Citrus Sinensis ID: 032440

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140
MCGSKRVWVSELIFILLLVKWWWSEGCLEQERSALLQLKHFFNDDHRLQNWVDDENYSDCCQWERVECNNTTGRVIKLDLTQTRKWESAEWYMNASLFTPFQQLESLDLIGNNIAGCVENEGLERLSRWSFITQTLIIGW
ccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccccccccccccccccccEEEEccccccEEEEEccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccc
cccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccccccccccccccEcEEEEcccccEEEEEEcccccccccccccEcHHHHccHHHHHcEcccccccccccccccHHHHHHHHHHHHHHHccc
MCGSKRVWVSELIFILLLVKWWWSEGCLEQERSALLQLKhffnddhrlqnwvddenysdccqWERVECNNTTGRVIKLDLTQTRKWESAEWymnaslftpfqqlesLDLIgnniagcveneglerlsRWSFITQTLIIGW
mcgskrvwVSELIFILLLVKWWWSEGCLEQERSALLQLKHFFNDDHRLQNWVDDENYSDCCQWERvecnnttgrvikldltqtRKWESAEWYMNASLFTPFQQLESLDLIGNNIAGCVeneglerlsrwsfitqtliigw
MCGSKRVWVSELIFILLLVKWWWSEGCLEQERSALLQLKHFFNDDHRLQNWVDDENYSDCCQWERVECNNTTGRVIKLDLTQTRKWESAEWYMNASLFTPFQQLESLDLIGNNIAGCVENEGLERLSRWSFITQTLIIGW
*****RVWVSELIFILLLVKWWWSEGCLEQERSALLQLKHFFNDDHRLQNWVDDENYSDCCQWERVECNNTTGRVIKLDLTQTRKWESAEWYMNASLFTPFQQLESLDLIGNNIAGCVENEGLERLSRWSFITQTLIIG*
****KRVWVSELIFILLLVKWWWSEGCLEQERSALLQLKHFFNDDHRLQNWVDDENYSDCCQWERVECNNTTGRVIKLDLTQTRKWESAEWYMNASLFTPFQQLESLDLIGNNIAGCVENEGLERLSRWSFITQTLIIGW
MCGSKRVWVSELIFILLLVKWWWSEGCLEQERSALLQLKHFFNDDHRLQNWVDDENYSDCCQWERVECNNTTGRVIKLDLTQTRKWESAEWYMNASLFTPFQQLESLDLIGNNIAGCVENEGLERLSRWSFITQTLIIGW
*CGSKRVWVSELIFILLLVKWWWSEGCLEQERSALLQLKHFFNDDHRLQNWVDDENYSDCCQWERVECNNTTGRVIKLDLTQTRKWESAEWYMNASLFTPFQQLESLDLIGNNIAGCVENEGLERLSRWSFITQTLIIGW
iiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCGSKRVWVSELIFILLLVKWWWSEGCLEQERSALLQLKHFFNDDHRLQNWVDDENYSDCCQWERVECNNTTGRVIKLDLTQTRKWESAEWYMNASLFTPFQQLESLDLIGNNIAGCVENEGLERLSRWSFITQTLIIGW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query140 2.2.26 [Sep-21-2011]
Q9C9H7 847 Receptor-like protein 12 no no 0.914 0.151 0.338 5e-07
Q05091 330 Polygalacturonase inhibit N/A no 0.75 0.318 0.279 9e-05
C0LGW6 966 LRR receptor-like serine/ no no 0.628 0.091 0.305 0.0006
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 68/142 (47%), Gaps = 14/142 (9%)

Query: 1   MCGSKRVWVSE---LIFILLLVKWWWSEG---CLEQERSALLQLKHFFNDD---HRLQNW 51
           M  S R WV     +IF+ LLV    S     C + +R ALL+ +  F  +   H +  W
Sbjct: 2   MIRSHRHWVFSSRIIIFLSLLVHSLASSSPHFCRDDQRDALLEFRGEFPINASWHIMNQW 61

Query: 52  VDDENYS-DCCQWERVECNNTTGRVIKLDLTQTRKWESAEWYMNASLFTPFQQLESLDLI 110
               N S DCC W  V CN+ +G+VI LD+  T  + +     N+SLF   Q L  LDL 
Sbjct: 62  RGPWNKSTDCCLWNGVTCNDKSGQVISLDIPNT--FLNNYLKTNSSLFK-LQYLRHLDLT 118

Query: 111 GNNIAGCVENEGLERLSRWSFI 132
             N+ G + +  L  LS  + +
Sbjct: 119 NCNLYGEIPSS-LGNLSHLTLV 139
Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|Q05091|PGIP_PYRCO Polygalacturonase inhibitor OS=Pyrus communis GN=PGIP PE=1 SV=1 Back     alignment and function description
>sp|C0LGW6|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query140
255581263 912 serine-threonine protein kinase, plant-t 0.807 0.123 0.570 1e-29
255585991 743 serine-threonine protein kinase, plant-t 0.8 0.150 0.554 2e-27
224120284 929 predicted protein [Populus trichocarpa] 0.842 0.127 0.487 6e-26
224120450 935 predicted protein [Populus trichocarpa] 0.764 0.114 0.535 1e-24
224142503177 predicted protein [Populus trichocarpa] 0.892 0.706 0.470 2e-23
255583082 711 serine-threonine protein kinase, plant-t 0.8 0.157 0.512 7e-23
224111186 960 predicted protein [Populus trichocarpa] 0.807 0.117 0.487 8e-23
224142499 436 predicted protein [Populus trichocarpa] 0.892 0.286 0.455 3e-22
224107431173 predicted protein [Populus trichocarpa] 0.835 0.676 0.463 7e-22
224144186 973 predicted protein [Populus trichocarpa] 0.921 0.132 0.447 2e-21
>gi|255581263|ref|XP_002531443.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223528936|gb|EEF30930.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 86/114 (75%), Gaps = 1/114 (0%)

Query: 15  ILLLVKWWWSEGCLEQERSALLQLKHFFNDDHRLQNWVDDENYSDCCQWERVECNNTTGR 74
           +L+L +    +GCL++ER+ALLQLK FF+    LQ W+  E+  DCCQWERVEC++ TGR
Sbjct: 11  LLVLSETCCCKGCLDKERAALLQLKPFFDSTLALQKWLGAEDNLDCCQWERVECSSITGR 70

Query: 75  VIKLDLTQTRKWESA-EWYMNASLFTPFQQLESLDLIGNNIAGCVENEGLERLS 127
           V +LDL  TR ++S+  WY+NASLF PF++L+SL L GN+I  CVENEG ERLS
Sbjct: 71  VTRLDLDTTRAYQSSRNWYLNASLFLPFEELKSLSLKGNSIVDCVENEGFERLS 124

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255585991|ref|XP_002533665.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223526433|gb|EEF28711.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224120284|ref|XP_002331010.1| predicted protein [Populus trichocarpa] gi|222872940|gb|EEF10071.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224120450|ref|XP_002331051.1| predicted protein [Populus trichocarpa] gi|222872981|gb|EEF10112.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224142503|ref|XP_002324596.1| predicted protein [Populus trichocarpa] gi|222866030|gb|EEF03161.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255583082|ref|XP_002532308.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223527977|gb|EEF30060.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224111186|ref|XP_002332969.1| predicted protein [Populus trichocarpa] gi|222834328|gb|EEE72805.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224142499|ref|XP_002324594.1| predicted protein [Populus trichocarpa] gi|222866028|gb|EEF03159.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224107431|ref|XP_002333512.1| predicted protein [Populus trichocarpa] gi|222837050|gb|EEE75429.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224144186|ref|XP_002336117.1| predicted protein [Populus trichocarpa] gi|222873047|gb|EEF10178.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query140
TAIR|locus:2037308 976 RLP14 "AT1G74180" [Arabidopsis 0.842 0.120 0.386 7.8e-15
TAIR|locus:2155909 908 RLP56 "AT5G49290" [Arabidopsis 0.792 0.122 0.377 9.7e-13
TAIR|locus:2040075 935 RLP21 "AT2G25470" [Arabidopsis 0.785 0.117 0.379 4.4e-12
TAIR|locus:2119535 725 RLP48 "receptor like protein 4 0.921 0.177 0.337 7e-10
TAIR|locus:2019662 965 RLP15 "AT1G74190" [Arabidopsis 0.814 0.118 0.300 1e-09
TAIR|locus:2825384 847 RLP12 "AT1G71400" [Arabidopsis 0.914 0.151 0.345 1.7e-08
TAIR|locus:2078112 868 RLP32 "receptor like protein 3 0.635 0.102 0.361 4.6e-08
TAIR|locus:2074633 943 RLP35 "AT3G11080" [Arabidopsis 0.621 0.092 0.371 5.1e-08
TAIR|locus:2119445 719 AT4G13820 [Arabidopsis thalian 0.6 0.116 0.32 2.6e-07
TAIR|locus:2044767 905 AT2G34930 "AT2G34930" [Arabido 0.728 0.112 0.322 7.5e-07
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 201 (75.8 bits), Expect = 7.8e-15, P = 7.8e-15
 Identities = 53/137 (38%), Positives = 77/137 (56%)

Query:     3 GSKRVWVSELIFILLLVKWWWSEGCLEQERSALLQLKHFFND-------DHRLQNWVDDE 55
             G   +WV     +LLLV+    + C+E+ER ALL+LK +          D  L  W +D 
Sbjct:     8 GQNLIWV-----MLLLVQLRGYKCCIEKERKALLELKKYMISKTADWGLDSVLPTWTNDT 62

Query:    56 NYSDCCQWERVECNNTTGRVIKLDLTQTRKWESAEWYMNASLFTPFQQLESLDLIG---N 112
               S+CC+WE ++CN T+GR+I+L + QT   ES+   +N SL  PF++L SL+L G   N
Sbjct:    63 K-SNCCRWEGLKCNQTSGRIIELSIGQTNFKESS--LLNLSLLHPFEELRSLNLSGEIYN 119

Query:   113 NIAGCVEN-EGLERLSR 128
                G  ++ EG E L R
Sbjct:   120 EFNGLFDDVEGYESLRR 136
GO:0007165 "signal transduction" evidence=IC
GO:0009507 "chloroplast" evidence=IDA
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119535 RLP48 "receptor like protein 48" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078112 RLP32 "receptor like protein 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119445 AT4G13820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2044767 AT2G34930 "AT2G34930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query140
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 2e-06
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information 
 Score = 41.5 bits (98), Expect = 2e-06
 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 4/44 (9%)

Query: 28 LEQERSALLQLKHFFNDDH--RLQNWVDDENYSDCCQWERVECN 69
          L  +R ALL  K   N D    L +W  + + SD C W  V C+
Sbjct: 1  LNDDRDALLAFKSSLNGDPSGALSSW--NPSSSDPCSWTGVTCD 42

Leucine Rich Repeats pfam00560 are short sequence motifs present in a number of proteins with diverse functions and cellular locations. Leucine Rich Repeats are often flanked by cysteine rich domains. This domain is often found at the N-terminus of tandem leucine rich repeats. Length = 42

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 140
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.49
PLN03150 623 hypothetical protein; Provisional 99.18
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.76
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.42
PLN03150623 hypothetical protein; Provisional 98.15
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.94
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 97.56
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 97.44
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.03
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 96.57
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.39
KOG4237 498 consensus Extracellular matrix protein slit, conta 96.18
KOG0617 264 consensus Ras suppressor protein (contains leucine 96.16
KOG0472565 consensus Leucine-rich repeat protein [Function un 95.73
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 95.52
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 94.93
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 94.85
KOG0472 565 consensus Leucine-rich repeat protein [Function un 94.65
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 94.51
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 94.03
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.64
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 93.29
PLN03210 1153 Resistant to P. syringae 6; Provisional 93.21
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 93.2
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 92.76
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 92.53
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 92.4
PLN03210 1153 Resistant to P. syringae 6; Provisional 91.38
KOG0617 264 consensus Ras suppressor protein (contains leucine 90.53
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.24
smart0037026 LRR Leucine-rich repeats, outliers. 90.24
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 89.63
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 89.46
cd00116 319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 88.65
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 88.22
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 86.83
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 86.16
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 86.02
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 85.78
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 85.41
KOG2982 418 consensus Uncharacterized conserved protein [Funct 84.95
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 84.89
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 84.79
KOG1259 490 consensus Nischarin, modulator of integrin alpha5 84.36
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 84.13
KOG4237 498 consensus Extracellular matrix protein slit, conta 83.86
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 81.06
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 80.62
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=99.49  E-value=1.8e-13  Score=117.79  Aligned_cols=100  Identities=23%  Similarity=0.455  Sum_probs=82.9

Q ss_pred             cHHHHHHHHHHHhhCC-CCCCCCCCCCCCCCCCCeeeeeeEEcCCCCCEEEEEcCCCCcccccccccCcccccCCcCCcE
Q 032440           28 LEQERSALLQLKHFFN-DDHRLQNWVDDENYSDCCQWERVECNNTTGRVIKLDLTQTRKWESAEWYMNASLFTPFQQLES  106 (140)
Q Consensus        28 ~~~~~~~L~~~k~~l~-~~~~l~~W~~~~~~~~~C~w~gv~c~~~~~~v~~l~l~~~~l~~~g~~~~~~~~l~~l~~L~~  106 (140)
                      .+.|..+|++||+.+. +.+.+.+|+   ...++|.|.||.|+. .++|+.++++++++.  |.  + +..+..+++|+.
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~~~~~w~---~~~~~c~w~gv~c~~-~~~v~~L~L~~~~i~--~~--~-~~~~~~l~~L~~   97 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLKYLSNWN---SSADVCLWQGITCNN-SSRVVSIDLSGKNIS--GK--I-SSAIFRLPYIQT   97 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcccCCCCC---CCCCCCcCcceecCC-CCcEEEEEecCCCcc--cc--C-ChHHhCCCCCCE
Confidence            5688999999999987 666778997   567899999999986 579999999998875  53  2 445788999999


Q ss_pred             EEccCCccccccCchhhh-CCCCCCeeeeece
Q 032440          107 LDLIGNNIAGCVENEGLE-RLSRWSFITQTLI  137 (140)
Q Consensus       107 L~Ls~N~l~G~iP~~~l~-~l~~L~~L~L~~~  137 (140)
                      |+|++|+++|.+|. .+. .+++|++|+|+.+
T Consensus        98 L~Ls~n~~~~~ip~-~~~~~l~~L~~L~Ls~n  128 (968)
T PLN00113         98 INLSNNQLSGPIPD-DIFTTSSSLRYLNLSNN  128 (968)
T ss_pred             EECCCCccCCcCCh-HHhccCCCCCEEECcCC
Confidence            99999999999998 455 8888888888653

>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query140
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-18
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-09
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score = 80.0 bits (198), Expect = 1e-18
 Identities = 22/91 (24%), Positives = 39/91 (42%), Gaps = 7/91 (7%)

Query: 26  GCLEQERSALLQLKHFFNDDHRLQNWVDDENYSDCCQWERVECNNTTGRVIKLDLTQTRK 85
             L +E   L+  K    D + L +W  +    + C ++ V C +   +V  +DL+    
Sbjct: 8   QSLYREIHQLISFKDVLPDKNLLPDWSSN---KNPCTFDGVTCRD--DKVTSIDLSSKP- 61

Query: 86  WESAEWYMNASLFTPFQQLESLDLIGNNIAG 116
                  +++SL      LESL L  ++I G
Sbjct: 62  LNVGFSAVSSSLL-SLTGLESLFLSNSHING 91
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query140
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.65
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.64
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.45
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.42
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 99.05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.55
3e6j_A 229 Variable lymphocyte receptor diversity region; var 98.54
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.43
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.43
2o6s_A 208 Variable lymphocyte receptor B; leucine-rich repea 98.41
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 98.38
1w8a_A 192 SLIT protein; signaling protein, secreted protein, 98.36
2v9t_B 220 SLIT homolog 2 protein N-product; structural prote 98.34
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.33
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 98.25
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 98.24
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.21
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.2
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.17
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 98.14
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.14
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.13
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 98.11
2wfh_A 193 SLIT homolog 2 protein C-product; developmental pr 98.06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.03
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 98.02
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 98.0
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.99
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.99
3e6j_A229 Variable lymphocyte receptor diversity region; var 97.98
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 97.93
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 97.91
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.91
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 97.88
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.86
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 97.86
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 97.86
3m19_A 251 Variable lymphocyte receptor A diversity region; a 97.84
3m19_A251 Variable lymphocyte receptor A diversity region; a 97.83
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 97.8
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.79
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 97.77
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 97.76
4ezg_A197 Putative uncharacterized protein; internalin-A, le 97.76
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 97.74
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 97.74
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 97.74
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 97.72
3rfs_A 272 Internalin B, repeat modules, variable lymphocyte 97.69
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 97.68
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 97.68
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 97.68
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 97.68
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 97.66
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 97.65
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 97.65
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.64
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 97.64
2xwt_C 239 Thyrotropin receptor; signaling protein-immune sys 97.63
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 97.62
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 97.61
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 97.61
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 97.59
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 97.59
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 97.58
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 97.58
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 97.57
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 97.56
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.55
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 97.54
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.54
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.54
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 97.51
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 97.5
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 97.5
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 97.5
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 97.49
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 97.48
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 97.47
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 97.46
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.46
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 97.45
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 97.45
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 97.44
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 97.44
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 97.44
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 97.44
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 97.43
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.43
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 97.42
2xwt_C 239 Thyrotropin receptor; signaling protein-immune sys 97.42
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 97.42
4ezg_A197 Putative uncharacterized protein; internalin-A, le 97.41
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 97.41
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 97.39
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 97.38
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 97.37
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 97.26
1wwl_A 312 Monocyte differentiation antigen CD14; LPS, immune 97.25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 97.21
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 97.19
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 97.14
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.97
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 96.93
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 96.93
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 96.87
4fmz_A347 Internalin; leucine rich repeat, structural genomi 96.83
4glp_A 310 Monocyte differentiation antigen CD14; alpha beta 96.83
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 96.81
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 96.81
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 96.8
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 96.77
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.76
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 96.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 96.68
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 96.68
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 96.64
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 96.61
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 96.6
4fmz_A347 Internalin; leucine rich repeat, structural genomi 96.59
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 96.49
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 96.43
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 96.36
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 96.35
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 96.15
1o6v_A 466 Internalin A; bacterial infection, extracellular r 96.14
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 96.11
1o6v_A466 Internalin A; bacterial infection, extracellular r 96.09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 96.02
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 95.89
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 95.8
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 95.74
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 95.59
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 95.43
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 95.25
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 95.18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 94.91
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.78
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 94.51
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 94.2
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 94.05
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.61
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 92.98
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 92.15
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 91.25
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 90.07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 89.29
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 88.26
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 85.1
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 83.87
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 82.95
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 81.25
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=99.65  E-value=5.3e-16  Score=117.00  Aligned_cols=104  Identities=29%  Similarity=0.503  Sum_probs=81.9

Q ss_pred             CCcHHHHHHHHHHHhhCC-CCCCCCCCCCCCCCCCCee--eeeeEEcCCC--CCEEEEEcCCCCcccccccccCcccccC
Q 032440           26 GCLEQERSALLQLKHFFN-DDHRLQNWVDDENYSDCCQ--WERVECNNTT--GRVIKLDLTQTRKWESAEWYMNASLFTP  100 (140)
Q Consensus        26 ~~~~~~~~~L~~~k~~l~-~~~~l~~W~~~~~~~~~C~--w~gv~c~~~~--~~v~~l~l~~~~l~~~g~~~~~~~~l~~  100 (140)
                      .|.++|+++|++||+++. +. .+.+|.   ...+||.  |.||.|+...  ++|+.++++++++.  |...+ |+.+..
T Consensus         2 ~c~~~~~~aL~~~k~~~~~~~-~l~~W~---~~~~~C~~~w~gv~C~~~~~~~~l~~L~L~~~~l~--~~~~~-~~~l~~   74 (313)
T 1ogq_A            2 LCNPQDKQALLQIKKDLGNPT-TLSSWL---PTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLP--KPYPI-PSSLAN   74 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG-GGTTCC---TTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCS--SCEEC-CGGGGG
T ss_pred             CCCHHHHHHHHHHHHhcCCcc-cccCCC---CCCCCCcCCCcceEeCCCCCCceEEEEECCCCCcc--CCccc-ChhHhC
Confidence            588999999999999997 43 678997   5678998  9999998633  79999999999876  41012 445777


Q ss_pred             CcCCcEEEccC-CccccccCchhhhCCCCCCeeeeece
Q 032440          101 FQQLESLDLIG-NNIAGCVENEGLERLSRWSFITQTLI  137 (140)
Q Consensus       101 l~~L~~L~Ls~-N~l~G~iP~~~l~~l~~L~~L~L~~~  137 (140)
                      +++|++|++++ |+++|.+|. .++++++|++|+|+.+
T Consensus        75 l~~L~~L~L~~~n~l~~~~p~-~l~~l~~L~~L~Ls~n  111 (313)
T 1ogq_A           75 LPYLNFLYIGGINNLVGPIPP-AIAKLTQLHYLYITHT  111 (313)
T ss_dssp             CTTCSEEEEEEETTEESCCCG-GGGGCTTCSEEEEEEE
T ss_pred             CCCCCeeeCCCCCcccccCCh-hHhcCCCCCEEECcCC
Confidence            88888888884 888888888 5888888888887654
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 140
d1ogqa_ 313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-07
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score = 45.1 bits (105), Expect = 6e-07
 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 7/58 (12%)

Query: 27 CLEQERSALLQLKHFFNDDHRLQNWVDDENYSDCCQ--WERVECNNTTG--RVIKLDL 80
          C  Q++ ALLQ+K    +   L +W+     +DCC   W  V C+  T   RV  LDL
Sbjct: 3  CNPQDKQALLQIKKDLGNPTTLSSWLPT---TDCCNRTWLGVLCDTDTQTYRVNNLDL 57

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query140
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 99.83
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.35
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.23
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.14
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.05
d1xkua_ 305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.97
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 97.88
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.8
d2ifga3156 High affinity nerve growth factor receptor, N-term 97.71
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.57
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 97.54
d1xwdc1 242 Follicle-stimulating hormone receptor {Human (Homo 97.46
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.43
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 97.42
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 97.41
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.3
d1p9ag_266 von Willebrand factor binding domain of glycoprote 97.29
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.23
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.05
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.04
d2omza2 384 Internalin A {Listeria monocytogenes [TaxId: 1639] 96.96
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 96.88
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 96.83
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 96.74
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 96.56
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 95.66
d1m9la_ 198 Outer arm dynein light chain 1 {Green algae (Chlam 95.39
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 95.27
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 95.18
d2astb2 284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 94.75
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 94.61
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 94.49
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 94.42
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 93.76
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 93.7
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 89.59
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.83  E-value=1.1e-20  Score=140.32  Aligned_cols=105  Identities=29%  Similarity=0.502  Sum_probs=89.4

Q ss_pred             CCcHHHHHHHHHHHhhCCCCCCCCCCCCCCCCCCCe--eeeeeEEcCC--CCCEEEEEcCCCCcccccccccCcccccCC
Q 032440           26 GCLEQERSALLQLKHFFNDDHRLQNWVDDENYSDCC--QWERVECNNT--TGRVIKLDLTQTRKWESAEWYMNASLFTPF  101 (140)
Q Consensus        26 ~~~~~~~~~L~~~k~~l~~~~~l~~W~~~~~~~~~C--~w~gv~c~~~--~~~v~~l~l~~~~l~~~g~~~~~~~~l~~l  101 (140)
                      .|.++|++||++||+.+.....+.+|.   .+++||  .|.||+|+..  .+||++++|+++++.  |...+ |+.+++|
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~~l~sW~---~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~--g~~~l-p~~l~~L   75 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPTTLSSWL---PTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLP--KPYPI-PSSLANL   75 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCGGGTTCC---TTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCS--SCEEC-CGGGGGC
T ss_pred             CCCHHHHHHHHHHHHHCCCCCcCCCCC---CCCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCC--CCCCC-ChHHhcC
Confidence            588999999999999998334688998   678999  5999999863  348999999999886  53234 4468999


Q ss_pred             cCCcEEEccC-CccccccCchhhhCCCCCCeeeeece
Q 032440          102 QQLESLDLIG-NNIAGCVENEGLERLSRWSFITQTLI  137 (140)
Q Consensus       102 ~~L~~L~Ls~-N~l~G~iP~~~l~~l~~L~~L~L~~~  137 (140)
                      ++|++|||++ |+++|+||+ .|+++++|++|+|+.+
T Consensus        76 ~~L~~L~Ls~~N~l~g~iP~-~i~~L~~L~~L~Ls~N  111 (313)
T d1ogqa_          76 PYLNFLYIGGINNLVGPIPP-AIAKLTQLHYLYITHT  111 (313)
T ss_dssp             TTCSEEEEEEETTEESCCCG-GGGGCTTCSEEEEEEE
T ss_pred             cccccccccccccccccccc-ccccccccchhhhccc
Confidence            9999999997 899999999 6999999999999865
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure