Citrus Sinensis ID: 032536

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
METGATKATVKAVALISGATSVKGSLHFVQGPNGVTHVKGKITGLKPGLHGFHIHALGDTTNGCNSTGPHFNPLKKDHGAPSDNERHTGDLGNIVAGPDGVAEVSIADRMVNGLINKNFRSVHCRLYEIRLVLFFHQII
cccccccccEEEEEEEcccccEEEEEEEEEcccccEEEEEEEEcccccEEEEEEEccccccccccccccccccccccccccccccccccccccEEEccccEEEEEEEEccEEEccccccEEEccccccccEEEEEEEEc
ccccHHHcEEEEEEEcEcccccccEEEEEEEccccEEEEEEEEccccEEcEEEEEccccccccccccccEcccccccccccccccccccEccccEEccccEEEEEEEEcccEEEEHHHHHHHHHHHHHHHHHHHHHHHc
METGATKATVKAVALISGatsvkgslhfvqgpngvthvkgkitglkpglhgfhihalgdttngcnstgphfnplkkdhgapsdnerhtgdlgnivagpdgvaEVSIADRMVNGLINKNFRSVHCRLYEIRLVLFFHQII
metgatkatVKAVALISGATSVKGSLHFVQGPNGVTHVKGKITGLKPGLHGFHIHALGDTTNGCNSTGPHFNPLKKDHGAPSDNERHTGDLGNIVAGPDGVAEVSIADRMVNGLINKNFRSVHCRLYEIRLVLFFHQII
METGatkatvkavaLISGATSVKGSLHFVQGPNGVTHVKGKITGLKPGLHGFHIHALGDTTNGCNSTGPHFNPLKKDHGAPSDNERHTGDLGNIVAGPDGVAEVSIADRMVNGLINKNFRSVHCRLYEIRLVLFFHQII
*********VKAVALISGATSVKGSLHFVQGPNGVTHVKGKITGLKPGLHGFHIHALGDTTNGC**************************LGNIVAGPDGVAEVSIADRMVNGLINKNFRSVHCRLYEIRLVLFFHQI*
************VALISGATSVKGSLHFVQGPNGVTHVKGKITGLKPGLHGFHIHALGDTTNGCNSTGPHFNPLKKDHGAPSDNERHTGDLGNIVAGPDGVAEVSIADRMVNGLINKNFRSVHCRLYEIRLVLFFHQII
*********VKAVALISGATSVKGSLHFVQGPNGVTHVKGKITGLKPGLHGFHIHALGDTTNGCNSTGPHFNPLKKDHGAPSDNERHTGDLGNIVAGPDGVAEVSIADRMVNGLINKNFRSVHCRLYEIRLVLFFHQII
****ATKATVKAVALISGATSVKGSLHFVQGPNGVTHVKGKITGLKPGLHGFHIHALGDTTNGCNSTGPHFNPLKKDHGAPSDNERHTGDLGNIVAGPDGVAEVSIADRMVNGLINKNFRSVHCRLYEIRLVLFFHQII
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
METGATKATVKAVALISGATSVKGSLHFVQGPNGVTHVKGKITGLKPGLHGFHIHALGDTTNGCNSTGPHFNPLKKDHGAPSDNERHTGDLGNIVAGPDGVAEVSIADRMVNGLINKNFRSVHCRLYEIRLVLFFHQII
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query139 2.2.26 [Sep-21-2011]
O49044156 Superoxide dismutase [Cu- N/A no 0.733 0.653 0.774 4e-41
Q9FK60164 Superoxide dismutase [Cu- yes no 0.769 0.652 0.616 2e-33
P28757152 Superoxide dismutase [Cu- no no 0.733 0.671 0.627 5e-32
P24669154 Superoxide dismutase [Cu- N/A no 0.733 0.662 0.627 7e-32
P11428151 Superoxide dismutase [Cu- N/A no 0.726 0.668 0.647 1e-31
O22668152 Superoxide dismutase [Cu- N/A no 0.733 0.671 0.607 2e-31
Q0DRV6152 Superoxide dismutase [Cu- no no 0.733 0.671 0.617 2e-31
A2XGP6152 Superoxide dismutase [Cu- N/A no 0.733 0.671 0.617 2e-31
P23345152 Superoxide dismutase [Cu- N/A no 0.733 0.671 0.598 3e-31
P23346152 Superoxide dismutase [Cu- N/A no 0.733 0.671 0.598 3e-31
>sp|O49044|SODC2_MESCR Superoxide dismutase [Cu-Zn] 2 OS=Mesembryanthemum crystallinum GN=SODCC.2 PE=2 SV=1 Back     alignment and function desciption
 Score =  166 bits (420), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 88/102 (86%)

Query: 10  VKAVALISGATSVKGSLHFVQGPNGVTHVKGKITGLKPGLHGFHIHALGDTTNGCNSTGP 69
           +KAVA+I+G  +VKGSL F+Q   GVTHVKG+ITGL PGLHGFHIHALGDTTNGCNSTGP
Sbjct: 4   IKAVAVINGNNNVKGSLQFIQDSTGVTHVKGRITGLTPGLHGFHIHALGDTTNGCNSTGP 63

Query: 70  HFNPLKKDHGAPSDNERHTGDLGNIVAGPDGVAEVSIADRMV 111
           HFNPLKKDHGAP D ERH GDLGN+VAG DGVAEVS+ D  +
Sbjct: 64  HFNPLKKDHGAPFDTERHAGDLGNVVAGADGVAEVSVRDTQI 105
Destroys radicals which are normally produced within the cells and which are toxic to biological systems.
Mesembryanthemum crystallinum (taxid: 3544)
EC: 1EC: .EC: 1EC: 5EC: .EC: 1EC: .EC: 1
>sp|Q9FK60|SODC3_ARATH Superoxide dismutase [Cu-Zn] 3 OS=Arabidopsis thaliana GN=CSD3 PE=1 SV=1 Back     alignment and function description
>sp|P28757|SODC2_ORYSJ Superoxide dismutase [Cu-Zn] 2 OS=Oryza sativa subsp. japonica GN=SODCC2 PE=1 SV=2 Back     alignment and function description
>sp|P24669|SODC_PINSY Superoxide dismutase [Cu-Zn] OS=Pinus sylvestris GN=SODCC PE=2 SV=1 Back     alignment and function description
>sp|P11428|SODC2_MAIZE Superoxide dismutase [Cu-Zn] 2 OS=Zea mays GN=SODCC.1 PE=2 SV=2 Back     alignment and function description
>sp|O22668|SODC_PANGI Superoxide dismutase [Cu-Zn] OS=Panax ginseng GN=SODCC PE=2 SV=1 Back     alignment and function description
>sp|Q0DRV6|SODC1_ORYSJ Superoxide dismutase [Cu-Zn] 1 OS=Oryza sativa subsp. japonica GN=SODCC1 PE=1 SV=1 Back     alignment and function description
>sp|A2XGP6|SODC1_ORYSI Superoxide dismutase [Cu-Zn] 1 OS=Oryza sativa subsp. indica GN=SODCC1 PE=2 SV=2 Back     alignment and function description
>sp|P23345|SODC4_MAIZE Superoxide dismutase [Cu-Zn] 4A OS=Zea mays GN=SODCC.3 PE=2 SV=2 Back     alignment and function description
>sp|P23346|SODC5_MAIZE Superoxide dismutase [Cu-Zn] 4AP OS=Zea mays GN=SODCC.2 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query139
186886514161 extracellular Cu/Zn superoxide dismutase 0.791 0.683 0.801 4e-44
301322852161 cytosolic copper/zinc-superoxide dismuta 0.784 0.677 0.821 3e-43
301322842161 cytosolic copper/zinc-superoxide dismuta 0.784 0.677 0.812 7e-43
345106300152 cytosolic copper/zinc-superoxide dismuta 0.784 0.717 0.812 7e-43
13274154158 putative CuZn-superoxide dismutase [Popu 0.741 0.651 0.815 3e-42
224123758158 predicted protein [Populus trichocarpa] 0.741 0.651 0.805 1e-41
225441599123 PREDICTED: superoxide dismutase [Cu-Zn] 0.748 0.845 0.798 1e-41
224146003158 predicted protein [Populus trichocarpa] 0.741 0.651 0.796 2e-41
15131679158 putative CuZn-superoxide dismutase [Popu 0.741 0.651 0.796 5e-41
225441597156 PREDICTED: superoxide dismutase [Cu-Zn] 0.748 0.666 0.788 5e-41
>gi|186886514|gb|ACC93639.1| extracellular Cu/Zn superoxide dismutase [Gossypium hirsutum] Back     alignment and taxonomy information
 Score =  182 bits (462), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 99/111 (89%), Gaps = 1/111 (0%)

Query: 1   METGATKATVKAVALISGATSVKGSLHFVQGPNGVTHVKGKITGLKPGLHGFHIHALGDT 60
           ME G +KAT+KAVALI+G T+V+G +HF Q PNG+THV+GKITGL PGLHGFHIHALGDT
Sbjct: 1   MECG-SKATLKAVALITGDTNVRGFIHFTQIPNGITHVQGKITGLSPGLHGFHIHALGDT 59

Query: 61  TNGCNSTGPHFNPLKKDHGAPSDNERHTGDLGNIVAGPDGVAEVSIADRMV 111
           TNGCNSTGPHFNPLKKDHGAPSD ERH GDLGNI+AGPDGVAEVSI D  +
Sbjct: 60  TNGCNSTGPHFNPLKKDHGAPSDGERHAGDLGNIIAGPDGVAEVSIKDWQI 110

Source: Gossypium hirsutum

Species: Gossypium hirsutum

Genus: Gossypium

Family: Malvaceae

Order: Malvales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|301322852|gb|ADK70242.1| cytosolic copper/zinc-superoxide dismutase [Dimocarpus longan] Back     alignment and taxonomy information
>gi|301322842|gb|ADK70237.1| cytosolic copper/zinc-superoxide dismutase [Dimocarpus longan] gi|301322844|gb|ADK70238.1| cytosolic copper/zinc-superoxide dismutase [Dimocarpus longan] gi|301322846|gb|ADK70239.1| cytosolic copper/zinc-superoxide dismutase [Dimocarpus longan] gi|301322848|gb|ADK70240.1| cytosolic copper/zinc-superoxide dismutase [Dimocarpus longan] gi|301322850|gb|ADK70241.1| cytosolic copper/zinc-superoxide dismutase [Dimocarpus longan] gi|345018984|gb|ADG26762.2| cytosolic copper/zinc-superoxide dismutase [Dimocarpus longan] Back     alignment and taxonomy information
>gi|345106300|gb|AEN71835.1| cytosolic copper/zinc-superoxide dismutase variant 1 [Dimocarpus longan] Back     alignment and taxonomy information
>gi|13274154|emb|CAC33847.1| putative CuZn-superoxide dismutase [Populus tremula x Populus tremuloides] Back     alignment and taxonomy information
>gi|224123758|ref|XP_002319157.1| predicted protein [Populus trichocarpa] gi|222857533|gb|EEE95080.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225441599|ref|XP_002281608.1| PREDICTED: superoxide dismutase [Cu-Zn] 2 isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224146003|ref|XP_002325843.1| predicted protein [Populus trichocarpa] gi|222862718|gb|EEF00225.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|15131679|emb|CAC33846.2| putative CuZn-superoxide dismutase [Populus tremula x Populus tremuloides] Back     alignment and taxonomy information
>gi|225441597|ref|XP_002281571.1| PREDICTED: superoxide dismutase [Cu-Zn] 2 isoform 1 [Vitis vinifera] gi|297739768|emb|CBI29950.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query139
UNIPROTKB|Q0DTX5162 Os03g0219200 "Superoxide dismu 0.705 0.604 0.656 2.5e-33
TAIR|locus:2172324164 CSD3 "AT5G18100" [Arabidopsis 0.697 0.591 0.639 4.7e-32
UNIPROTKB|Q0DRV6152 SODCC1 "Superoxide dismutase [ 0.697 0.638 0.608 1.6e-31
UNIPROTKB|P28757152 SODCC2 "Superoxide dismutase [ 0.697 0.638 0.608 3.3e-31
UNIPROTKB|P33431153 SOD1 "Superoxide dismutase [Cu 0.705 0.640 0.581 5.6e-29
TAIR|locus:2025595152 CSD1 "copper/zinc superoxide d 0.676 0.618 0.606 9.1e-29
UNIPROTKB|Q8WNN6153 SOD1 "Superoxide dismutase [Cu 0.697 0.633 0.567 2.8e-27
UNIPROTKB|Q8HXP8154 SOD1 "Superoxide dismutase [Cu 0.705 0.636 0.555 3.5e-27
UNIPROTKB|Q8HXP9154 SOD1 "Superoxide dismutase [Cu 0.705 0.636 0.555 3.5e-27
UNIPROTKB|Q8HXQ0154 SOD1 "Superoxide dismutase [Cu 0.705 0.636 0.545 3.5e-27
UNIPROTKB|Q0DTX5 Os03g0219200 "Superoxide dismutase [Cu-Zn]" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
 Score = 363 (132.8 bits), Expect = 2.5e-33, P = 2.5e-33
 Identities = 67/102 (65%), Positives = 80/102 (78%)

Query:    15 LISGA---TSVKGSLHFVQGPN-GVTHVKGKITGLKPGLHGFHIHALGDTTNGCNSTGPH 70
             LI GA   ++V G+LHF Q P+ G T V+G++TGL PGLHGFHIH+ GDTTNGCNSTGPH
Sbjct:    11 LIGGAGGNSAVAGALHFFQDPSTGYTEVRGRVTGLAPGLHGFHIHSFGDTTNGCNSTGPH 70

Query:    71 FNPLKKDHGAPSDNERHTGDLGNIVAGPDGVAEVSIADRMVN 112
             FNP  K HGAPSD+ERH GDLGNIVA  DGVA++ I D  ++
Sbjct:    71 FNPHNKSHGAPSDDERHVGDLGNIVANKDGVADIFIKDLQIS 112
GO:0004784 "superoxide dismutase activity" evidence=IBA
GO:0005507 "copper ion binding" evidence=IBA
GO:0008270 "zinc ion binding" evidence=IBA
GO:0019430 "removal of superoxide radicals" evidence=IBA
TAIR|locus:2172324 CSD3 "AT5G18100" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q0DRV6 SODCC1 "Superoxide dismutase [Cu-Zn] 1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|P28757 SODCC2 "Superoxide dismutase [Cu-Zn] 2" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|P33431 SOD1 "Superoxide dismutase [Cu-Zn]" [Cavia porcellus (taxid:10141)] Back     alignment and assigned GO terms
TAIR|locus:2025595 CSD1 "copper/zinc superoxide dismutase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q8WNN6 SOD1 "Superoxide dismutase [Cu-Zn]" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q8HXP8 SOD1 "Superoxide dismutase [Cu-Zn]" [Callithrix jacchus (taxid:9483)] Back     alignment and assigned GO terms
UNIPROTKB|Q8HXP9 SOD1 "Superoxide dismutase [Cu-Zn]" [Cebus apella (taxid:9515)] Back     alignment and assigned GO terms
UNIPROTKB|Q8HXQ0 SOD1 "Superoxide dismutase [Cu-Zn]" [Macaca mulatta (taxid:9544)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P33431SODC_CAVPO1, ., 1, 5, ., 1, ., 10.58820.73380.6666yesno
P08228SODC_MOUSE1, ., 1, 5, ., 1, ., 10.55760.74100.6688yesno
Q8WNN6SODC_CANFA1, ., 1, 5, ., 1, ., 10.56860.73380.6666yesno
Q8HXQ0SODC_MACMU1, ., 1, 5, ., 1, ., 10.54800.74100.6688yesno
Q9FK60SODC3_ARATH1, ., 1, 5, ., 1, ., 10.61680.76970.6524yesno
P07632SODC_RAT1, ., 1, 5, ., 1, ., 10.54280.74820.6753yesno
Q8HXP8SODC_CALJA1, ., 1, 5, ., 1, ., 10.55230.74820.6753yesno
O49044SODC2_MESCR1, ., 1, 5, ., 1, ., 10.77450.73380.6538N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.15.1.10.946
3rd Layer1.15.10.963

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_Genewise1_v1.C_LG_XIII1983
hypothetical protein; Destroys radicals which are normally produced within the cells and which are toxic to biological systems (By similarity) (158 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query139
PLN02642164 PLN02642, PLN02642, copper, zinc superoxide dismut 8e-41
PLN02386152 PLN02386, PLN02386, superoxide dismutase [Cu-Zn] 4e-40
pfam00080140 pfam00080, Sod_Cu, Copper/zinc superoxide dismutas 2e-37
cd00305144 cd00305, Cu-Zn_Superoxide_Dismutase, Copper/zinc s 4e-36
COG2032179 COG2032, SodC, Cu/Zn superoxide dismutase [Inorgan 1e-15
PLN02957238 PLN02957, PLN02957, copper, zinc superoxide dismut 5e-13
PRK15388177 PRK15388, PRK15388, Cu/Zn superoxide dismutase; Pr 6e-06
PRK10290173 PRK10290, PRK10290, superoxide dismutase; Provisio 1e-04
>gnl|CDD|178248 PLN02642, PLN02642, copper, zinc superoxide dismutase Back     alignment and domain information 
 Score =  133 bits (336), Expect = 8e-41
 Identities = 67/107 (62%), Positives = 82/107 (76%)

Query: 5   ATKATVKAVALISGATSVKGSLHFVQGPNGVTHVKGKITGLKPGLHGFHIHALGDTTNGC 64
           A +  ++AVALI+G  +V+G L FVQ   G THV GKI+GL PG HGFHIH+ GDTTNGC
Sbjct: 3   APRGNLRAVALIAGDNNVRGCLQFVQDIFGTTHVTGKISGLSPGFHGFHIHSFGDTTNGC 62

Query: 65  NSTGPHFNPLKKDHGAPSDNERHTGDLGNIVAGPDGVAEVSIADRMV 111
            STGPHFNPL + HG P++ ERH GDLGNI+AG DGVAE+ I D+ +
Sbjct: 63  ISTGPHFNPLNRVHGPPNEEERHAGDLGNILAGSDGVAEILIKDKHI 109

Length = 164
>gnl|CDD|166027 PLN02386, PLN02386, superoxide dismutase [Cu-Zn] Back     alignment and domain information
>gnl|CDD|215700 pfam00080, Sod_Cu, Copper/zinc superoxide dismutase (SODC) Back     alignment and domain information
>gnl|CDD|238186 cd00305, Cu-Zn_Superoxide_Dismutase, Copper/zinc superoxide dismutase (SOD) Back     alignment and domain information
>gnl|CDD|224943 COG2032, SodC, Cu/Zn superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|215516 PLN02957, PLN02957, copper, zinc superoxide dismutase Back     alignment and domain information
>gnl|CDD|185286 PRK15388, PRK15388, Cu/Zn superoxide dismutase; Provisional Back     alignment and domain information
>gnl|CDD|182357 PRK10290, PRK10290, superoxide dismutase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 139
PLN02642164 copper, zinc superoxide dismutase 100.0
PLN02386152 superoxide dismutase [Cu-Zn] 100.0
cd00305144 Cu-Zn_Superoxide_Dismutase Copper/zinc superoxide 100.0
KOG0441154 consensus Cu2+/Zn2+ superoxide dismutase SOD1 [Ino 100.0
PRK15388177 Cu/Zn superoxide dismutase; Provisional 100.0
PF00080142 Sod_Cu: Copper/zinc superoxide dismutase (SODC); I 100.0
PRK10290173 superoxide dismutase; Provisional 100.0
PLN02957238 copper, zinc superoxide dismutase 100.0
COG2032179 SodC Cu/Zn superoxide dismutase [Inorganic ion tra 100.0
KOG4656247 consensus Copper chaperone for superoxide dismutas 99.97
PF07452119 CHRD: CHRD domain; InterPro: IPR010895 CHRD (after 84.35
smart00754118 CHRD A domain in the BMP inhibitor chordin and in 82.39
>PLN02642 copper, zinc superoxide dismutase Back     alignment and domain information 
Probab=100.00  E-value=4.2e-42  Score=258.95  Aligned_cols=127  Identities=55%  Similarity=0.919  Sum_probs=117.6

Q ss_pred             CCccccccceeEEEEEcCCCCeEEEEEEEEcCCCcEEEEEEEecCCCCeeeEEEeCCCCCCCCCCCCCCCccCCCCCCCC
Q 032536            1 METGATKATVKAVALISGATSVKGSLHFVQGPNGVTHVKGKITGLKPGLHGFHIHALGDTTNGCNSTGPHFNPLKKDHGA   80 (139)
Q Consensus         1 ~~~~~~~~~~~Ava~l~~~~~v~G~v~f~q~~~g~~~v~~~l~GL~~G~hg~HIHe~Gd~s~~c~saGgHfnP~~~~hg~   80 (139)
                      ||.|.  +..+|+|+|++.++++|+|+|+|..++.++|+++|+||+||+|+|||||+|||+++|+|||+||||.+..||.
T Consensus         1 ~~~~~--~~~~A~a~~~g~~~v~G~v~f~q~~~g~v~I~~~v~GL~pG~HG~HIHe~Gd~~~g~~SaGgHfNP~~~~HG~   78 (164)
T PLN02642          1 MEAPR--GNLRAVALIAGDNNVRGCLQFVQDIFGTTHVTGKISGLSPGFHGFHIHSFGDTTNGCISTGPHFNPLNRVHGP   78 (164)
T ss_pred             CCccC--CCeeEEEEEcCCCCcEEEEEEEECCCCcEEEEEEEcCCCCCceeEEEcCCCcCCCCcccccCcccCCCCcCCC
Confidence            55543  5578999999888899999999987667999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCccCceEECCCceEEEEEEeCeEEeeccCCCccccceEEEEEee
Q 032536           81 PSDNERHTGDLGNIVAGPDGVAEVSIADRMVNGLINKNFRSVHCRLYEIRLV  132 (139)
Q Consensus        81 p~~~~~h~GDLgni~~~~~G~~~~~~~d~~l~L~~~~~~~sIiGRSiVI~~~  132 (139)
                      |++..||+||||||+++++|++++++++++++|.   +.++|+|||||||..
T Consensus        79 ~~~~~rH~GDLgNi~a~~~G~a~~~~~~~~i~L~---g~~~iiGRalVVHa~  127 (164)
T PLN02642         79 PNEEERHAGDLGNILAGSDGVAEILIKDKHIPLS---GQYSILGRAVVVHAD  127 (164)
T ss_pred             CCcCCCcccccCCEEECCCCeEEEEEEcCceecC---CCCCcCCcEEEEecc
Confidence            9999999999999999999999999999999997   468999999999963

>PLN02386 superoxide dismutase [Cu-Zn] Back     alignment and domain information
>cd00305 Cu-Zn_Superoxide_Dismutase Copper/zinc superoxide dismutase (SOD) Back     alignment and domain information
>KOG0441 consensus Cu2+/Zn2+ superoxide dismutase SOD1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15388 Cu/Zn superoxide dismutase; Provisional Back     alignment and domain information
>PF00080 Sod_Cu: Copper/zinc superoxide dismutase (SODC); InterPro: IPR001424 Superoxide dismutases are ubiquitous metalloproteins that prevent damage by oxygen-mediated free radicals by catalysing the dismutation of superoxide into molecular oxygen and hydrogen peroxide [] Back     alignment and domain information
>PRK10290 superoxide dismutase; Provisional Back     alignment and domain information
>PLN02957 copper, zinc superoxide dismutase Back     alignment and domain information
>COG2032 SodC Cu/Zn superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF07452 CHRD: CHRD domain; InterPro: IPR010895 CHRD (after SWISS-PROT abbreviation for chordin) is a novel domain identified in chordin, an inhibitor of bone morphogenetic proteins Back     alignment and domain information
>smart00754 CHRD A domain in the BMP inhibitor chordin and in microbial proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query139
2q2l_A152 Crystal Structure Of Superoxide Dismutase From P. A 4e-28
1srd_A154 Three-Dimensional Structure Of Cu,Zn-Superoxide Dis 8e-27
3gtt_A153 Mouse Sod1 Length = 153 4e-26
3gtv_A153 Human-Mouse Sod1 Chimera Length = 153 6e-26
3km1_A154 Zinc-Reconstituted Tomato Chloroplast Superoxide Di 8e-26
1to4_A156 Structure Of The Cytosolic Cu,Zn Sod From S. Manson 7e-25
3ltv_A153 Mouse-Human Sod1 Chimera Length = 153 8e-25
1xso_A150 Three-Dimensional Structure Of Xenopus Laevis Cu,Zn 9e-25
1n19_A154 Structure Of The Hsod A4v Mutant Length = 154 1e-24
1sos_A154 Atomic Structures Of Wild-type And Thermostable Mut 1e-24
1l3n_A153 The Solution Structure Of Reduced Dimeric Copper Zi 1e-24
1fun_A153 Superoxide Dismutase Mutant With Lys 136 Replaced B 1e-24
2gbt_A153 C6aC111A CUZN SUPEROXIDE DISMUTASE Length = 153 1e-24
1n18_A154 Thermostable Mutant Of Human Superoxide Dismutase, 1e-24
3h2p_A153 Human Sod1 D124v Variant Length = 153 1e-24
1p1v_A153 Crystal Structure Of Fals-Associated Human Copper-Z 1e-24
4b3e_A154 Structure Of Copper-Zinc Superoxide Dismutase Compl 1e-24
1hl4_A154 The Structure Of Apo Type Human Cu, Zn Superoxide D 1e-24
1uxl_A153 I113t Mutant Of Human Sod1 Length = 153 1e-24
1hl5_A153 The Structure Of Holo Type Human Cu, Zn Superoxide 1e-24
2c9s_A153 1.24 Angstroms Resolution Structure Of Zn-Zn Human 1e-24
1ozu_A153 Crystal Structure Of Familial Als Mutant S134n Of H 1e-24
1uxm_A153 A4v Mutant Of Human Sod1 Length = 153 1e-24
3gzq_A154 Human Sod1 A4v Metal-Free Variant Length = 154 1e-24
2wyt_A153 1.0 A Resolution Structure Of L38v Sod1 Mutant Leng 3e-24
3mnd_A152 Crystallographic Analysis Of The Cystosolic CuZN SU 3e-24
2wyz_A153 L38v Sod1 Mutant Complexed With Ump Length = 153 3e-24
1e9p_B151 Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angst 3e-24
3f7k_A152 X-Ray Crystal Structure Of An Alvinella Pompejana C 4e-24
3gzp_A153 Human Sod1 G93a Metal-Free Variant Length = 153 5e-24
3gzo_A154 Human Sod1 G93a Variant Length = 154 5e-24
2wko_F154 Structure Of Metal Loaded Pathogenic Sod1 Mutant G9 5e-24
4a7g_A153 Structure Of Human I113t Sod1 Mutant Complexed With 5e-24
3ecw_A153 Crystal Structure Of The Als-Related Pathological M 6e-24
2zky_A159 Crystal Structure Of Human Cu-Zn Superoxide Dismuta 6e-24
1ptz_A153 Crystal Structure Of The Human Cu, Zn Superoxide Di 6e-24
3qqd_A154 Human Sod1 H80r Variant, P212121 Crystal Form Lengt 7e-24
1oez_W153 Zn His46arg Mutant Of Human Cu, Zn Superoxide Dismu 7e-24
3h2q_A153 Human Sod1 H80r Variant, P21 Crystal Form Length = 7e-24
1e9p_A151 Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angst 7e-24
2vr8_A154 Crystal Structure Of G85r Als Mutant Of Human Cu,Zn 1e-23
3cqq_A153 Human Sod1 G85r Variant, Structure Ii Length = 153 1e-23
2vr7_A154 Crystal Structure Of G85r Als Mutant Of Human Cu,Zn 1e-23
2vr6_A153 Crystal Structure Of G85r Als Mutant Of Human Cu,Zn 1e-23
1azv_A153 Familial Als Mutant G37r Cuznsod (Human) Length = 1 1e-23
2zkw_A159 Crystal Structure Of Human Cu-Zn Superoxide Dismuta 1e-23
2gbu_A153 C6a/c111a/c57a/c146a Apo Cuzn Superoxide Dismutase 1e-23
1ba9_A153 The Solution Structure Of Reduced Monomeric Superox 1e-23
1mfm_A153 Monomeric Human Sod Mutant F50eG51EE133Q AT ATOMIC 1e-23
1dsw_A153 The Solution Structure Of A Monomeric, Reduced Form 1e-23
2xjk_A153 Monomeric Human Cu,Zn Superoxide Dismutase Length = 1e-23
1e9o_A152 Crystal Structure Of Bovine Sod - 1 Of 3 Length = 1 2e-23
1e9q_A151 Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Leng 2e-23
3gqf_A153 Structural And Biophysical Properties Of The Pathog 3e-23
2nnx_A154 Crystal Structure Of The H46r, H48q Double Mutant O 3e-23
2r27_A154 Constitutively Zinc-Deficient Mutant Of Human Super 4e-23
1e9q_B151 Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Leng 5e-23
1e9o_B152 Crystal Structure Of Bovine Sod - 1 Of 3 Length = 1 5e-23
1cb4_A151 Crystal Structure Of Copper, Zinc Superoxide Dismut 5e-23
3sod_O152 Changes In Crystallographic Structure And Thermosta 7e-23
1q0e_A152 Atomic Resolution (1.15 ) Crystal Structure Of Bovi 7e-23
1cob_A151 Crystal Structure Solution And Refinement Of The Se 7e-23
1sda_O152 Crystal Structure Of Peroxynitrite-Modified Bovine 8e-23
4bcy_A153 Monomeric Human Cu,zn Superoxide Dismutase, Mutatio 1e-22
3kbe_A157 Metal-Free C. Elegans Cu,Zn Superoxide Dismutase Le 1e-22
2xjl_A153 Monomeric Human Cu,Zn Superoxide Dismutase Without 5e-22
3hff_A153 Monomeric Human Cu,Zn Superoxide Dismutase Without 2e-20
2e46_A157 Crystal Structure Analysis Of The Clock Protein Ea4 9e-20
2e47_A156 Crystal Structure Analysis Of The Clock Protein Ea4 1e-19
1do5_A154 Human Copper Chaperone For Superoxide Dismutase Dom 2e-19
3l9y_A154 Crystal Structures Of Holo And Cu-Deficient CuZNSOD 9e-19
3l9e_A154 Crystal Structures Of Holo And Cu-Deficient CuZNSOD 9e-19
1sdy_A153 Structure Solution And Molecular Dynamics Refinemen 5e-18
1f1g_A154 Crystal Structure Of Yeast Cuznsod Exposed To Nitri 5e-18
1f1a_A154 Crystal Structure Of Yeast H48q Cuznsod Fals Mutant 2e-17
1f18_A154 Crystal Structure Of Yeast Copper-Zinc Superoxide D 3e-17
1jk9_A153 Heterodimer Between H48f-Ysod1 And Yccs Length = 15 4e-17
1f1d_A154 Crystal Structure Of Yeast H46c Cuznsod Mutant Leng 5e-17
1b4t_A153 H48c Yeast Cu(Ii)ZN SUPEROXIDE DISMUTASE ROOM TEMPE 5e-17
3ce1_A168 Crystal Structure Of The CuZN SUPEROXIDE DISMUTASE 9e-15
4bcz_A110 Monomeric Human Cu,zn Superoxide Dismutase, Loops I 4e-06
2jlp_A222 Crystal Structure Of Human Extracellular Copper-Zin 6e-06
4bd4_A110 Monomeric Human Cu,zn Superoxide Dismutase, Loops I 3e-05
1xtm_B175 Crystal Structure Of The Double Mutant Y88h-p104h O 4e-05
1xtl_B175 Crystal Structure Of P104h Mutant Of Sod-Like Prote 1e-04
1u3n_A162 A Sod-Like Protein From B. Subtilis, Unstructured I 8e-04
>pdb|2Q2L|A Chain A, Crystal Structure Of Superoxide Dismutase From P. Atrosanguina Length = 152 Back     alignment and structure 
Iteration: 1

 Score =  119 bits (299), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 57/97 (58%), Positives = 70/97 (72%)
Query: 15  LISGATSVKGSLHFVQGPNGVTHVKGKITGLKPGLHGFHIHALGDTTNGCNSTGPHFNPL 74
           ++S +  V G++ F Q  +G T V G I+GLKPGLHGFH+HALGDTTNGC STGPHFNP 
Sbjct: 7   VLSSSEGVAGTILFTQEGDGPTTVTGNISGLKPGLHGFHVHALGDTTNGCMSTGPHFNPA 66
Query: 75  KKDHGAPSDNERHTGDLGNIVAGPDGVAEVSIADRMV 111
            K+HG+P D  RH GDLGNI  G DG A  +I D+ +
Sbjct: 67  GKEHGSPEDETRHAGDLGNITVGDDGTACFTIVDKQI 103
>pdb|1SRD|A Chain A, Three-Dimensional Structure Of Cu,Zn-Superoxide Dismutase From Spinach At 2.0 Angstroms Resolution Length = 154 Back     alignment and structure
>pdb|3GTT|A Chain A, Mouse Sod1 Length = 153 Back     alignment and structure
>pdb|3GTV|A Chain A, Human-Mouse Sod1 Chimera Length = 153 Back     alignment and structure
>pdb|3KM1|A Chain A, Zinc-Reconstituted Tomato Chloroplast Superoxide Dismutase Length = 154 Back     alignment and structure
>pdb|1TO4|A Chain A, Structure Of The Cytosolic Cu,Zn Sod From S. Mansoni Length = 156 Back     alignment and structure
>pdb|3LTV|A Chain A, Mouse-Human Sod1 Chimera Length = 153 Back     alignment and structure
>pdb|1XSO|A Chain A, Three-Dimensional Structure Of Xenopus Laevis Cu,Zn Superoxide Dismutase B Determined By X-Ray Crystallography At 1.5 Angstroms Resolution Length = 150 Back     alignment and structure
>pdb|1N19|A Chain A, Structure Of The Hsod A4v Mutant Length = 154 Back     alignment and structure
>pdb|1SOS|A Chain A, Atomic Structures Of Wild-type And Thermostable Mutant Recombinant Human Cu, Zn Superoxide Dismutase Length = 154 Back     alignment and structure
>pdb|1L3N|A Chain A, The Solution Structure Of Reduced Dimeric Copper Zinc Sod: The Structural Effects Of Dimerization Length = 153 Back     alignment and structure
>pdb|1FUN|A Chain A, Superoxide Dismutase Mutant With Lys 136 Replaced By Glu, Cys 6 Replaced By Ala And Cys 111 Replaced By Ser (K136e, C6a, C111s) Length = 153 Back     alignment and structure
>pdb|2GBT|A Chain A, C6aC111A CUZN SUPEROXIDE DISMUTASE Length = 153 Back     alignment and structure
>pdb|1N18|A Chain A, Thermostable Mutant Of Human Superoxide Dismutase, C6a, C111s Length = 154 Back     alignment and structure
>pdb|3H2P|A Chain A, Human Sod1 D124v Variant Length = 153 Back     alignment and structure
>pdb|1P1V|A Chain A, Crystal Structure Of Fals-Associated Human Copper-Zinc Superoxide Dismutase (Cuznsod) Mutant D125h To 1.4a Length = 153 Back     alignment and structure
>pdb|4B3E|A Chain A, Structure Of Copper-Zinc Superoxide Dismutase Complexed With Bicarbonate. Length = 154 Back     alignment and structure
>pdb|1HL4|A Chain A, The Structure Of Apo Type Human Cu, Zn Superoxide Dismutase Length = 154 Back     alignment and structure
>pdb|1UXL|A Chain A, I113t Mutant Of Human Sod1 Length = 153 Back     alignment and structure
>pdb|1HL5|A Chain A, The Structure Of Holo Type Human Cu, Zn Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|2C9S|A Chain A, 1.24 Angstroms Resolution Structure Of Zn-Zn Human Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|1OZU|A Chain A, Crystal Structure Of Familial Als Mutant S134n Of Human Cu, Zn Superoxide Dismutase (Cuznsod) To 1.3a Resolution Length = 153 Back     alignment and structure
>pdb|1UXM|A Chain A, A4v Mutant Of Human Sod1 Length = 153 Back     alignment and structure
>pdb|3GZQ|A Chain A, Human Sod1 A4v Metal-Free Variant Length = 154 Back     alignment and structure
>pdb|2WYT|A Chain A, 1.0 A Resolution Structure Of L38v Sod1 Mutant Length = 153 Back     alignment and structure
>pdb|3MND|A Chain A, Crystallographic Analysis Of The Cystosolic CuZN SUPEROXIDE DISMUTASE From Taenia Solium Length = 152 Back     alignment and structure
>pdb|2WYZ|A Chain A, L38v Sod1 Mutant Complexed With Ump Length = 153 Back     alignment and structure
>pdb|1E9P|B Chain B, Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angstrom (3 Of 3) Length = 151 Back     alignment and structure
>pdb|3F7K|A Chain A, X-Ray Crystal Structure Of An Alvinella Pompejana Cu,Zn Superoxide Dismutase- Hydrogen Peroxide Complex Length = 152 Back     alignment and structure
>pdb|3GZP|A Chain A, Human Sod1 G93a Metal-Free Variant Length = 153 Back     alignment and structure
>pdb|3GZO|A Chain A, Human Sod1 G93a Variant Length = 154 Back     alignment and structure
>pdb|2WKO|F Chain F, Structure Of Metal Loaded Pathogenic Sod1 Mutant G93a Length = 154 Back     alignment and structure
>pdb|4A7G|A Chain A, Structure Of Human I113t Sod1 Mutant Complexed With 4- Methylpiperazin-1-Yl)quinazoline In The P21 Space Group Length = 153 Back     alignment and structure
>pdb|3ECW|A Chain A, Crystal Structure Of The Als-Related Pathological Mutant T54r Of Human Apo Cu,Zn Superoxide Dismutase (Sod1) Length = 153 Back     alignment and structure
>pdb|2ZKY|A Chain A, Crystal Structure Of Human Cu-Zn Superoxide Dismutase Mutant G93a Length = 159 Back     alignment and structure
>pdb|1PTZ|A Chain A, Crystal Structure Of The Human Cu, Zn Superoxide Dismutase, Familial Amyotrophic Lateral Sclerosis (Fals) Mutant H43r Length = 153 Back     alignment and structure
>pdb|3QQD|A Chain A, Human Sod1 H80r Variant, P212121 Crystal Form Length = 154 Back     alignment and structure
>pdb|1OEZ|W Chain W, Zn His46arg Mutant Of Human Cu, Zn Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|3H2Q|A Chain A, Human Sod1 H80r Variant, P21 Crystal Form Length = 153 Back     alignment and structure
>pdb|1E9P|A Chain A, Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angstrom (3 Of 3) Length = 151 Back     alignment and structure
>pdb|2VR8|A Chain A, Crystal Structure Of G85r Als Mutant Of Human Cu,Zn Superoxide Dismutase (Cuznsod) At 1.36 A Resolution Length = 154 Back     alignment and structure
>pdb|3CQQ|A Chain A, Human Sod1 G85r Variant, Structure Ii Length = 153 Back     alignment and structure
>pdb|2VR7|A Chain A, Crystal Structure Of G85r Als Mutant Of Human Cu,Zn Superoxide Dismutase (Cuznsod) At 1.58 A Resolution Length = 154 Back     alignment and structure
>pdb|2VR6|A Chain A, Crystal Structure Of G85r Als Mutant Of Human Cu,Zn Superoxide Dismutase (Cuznsod) At 1.3 A Resolution Length = 153 Back     alignment and structure
>pdb|1AZV|A Chain A, Familial Als Mutant G37r Cuznsod (Human) Length = 153 Back     alignment and structure
>pdb|2ZKW|A Chain A, Crystal Structure Of Human Cu-Zn Superoxide Dismutase Mutant G85r In Space Group P21 Length = 159 Back     alignment and structure
>pdb|2GBU|A Chain A, C6a/c111a/c57a/c146a Apo Cuzn Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|1BA9|A Chain A, The Solution Structure Of Reduced Monomeric Superoxide Dismutase, Nmr, 36 Structures Length = 153 Back     alignment and structure
>pdb|1MFM|A Chain A, Monomeric Human Sod Mutant F50eG51EE133Q AT ATOMIC Resolution Length = 153 Back     alignment and structure
>pdb|1DSW|A Chain A, The Solution Structure Of A Monomeric, Reduced Form Of Human Copper, Zinc Superoxide Dismutase Bearing The Same Charge As The Native Protein Length = 153 Back     alignment and structure
>pdb|2XJK|A Chain A, Monomeric Human Cu,Zn Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|1E9O|A Chain A, Crystal Structure Of Bovine Sod - 1 Of 3 Length = 152 Back     alignment and structure
>pdb|1E9Q|A Chain A, Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Length = 151 Back     alignment and structure
>pdb|3GQF|A Chain A, Structural And Biophysical Properties Of The Pathogenic Sod1 Variant H46rH48Q Length = 153 Back     alignment and structure
>pdb|2NNX|A Chain A, Crystal Structure Of The H46r, H48q Double Mutant Of Human [cu-Zn] Superoxide Dismutase Length = 154 Back     alignment and structure
>pdb|2R27|A Chain A, Constitutively Zinc-Deficient Mutant Of Human Superoxide Dismutase (Sod), C6a, H80s, H83s, C111s Length = 154 Back     alignment and structure
>pdb|1E9Q|B Chain B, Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Length = 151 Back     alignment and structure
>pdb|1E9O|B Chain B, Crystal Structure Of Bovine Sod - 1 Of 3 Length = 152 Back     alignment and structure
>pdb|1CB4|A Chain A, Crystal Structure Of Copper, Zinc Superoxide Dismutase Length = 151 Back     alignment and structure
>pdb|3SOD|O Chain O, Changes In Crystallographic Structure And Thermostability Of A Cu,Zn Superoxide Dismutase Mutant Resulting From The Removal Of Buried Cysteine Length = 152 Back     alignment and structure
>pdb|1Q0E|A Chain A, Atomic Resolution (1.15 ) Crystal Structure Of Bovine Copper, Zinc Superoxide Dismutase Length = 152 Back     alignment and structure
>pdb|1COB|A Chain A, Crystal Structure Solution And Refinement Of The Semisynthetic Cobalt Substituted Bovine Erythrocyte Enzyme Superoxide Dismutase At 2.0 Angstroms Resolution Length = 151 Back     alignment and structure
>pdb|1SDA|O Chain O, Crystal Structure Of Peroxynitrite-Modified Bovine Cu,Zn Superoxide Dismutase Length = 152 Back     alignment and structure
>pdb|4BCY|A Chain A, Monomeric Human Cu,zn Superoxide Dismutase, Mutation H43f Length = 153 Back     alignment and structure
>pdb|3KBE|A Chain A, Metal-Free C. Elegans Cu,Zn Superoxide Dismutase Length = 157 Back     alignment and structure
>pdb|2XJL|A Chain A, Monomeric Human Cu,Zn Superoxide Dismutase Without Cu Ligands Length = 153 Back     alignment and structure
>pdb|3HFF|A Chain A, Monomeric Human Cu,Zn Superoxide Dismutase Without Zn Ligands Length = 153 Back     alignment and structure
>pdb|2E46|A Chain A, Crystal Structure Analysis Of The Clock Protein Ea4 Length = 157 Back     alignment and structure
>pdb|2E47|A Chain A, Crystal Structure Analysis Of The Clock Protein Ea4 (Glycosylation Form) Length = 156 Back     alignment and structure
>pdb|1DO5|A Chain A, Human Copper Chaperone For Superoxide Dismutase Domain Ii Length = 154 Back     alignment and structure
>pdb|3L9Y|A Chain A, Crystal Structures Of Holo And Cu-Deficient CuZNSOD FROM The Silkworm Bombyx Mori And The Implications In Amyotrophic Lateral Sclerosis Length = 154 Back     alignment and structure
>pdb|3L9E|A Chain A, Crystal Structures Of Holo And Cu-Deficient CuZNSOD FROM THE SILKWORM Bombyx Mori And The Implications In Amyotrophic Lateral Sclerosis Length = 154 Back     alignment and structure
>pdb|1SDY|A Chain A, Structure Solution And Molecular Dynamics Refinement Of The Yeast Cu,Zn Enzyme Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|1F1G|A Chain A, Crystal Structure Of Yeast Cuznsod Exposed To Nitric Oxide Length = 154 Back     alignment and structure
>pdb|1F1A|A Chain A, Crystal Structure Of Yeast H48q Cuznsod Fals Mutant Analog Length = 154 Back     alignment and structure
>pdb|1F18|A Chain A, Crystal Structure Of Yeast Copper-Zinc Superoxide Dismutase Mutant Gly85arg Length = 154 Back     alignment and structure
>pdb|1JK9|A Chain A, Heterodimer Between H48f-Ysod1 And Yccs Length = 153 Back     alignment and structure
>pdb|1F1D|A Chain A, Crystal Structure Of Yeast H46c Cuznsod Mutant Length = 154 Back     alignment and structure
>pdb|1B4T|A Chain A, H48c Yeast Cu(Ii)ZN SUPEROXIDE DISMUTASE ROOM TEMPERATURE (298k) Structure Length = 153 Back     alignment and structure
>pdb|3CE1|A Chain A, Crystal Structure Of The CuZN SUPEROXIDE DISMUTASE FROM Cryptococcus Liquefaciens Strain N6 Length = 168 Back     alignment and structure
>pdb|4BCZ|A Chain A, Monomeric Human Cu,zn Superoxide Dismutase, Loops Iv And Vii Deleted, Apo Form. Length = 110 Back     alignment and structure
>pdb|2JLP|A Chain A, Crystal Structure Of Human Extracellular Copper-Zinc Superoxide Dismutase. Length = 222 Back     alignment and structure
>pdb|4BD4|A Chain A, Monomeric Human Cu,zn Superoxide Dismutase, Loops Iv And Vii Deleted, Apo Form, Mutant H43f Length = 110 Back     alignment and structure
>pdb|1XTM|B Chain B, Crystal Structure Of The Double Mutant Y88h-p104h Of A Sod-like Protein From Bacillus Subtilis. Length = 175 Back     alignment and structure
>pdb|1XTL|B Chain B, Crystal Structure Of P104h Mutant Of Sod-Like Protein From Bacillus Subtilis. Length = 175 Back     alignment and structure
>pdb|1U3N|A Chain A, A Sod-Like Protein From B. Subtilis, Unstructured In Solution, Becomes Ordered In The Crystal: Implications For Function And For Fibrillogenesis Length = 162 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query139
2q2l_A152 Superoxide dismutase; SOD, SAD, antioxidant, oxido 3e-45
3pu7_A154 Superoxide dismutase [CU-ZN], chloroplastic; oxido 4e-45
1do5_A154 Human copper chaperone for superoxide dismutase do 2e-44
1to4_A156 Superoxide dismutase; beta-barrel, oxidoreductase; 8e-44
3f7l_A152 Copper,zinc superoxide dismutase; oxidoreductase ( 6e-43
1xso_A150 Copper,zinc superoxide dismutase; oxidoreductase ( 8e-43
2e47_A156 EA4, TIME interVal measuring enzyme TIME; motallop 2e-42
2wyt_A153 Superoxide dismutase [CU-ZN]; oxidoreductase, dise 2e-42
3kbe_A157 Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dis 3e-41
3ce1_A168 Superoxide dismutase [CU-ZN]; greek-KEY beta barre 7e-41
1xtm_B175 Hypothetical superoxide dismutase-like protein YO; 1e-40
1f1g_A154 Cuznsod, copper-zinc superoxide dismutase; nitric 4e-40
3l9y_A154 Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY 2e-39
1eso_A154 SOD, Cu, Zn superoxide dismutase; oxidoreductase, 8e-38
2aqm_A154 Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10 2e-37
1eqw_A156 Cu,Zn superoxide dismutase; greek KEY B-barrel, ox 9e-36
1oal_A151 Superoxide dismutase; oxidoreductase, prokaryotic 4e-35
1z9n_A177 Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxid 8e-35
2aqp_A164 Superoxide dismutase [CU-ZN]; electrostatic guidan 5e-34
1pzs_A208 Superoxide dismutase [CU-ZN]; Cu-protein, beta cor 2e-33
1ej8_A140 Lys7; beta barrel, copper chaperone for SOD, domai 3e-26
2jlp_A222 Extracellular superoxide dismutase (Cu-Zn); glycol 7e-24
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 4e-22
1jk9_B249 CCS, copper chaperone for superoxide dismutase; pr 9e-20
>2q2l_A Superoxide dismutase; SOD, SAD, antioxidant, oxidoreductase, metal-binding; 2.37A {Potentilla atrosanguinea} Length = 152 Back     alignment and structure
 Score =  143 bits (363), Expect = 3e-45
 Identities = 60/103 (58%), Positives = 73/103 (70%)

Query: 10  VKAVALISGATSVKGSLHFVQGPNGVTHVKGKITGLKPGLHGFHIHALGDTTNGCNSTGP 69
            K VA++S +  V G++ F Q  +G T V G I+GLKPGLHGFH+HALGDTTNGC STGP
Sbjct: 2   AKGVAVLSSSEGVAGTILFTQEGDGPTTVTGNISGLKPGLHGFHVHALGDTTNGCMSTGP 61

Query: 70  HFNPLKKDHGAPSDNERHTGDLGNIVAGPDGVAEVSIADRMVN 112
           HFNP  K+HG+P D  RH GDLGNI  G DG A  +I D+ + 
Sbjct: 62  HFNPAGKEHGSPEDETRHAGDLGNITVGDDGTACFTIVDKQIP 104
>3pu7_A Superoxide dismutase [CU-ZN], chloroplastic; oxidoreductase, antioxidant, metal-binding, DIS bond, transit peptide; 1.80A {Solanum lycopersicum} PDB: 3km1_A 3km2_A 3mkg_A 3hog_A 1srd_A Length = 154 Back     alignment and structure
>1do5_A Human copper chaperone for superoxide dismutase domain II; beta-barrel; 2.75A {Homo sapiens} SCOP: b.1.8.1 Length = 154 Back     alignment and structure
>1to4_A Superoxide dismutase; beta-barrel, oxidoreductase; 1.55A {Schistosoma mansoni} SCOP: b.1.8.1 PDB: 1to5_A 3mnd_A Length = 156 Back     alignment and structure
>3f7l_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor), greek KEY beta-barrel, amyloid filaments, ALS, FALS; 0.99A {Alvinella pompejana} PDB: 3f7k_A Length = 152 Back     alignment and structure
>1xso_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor); 1.49A {Xenopus laevis} SCOP: b.1.8.1 Length = 150 Back     alignment and structure
>2e47_A EA4, TIME interVal measuring enzyme TIME; motalloprotein, glycoprotein, metal binding protein; HET: NAG MAN; 2.11A {Bombyx mori} PDB: 2e46_A Length = 156 Back     alignment and structure
>2wyt_A Superoxide dismutase [CU-ZN]; oxidoreductase, disease mutation, amyotrophic lateral sclero antioxidant; HET: SO4; 1.00A {Homo sapiens} PDB: 2wyz_A* 2wz0_A* 2wz5_A* 1hl4_A 1spd_A 2c9v_A* 1hl5_A 1pu0_A 2c9u_A 2c9s_A* 2v0a_A* 3ecu_A 3kh3_A 3kh4_A 3re0_A 2wko_A 3gzo_A 2wz6_A* 3gzp_A 1uxl_A ... Length = 153 Back     alignment and structure
>3kbe_A Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dismutase, antioxidant, oxidoreductase, NEM disulfide bond, metal-binding; 1.10A {Caenorhabditis elegans} PDB: 3kbf_A Length = 157 Back     alignment and structure
>3ce1_A Superoxide dismutase [CU-ZN]; greek-KEY beta barrel, antioxidant, copper, metal-binding, oxidoreductase, zinc; 1.20A {Cryptococcus liquefaciens} Length = 168 Back     alignment and structure
>1xtm_B Hypothetical superoxide dismutase-like protein YO; SOD, Cu-Zn SOD, SOD-like, superoxide dismutase mutants, STRU genomics, unknown function; 1.60A {Bacillus subtilis} PDB: 1xtl_B 1s4i_B 1u3n_A Length = 175 Back     alignment and structure
>1f1g_A Cuznsod, copper-zinc superoxide dismutase; nitric oxide, oxidoreductase; 1.35A {Saccharomyces cerevisiae} SCOP: b.1.8.1 PDB: 1f1a_A 1f18_A 1jcv_A 1b4l_A 1sdy_A 1yaz_A 1yso_A 2jcw_A 1f1d_A 1jk9_A 1b4t_A Length = 154 Back     alignment and structure
>3l9y_A Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY-barrel, antioxidant, copper, cytoplasm, metal- binding, oxidoreductase; 1.80A {Bombyx mori} PDB: 3l9e_A Length = 154 Back     alignment and structure
>1eso_A SOD, Cu, Zn superoxide dismutase; oxidoreductase, monomeric superoxide dismutase, copper enzymes, enzyme evolution, X- RAY; 2.00A {Escherichia coli} SCOP: b.1.8.1 PDB: 2k4w_A Length = 154 Back     alignment and structure
>2aqm_A Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10A {Brucella abortus} Length = 154 Back     alignment and structure
>1eqw_A Cu,Zn superoxide dismutase; greek KEY B-barrel, oxidoreductase; 2.30A {Salmonella typhimurium} SCOP: b.1.8.1 PDB: 2wn0_A* 2wn1_A* 2wwn_A* 2wwo_A* Length = 156 Back     alignment and structure
>1oal_A Superoxide dismutase; oxidoreductase, prokaryotic Cu, protein-subunit interaction recognition, protein electrostatic; 1.5A {Photobacterium leiognathi} SCOP: b.1.8.1 PDB: 1bzo_A 1ibh_A 1ibd_A 1yai_A 1ib5_A 1oaj_A 1ibb_A 1ibf_A Length = 151 Back     alignment and structure
>1z9n_A Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxidoreductase; HET: HEM; 1.50A {Haemophilus ducreyi} Length = 177 Back     alignment and structure
>2aqp_A Superoxide dismutase [CU-ZN]; electrostatic guidance, neisseria MENI oxidoreductase; 1.30A {Neisseria meningitidis} PDB: 2aqn_A 2aqr_A 2aqq_A 2aqt_C 2aqs_A 2aps_A 1z9p_A Length = 164 Back     alignment and structure
>1pzs_A Superoxide dismutase [CU-ZN]; Cu-protein, beta core, antioxidant, metal binding, greek KEY barrel, oxidoreductase; 1.63A {Mycobacterium tuberculosis} SCOP: b.1.8.1 Length = 208 Back     alignment and structure
>1ej8_A Lys7; beta barrel, copper chaperone for SOD, domain 2; 1.55A {Saccharomyces cerevisiae} SCOP: b.1.8.1 Length = 140 Back     alignment and structure
>2jlp_A Extracellular superoxide dismutase (Cu-Zn); glycolisation, oxidoreductase, heparin binding, heparin-BIND oxidative stress, antioxidant; 1.70A {Homo sapiens} Length = 222 Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 222 Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 249 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query139
3pu7_A154 Superoxide dismutase [CU-ZN], chloroplastic; oxido 100.0
4a7u_A153 Superoxide dismutase [CU-ZN]; oxidoreductase, amyo 100.0
3f7l_A152 Copper,zinc superoxide dismutase; oxidoreductase ( 100.0
2q2l_A152 Superoxide dismutase; SOD, SAD, antioxidant, oxido 100.0
3l9y_A154 Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY 100.0
1to4_A156 Superoxide dismutase; beta-barrel, oxidoreductase; 100.0
2wyt_A153 Superoxide dismutase [CU-ZN]; oxidoreductase, dise 100.0
1xso_A150 Copper,zinc superoxide dismutase; oxidoreductase ( 100.0
1f1g_A154 Cuznsod, copper-zinc superoxide dismutase; nitric 100.0
3kbe_A157 Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dis 100.0
3ce1_A168 Superoxide dismutase [CU-ZN]; greek-KEY beta barre 100.0
2e47_A156 EA4, TIME interVal measuring enzyme TIME; motallop 100.0
1do5_A154 Human copper chaperone for superoxide dismutase do 100.0
1xtm_B175 Hypothetical superoxide dismutase-like protein YO; 100.0
2aqp_A164 Superoxide dismutase [CU-ZN]; electrostatic guidan 100.0
2aqm_A154 Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10 100.0
1oal_A151 Superoxide dismutase; oxidoreductase, prokaryotic 100.0
1z9n_A177 Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxid 100.0
1eqw_A156 Cu,Zn superoxide dismutase; greek KEY B-barrel, ox 100.0
1ej8_A140 Lys7; beta barrel, copper chaperone for SOD, domai 100.0
1eso_A154 SOD, Cu, Zn superoxide dismutase; oxidoreductase, 100.0
2jlp_A222 Extracellular superoxide dismutase (Cu-Zn); glycol 100.0
1pzs_A208 Superoxide dismutase [CU-ZN]; Cu-protein, beta cor 100.0
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 100.0
1jk9_B249 CCS, copper chaperone for superoxide dismutase; pr 100.0
>3pu7_A Superoxide dismutase [CU-ZN], chloroplastic; oxidoreductase, antioxidant, metal-binding, DIS bond, transit peptide; 1.80A {Solanum lycopersicum} PDB: 3km1_A 3km2_A 3mkg_A 3hog_A 3s0p_A 1srd_A Back     alignment and structure
Probab=100.00  E-value=4.4e-44  Score=266.69  Aligned_cols=120  Identities=53%  Similarity=0.822  Sum_probs=114.8

Q ss_pred             ceeEEEEEcCCCCeEEEEEEEEcCCCcEEEEEEEecCCCCeeeEEEeCCCCCCCCCCCCCCCccCCCCCCCCCCCCCCCC
Q 032536            9 TVKAVALISGATSVKGSLHFVQGPNGVTHVKGKITGLKPGLHGFHIHALGDTTNGCNSTGPHFNPLKKDHGAPSDNERHT   88 (139)
Q Consensus         9 ~~~Ava~l~~~~~v~G~v~f~q~~~g~~~v~~~l~GL~~G~hg~HIHe~Gd~s~~c~saGgHfnP~~~~hg~p~~~~~h~   88 (139)
                      +.+|+|+|++.++|+|+|+|+|..++.++|+++|+|||||.|+|||||+|||+++|+|||+||||++++|+.|+++.||+
T Consensus         2 ~~~Avavl~g~~~V~G~v~f~q~~~g~v~v~~~i~GL~pG~hgfHIHe~Gd~s~gc~SaGgHfnP~~~~Hg~p~~~~~h~   81 (154)
T 3pu7_A            2 TKKAVAVLKGNSNVEGVVTLSQDDDGPTTVNVRITGLAPGLHGFHLHEYGDTTNGCMSTGAHFNPNKLTHGAPGDEIRHA   81 (154)
T ss_dssp             EEEEEEEEBCSSSCEEEEEEEEETTSCEEEEEEEESCCSEEEEEEEESCCCCTTGGGGGCSBCCTTCCCCCCTTCSSCCT
T ss_pred             CceEEEEECCCCCCEEEEEEEEeCCCcEEEEEEEECCCCCcccEEEeecCCCCCCccccccccCCccCcCCCCCccCCcC
Confidence            57899999998889999999999877799999999999999999999999999999999999999999999999999999


Q ss_pred             CccCceEECCCceEEEEEEeCeEEeeccCCCccccceEEEEEe
Q 032536           89 GDLGNIVAGPDGVAEVSIADRMVNGLINKNFRSVHCRLYEIRL  131 (139)
Q Consensus        89 GDLgni~~~~~G~~~~~~~d~~l~L~~~~~~~sIiGRSiVI~~  131 (139)
                      ||||||+++++|+++++|+|++|+|+   ++++|+|||||||.
T Consensus        82 GDLgni~~~~~G~a~~~~~d~~l~L~---g~~~iiGRslVIH~  121 (154)
T 3pu7_A           82 GDLGNIVANADGVAEVTLVDNQIPLT---GPNSVVGRALVVHE  121 (154)
T ss_dssp             TEEEEEEECTTSCEEEEEEESSCCSS---STTCCTTSEEEEES
T ss_pred             CcccCEEeCCCCcEEEEEEeCCeeeC---CCCccCCeEEEEEC
Confidence            99999999999999999999999997   46899999999996
>4a7u_A Superoxide dismutase [CU-ZN]; oxidoreductase, amyotrophic lateral sclerosis, antioxidant, mutation, metal-binding, Zn superoxide dismutase; HET: ALE; 0.98A {Homo sapiens} PDB: 3ecv_A 1uxl_A* 4a7g_F* 4a7q_A* 4a7t_A* 4a7s_A* 4a7v_A* 4b3e_A 4a7g_A* 1hl4_A 1spd_A 2c9v_A* 1hl5_A 1pu0_A 2c9u_A 2c9s_A* 2v0a_A* 3ecu_A 3kh3_A 3kh4_A ... Back     alignment and structure
>3f7l_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor), greek KEY beta-barrel, amyloid filaments, ALS, FALS; 0.99A {Alvinella pompejana} SCOP: b.1.8.1 PDB: 3f7k_A Back     alignment and structure
>2q2l_A Superoxide dismutase; SOD, SAD, antioxidant, oxidoreductase, metal-binding; 2.37A {Potentilla atrosanguinea} Back     alignment and structure
>3l9y_A Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY-barrel, antioxidant, copper, cytoplasm, metal- binding, oxidoreductase; 1.80A {Bombyx mori} SCOP: b.1.8.1 PDB: 3l9e_A Back     alignment and structure
>1to4_A Superoxide dismutase; beta-barrel, oxidoreductase; 1.55A {Schistosoma mansoni} SCOP: b.1.8.1 PDB: 1to5_A 3mnd_A Back     alignment and structure
>2wyt_A Superoxide dismutase [CU-ZN]; oxidoreductase, disease mutation, amyotrophic lateral sclero antioxidant; HET: SO4; 1.00A {Homo sapiens} PDB: 2wyz_A* 2wz0_A* 2wz5_A* 1hl4_A 1spd_A 2c9v_A* 1hl5_A 1pu0_A 2c9u_A 2c9s_A* 2v0a_A* 3ecu_A 3kh3_A 3kh4_A 3re0_A 2wko_A 3gzo_A 2wz6_A* 3gzp_A 1uxl_A ... Back     alignment and structure
>1xso_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor); 1.49A {Xenopus laevis} SCOP: b.1.8.1 Back     alignment and structure
>1f1g_A Cuznsod, copper-zinc superoxide dismutase; nitric oxide, oxidoreductase; 1.35A {Saccharomyces cerevisiae} SCOP: b.1.8.1 PDB: 1f1a_A 1f18_A 1jcv_A 1b4l_A 1sdy_A 1yaz_A 1yso_A 2jcw_A 1f1d_A 1jk9_A 1b4t_A Back     alignment and structure
>3kbe_A Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dismutase, antioxidant, oxidoreductase, NEM disulfide bond, metal-binding; 1.10A {Caenorhabditis elegans} SCOP: b.1.8.1 PDB: 3kbf_A Back     alignment and structure
>3ce1_A Superoxide dismutase [CU-ZN]; greek-KEY beta barrel, antioxidant, copper, metal-binding, oxidoreductase, zinc; 1.20A {Cryptococcus liquefaciens} Back     alignment and structure
>2e47_A EA4, TIME interVal measuring enzyme TIME; motalloprotein, glycoprotein, metal binding protein; HET: NAG MAN; 2.11A {Bombyx mori} PDB: 2e46_A Back     alignment and structure
>1do5_A Human copper chaperone for superoxide dismutase domain II; beta-barrel; 2.75A {Homo sapiens} SCOP: b.1.8.1 Back     alignment and structure
>1xtm_B Hypothetical superoxide dismutase-like protein YO; SOD, Cu-Zn SOD, SOD-like, superoxide dismutase mutants, STRU genomics, unknown function; 1.60A {Bacillus subtilis} PDB: 1xtl_B 1s4i_B 1u3n_A Back     alignment and structure
>2aqp_A Superoxide dismutase [CU-ZN]; electrostatic guidance, neisseria MENI oxidoreductase; 1.30A {Neisseria meningitidis} PDB: 2aqn_A 2aqr_A 2aqq_A 2aqt_C 2aqs_A 2aps_A 1z9p_A Back     alignment and structure
>2aqm_A Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10A {Brucella abortus} Back     alignment and structure
>1oal_A Superoxide dismutase; oxidoreductase, prokaryotic Cu, protein-subunit interaction recognition, protein electrostatic; 1.5A {Photobacterium leiognathi} SCOP: b.1.8.1 PDB: 1bzo_A 1ibh_A 1ibd_A 1yai_A 1ib5_A 1oaj_A 1ibb_A 1ibf_A Back     alignment and structure
>1z9n_A Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxidoreductase; HET: HEM; 1.50A {Haemophilus ducreyi} Back     alignment and structure
>1eqw_A Cu,Zn superoxide dismutase; greek KEY B-barrel, oxidoreductase; 2.30A {Salmonella typhimurium} SCOP: b.1.8.1 PDB: 2wn0_A* 2wn1_A* 2wwn_A* 2wwo_A* Back     alignment and structure
>1ej8_A Lys7; beta barrel, copper chaperone for SOD, domain 2; 1.55A {Saccharomyces cerevisiae} SCOP: b.1.8.1 Back     alignment and structure
>1eso_A SOD, Cu, Zn superoxide dismutase; oxidoreductase, monomeric superoxide dismutase, copper enzymes, enzyme evolution, X- RAY; 2.00A {Escherichia coli} SCOP: b.1.8.1 PDB: 2k4w_A Back     alignment and structure
>2jlp_A Extracellular superoxide dismutase (Cu-Zn); glycolisation, oxidoreductase, heparin binding, heparin-BIND oxidative stress, antioxidant; 1.70A {Homo sapiens} Back     alignment and structure
>1pzs_A Superoxide dismutase [CU-ZN]; Cu-protein, beta core, antioxidant, metal binding, greek KEY barrel, oxidoreductase; 1.63A {Mycobacterium tuberculosis} SCOP: b.1.8.1 Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 139
d1to4a_156 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Bloo 9e-27
d1xsoa_150 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Afri 2e-26
d1do5a_154 b.1.8.1 (A:) Copper chaperone for superoxide dismu 2e-25
d1srda_154 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Spin 3e-25
d2c9va1153 b.1.8.1 (A:1-153) Cu,Zn superoxide dismutase, SOD 4e-25
d1eqwa_155 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Salm 3e-24
d1f1ga_153 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Bake 1e-22
d2apsa_155 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Acti 1e-21
d1esoa_154 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Esch 4e-21
d1ej8a_140 b.1.8.1 (A:) Copper chaperone for superoxide dismu 4e-21
d1oala_151 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Phot 1e-20
d1pzsa_171 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Myco 7e-19
>d1to4a_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} Length = 156 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cu,Zn superoxide dismutase-like
family: Cu,Zn superoxide dismutase-like
domain: Cu,Zn superoxide dismutase, SOD
species: Blood fluke (Schistosoma mansoni) [TaxId: 6183]

 Score = 95.9 bits (238), Expect = 9e-27
 Identities = 55/105 (52%), Positives = 72/105 (68%), Gaps = 1/105 (0%)

Query: 8   ATVKAVALISGATSVKGSLHFVQ-GPNGVTHVKGKITGLKPGLHGFHIHALGDTTNGCNS 66
           + +KAV +++G   VKG + F Q   NG  HV  + +GLK G HGFH+H  GDTTNGC S
Sbjct: 2   SNMKAVCVMTGTAGVKGVVKFTQETDNGPVHVHAEFSGLKAGKHGFHVHEFGDTTNGCTS 61

Query: 67  TGPHFNPLKKDHGAPSDNERHTGDLGNIVAGPDGVAEVSIADRMV 111
            G HFNP K++HGAP D+ RH GDLGN+VAG DG A  +  D+++
Sbjct: 62  AGAHFNPTKQEHGAPEDSIRHVGDLGNVVAGADGNAVYNATDKLI 106
>d1xsoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 150 Back     information, alignment and structure
>d1do5a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d1srda_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 154 Back     information, alignment and structure
>d2c9va1 b.1.8.1 (A:1-153) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]} Length = 153 Back     information, alignment and structure
>d1eqwa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Salmonella typhimurium [TaxId: 90371]} Length = 155 Back     information, alignment and structure
>d1f1ga_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 153 Back     information, alignment and structure
>d2apsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Actinobacillus pleuropneumoniae [TaxId: 715]} Length = 155 Back     information, alignment and structure
>d1esoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Escherichia coli [TaxId: 562]} Length = 154 Back     information, alignment and structure
>d1ej8a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 Back     information, alignment and structure
>d1oala_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Photobacterium leiognathi [TaxId: 553611]} Length = 151 Back     information, alignment and structure
>d1pzsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 171 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query139
d1srda_154 Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia 100.0
d1to4a_156 Cu,Zn superoxide dismutase, SOD {Blood fluke (Schi 100.0
d2c9va1153 Cu,Zn superoxide dismutase, SOD {Human (Homo sapie 100.0
d1f1ga_153 Cu,Zn superoxide dismutase, SOD {Baker's yeast (Sa 100.0
d1xsoa_150 Cu,Zn superoxide dismutase, SOD {African clawed fr 100.0
d1do5a_154 Copper chaperone for superoxide dismutase, C-termi 100.0
d2apsa_155 Cu,Zn superoxide dismutase, SOD {Actinobacillus pl 100.0
d1oala_151 Cu,Zn superoxide dismutase, SOD {Photobacterium le 100.0
d1esoa_154 Cu,Zn superoxide dismutase, SOD {Escherichia coli 100.0
d1eqwa_155 Cu,Zn superoxide dismutase, SOD {Salmonella typhim 100.0
d1ej8a_140 Copper chaperone for superoxide dismutase, C-termi 100.0
d1pzsa_171 Cu,Zn superoxide dismutase, SOD {Mycobacterium tub 99.97
>d1srda_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cu,Zn superoxide dismutase-like
family: Cu,Zn superoxide dismutase-like
domain: Cu,Zn superoxide dismutase, SOD
species: Spinach (Spinacia oleracea) [TaxId: 3562]

Probab=100.00  E-value=1.3e-42  Score=256.79  Aligned_cols=121  Identities=54%  Similarity=0.838  Sum_probs=115.4

Q ss_pred             cceeEEEEEcCCCCeEEEEEEEEcCCCcEEEEEEEecCCCCeeeEEEeCCCCCCCCCCCCCCCccCCCCCCCCCCCCCCC
Q 032536            8 ATVKAVALISGATSVKGSLHFVQGPNGVTHVKGKITGLKPGLHGFHIHALGDTTNGCNSTGPHFNPLKKDHGAPSDNERH   87 (139)
Q Consensus         8 ~~~~Ava~l~~~~~v~G~v~f~q~~~g~~~v~~~l~GL~~G~hg~HIHe~Gd~s~~c~saGgHfnP~~~~hg~p~~~~~h   87 (139)
                      ++++|+|+|+++++++|+|+|+|.+++.++|+++|+||+||+|+|||||+|||+++|.++|+||||.+..|+.|+...+|
T Consensus         1 ~~~~Ava~~~g~~~v~G~v~f~q~~~g~v~v~v~l~GL~pG~hg~HIHe~Gd~~~~~~saGgh~np~~~~hg~~~~~~~h   80 (154)
T d1srda_           1 ATKKAVAVLKGTSNVEGVVTLTQEDDGPTTVNVRISGLAPGKHGFHLHEFGDTTNGCMSTGPHFNPDKKTHGAPEDEVRH   80 (154)
T ss_dssp             CEEEEEEECBCSSSCCCEEEEEEETTSCEEEEEEEESCCSEECCEEEESCCCCTTGGGGGCSBCCTTCCCCCCSSCSSCC
T ss_pred             CCcEEEEEEcCCCCcEEEEEEEECCCCcEEEEEEEecCCCCceeEEEecCCccCCCccccccccccccccccCCCccccc
Confidence            46899999999889999999999887789999999999999999999999999999999999999999999999999999


Q ss_pred             CCccCceEECCCceEEEEEEeCeEEeeccCCCccccceEEEEEe
Q 032536           88 TGDLGNIVAGPDGVAEVSIADRMVNGLINKNFRSVHCRLYEIRL  131 (139)
Q Consensus        88 ~GDLgni~~~~~G~~~~~~~d~~l~L~~~~~~~sIiGRSiVI~~  131 (139)
                      +||||||+++++|.+++++++++|+|+   +.++|+|||||||.
T Consensus        81 ~GDLgni~~~~~G~~~~~~~~~~l~L~---g~~~iiGRSivIH~  121 (154)
T d1srda_          81 AGDLGNIVANTDGVAEATIVDNQIPLT---GPNSVVGRALVVHE  121 (154)
T ss_dssp             SSBCCCCEECTTSEEEEEEEESSCCSS---STTCCTTCEEEEES
T ss_pred             cccccCeEECCCCeEEEEEEeCcEEeC---CCCCCCCcEEEEec
Confidence            999999999999999999999999998   46899999999995
>d1to4a_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} Back     information, alignment and structure
>d2c9va1 b.1.8.1 (A:1-153) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f1ga_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xsoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1do5a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2apsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Actinobacillus pleuropneumoniae [TaxId: 715]} Back     information, alignment and structure
>d1oala_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Photobacterium leiognathi [TaxId: 553611]} Back     information, alignment and structure
>d1esoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eqwa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ej8a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pzsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure