataract; HET: MSE; 2.00A {Homo sapiens} PDB: 2y22_A 2wj7_A 3l1g_A 2y1z_A Back     alignment and structure
>2klr_A Alpha-crystallin B chain; protein, dimer, oligomer, heterogeneity, intermolecular INTE chaperone, SHSP, human, small heat-shock protein, cataract; NMR {Homo sapiens} PDB: 2ygd_A Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Back     alignment and structure
>2xcm_C SGT1-like protein, cytosolic heat shock protein 90; chaperone-protein binding complex, stress response; HET: ADP; 2.20A {Arabidopsis thaliana} PDB: 2jki_S* Back     alignment and structure
>1rl1_A Suppressor of G2 allele of SKP1 homolog; beta sandwich, 7 beta strands, similar to P23, lacking LAST beta strand SEEN in P23, protein degradation; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>2k8q_A Protein SHQ1; beta-sandwich, CS domain, nucleus, structural protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3eud_A Protein SHQ1; CS domain HSP20-like domain SHQ1 H/ACA snoRNP ribosome biogenesis, nucleus, nuclear protein; HET: MSE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Back     alignment and structure
>1x5m_A Calcyclin-binding protein; CS domain, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wh0_A Ubiquitin carboxyl-terminal hydrolase 19; USP, CS domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>1wgv_A KIAA1068 protein; CS domain, HSP20-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.15.1.4 Back     alignment and structure
>3qor_A Nuclear migration protein NUDC; beta-sandwich, chaperone, protein cell cycle; HET: OCS; 1.75A {Homo sapiens} PDB: 3qor_B* 2cr0_A Back     alignment and structure
>1wfi_A Nuclear distribution gene C homolog; NUDC, riken structural genomics/proteomics initiative, RSGI, structural genomics, transport protein; NMR {Mus musculus} SCOP: b.15.1.4 Back     alignment and structure
>2o30_A Nuclear movement protein; MCSG, structural genomics, PSI-2, structure initiative; 1.66A {Encephalitozoon cuniculi} Back     alignment and structure
>1ejf_A Progesterone receptor P23; chaperone, CO-chaperone, beta-sandwich; 2.49A {Homo sapiens} SCOP: b.15.1.2 Back     alignment and structure
>2rh0_A NUDC domain-containing protein 2; 13542905, nuclear movement protein, structural genomics, joint center for structural genomics, JCSG; 1.95A {Mus musculus} Back     alignment and structure
>2cg9_X CO-chaperone protein SBA1; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Back     alignment and structure
>2kmw_A Uncharacterized protein AT3G03773; protein structure initiative, center for eukaryotic structural genomics, CESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 141
d1shsa_115 b.15.1.1 (A:) Small heat shock protein {Archaeon M 2e-05
>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 115 Back     information, alignment and structure

class: All beta proteins
fold: HSP20-like chaperones
superfamily: HSP20-like chaperones
family: HSP20
domain: Small heat shock protein
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

 Score = 39.6 bits (92), Expect = 2e-05
 Identities = 17/112 (15%), Positives = 36/112 (32%), Gaps = 11/112 (9%)

Query: 25  GCGAPPLGLYDIGVSDKAYLFRVSLPGARKDTSNLKCIIRRNGNVQIQGVMTEGDVAKNS 84
           G G  P     I   D+       LPG  K+  ++      +                  
Sbjct: 7   GKGFMP---ISIIEGDQHIKVIAWLPGVNKE--DIILNAVGDTLEIRAKRSPLMI----- 56

Query: 85  SKVYKMLQQQLCPPGEFTVSFSLPGPVDPRLFHPQFRQDGILEGVVMKHRKA 136
           ++  +++  ++    E   +  LP  V       +F  +G+L  ++ K   +
Sbjct: 57  TESERIIYSEIPEEEEIYRTIKLPATVKEENASAKFE-NGVLSVILPKAESS 107

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query141
d1shsa_115 Small heat shock protein {Archaeon Methanococcus j 99.94
d1gmea_150 Small heat shock protein {Wheat (Triticum aestivum 99.93
d1rl1a_92 Suppressor of G2 allele of skp1 homolog, gst1 {Hum 98.28
d1wh0a_134 Ubiquitin carboxyl-terminal hydrolase 19, USP19 {H 97.18
d1ejfa_110 Co-chaperone p23 {Human (Homo sapiens) [TaxId: 960 96.75
d1wgva_124 NudC domain containing protein 3, NUDCD3 (KIAA1068 96.5
d1wfia_131 Nuclear migration protein nudC {Mouse (Mus musculu 96.28
>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
class: All beta proteins
fold: HSP20-like chaperones
superfamily: HSP20-like chaperones
family: HSP20
domain: Small heat shock protein
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

Probab=99.94  E-value=9.6e-27  Score=163.95  Aligned_cols=96  Identities=17%  Similarity=0.167  Sum_probs=80.5

Q ss_pred             cceeEEEcCCeEEEEEEcCCCCCCCeEEEEEeccCCEEEEEEEEeec--ccCCceeeEEEEeccccCCCeeEEEEEECCC
Q 032405           32 GLYDIGVSDKAYLFRVSLPGARKDTSNLKCIIRRNGNVQIQGVMTEG--DVAKNSSKVYKMLQQQLCPPGEFTVSFSLPG  109 (141)
Q Consensus        32 ~~vDi~Et~~~y~v~~dLPGv~kedi~V~ve~~~~~~L~I~G~~~~~--~~~~~~~~~er~~~~~~~~~G~F~R~~~LP~  109 (141)
                      +++||+|++++|+|.++|||++++||+|++   +++.|+|+|++...  .....+...      +++++|.|.|+|.||.
T Consensus        11 ~pvdi~e~~~~~~i~~~lPG~~~edi~v~v---~~~~l~I~~~~~~~~~~~~~~~~~~------~~~~~~~f~r~~~lP~   81 (115)
T d1shsa_          11 MPISIIEGDQHIKVIAWLPGVNKEDIILNA---VGDTLEIRAKRSPLMITESERIIYS------EIPEEEEIYRTIKLPA   81 (115)
T ss_dssp             CCEEEEECSSEEEEEEECTTCCGGGEEEEE---ETTEEEEEEECCCCCCCTTCEEEEE------CSCCCCEEEEEEECSS
T ss_pred             CceEEEEcCCEEEEEEECCCCCHHHEEEEE---ECCEEEEEEEeccccccccccEEEE------eeecccceEEEEecCC
Confidence            379999999999999999999999999999   89999999998622  121222221      2234899999999999


Q ss_pred             CCCCCCceeEeCCCCEEEEEEeccCCCC
Q 032405          110 PVDPRLFHPQFRQDGILEGVVMKHRKAG  137 (141)
Q Consensus       110 ~vd~~~I~A~~~~dGVL~I~vPK~~~~~  137 (141)
                      ++|.++|+|.|+ ||||+|++||.++.+
T Consensus        82 ~vd~~~i~A~~~-nGvL~I~lpK~~~~~  108 (115)
T d1shsa_          82 TVKEENASAKFE-NGVLSVILPKAESSI  108 (115)
T ss_dssp             CBCGGGCEEEEE-TTEEEEEEEBCGGGC
T ss_pred             ceeecceEEEEE-CCEEEEEEEeCCCCC
Confidence            999999999999 999999999987653
>d1gmea_ b.15.1.1 (A:) Small heat shock protein {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
>d1rl1a_ b.15.1.3 (A:) Suppressor of G2 allele of skp1 homolog, gst1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh0a_ b.15.1.3 (A:) Ubiquitin carboxyl-terminal hydrolase 19, USP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ejfa_ b.15.1.2 (A:) Co-chaperone p23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgva_ b.15.1.4 (A:) NudC domain containing protein 3, NUDCD3 (KIAA1068) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfia_ b.15.1.4 (A:) Nuclear migration protein nudC {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure