Citrus Sinensis ID: 032671


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130------
MGMGEISESVEITVKTIGPAPPSRLSVSSPIKVRDLRKLIATSSANHLPIENLRLVFRGKVLDDTQDDDDRDDVYLQLSNGDSVIAAVKPKPPPRHLRDDTCIDDDDLDLKFKLPQSTSRWKRKLLLFSPQQVKAS
ccccccccEEEEEEEEEccccccEEEccccHHHHHHHHHHHHHcccccccccEEEEEEcccccccccccccccEEEEEccccEEEEEEccccccccccccccccccccccccccccccHHHHHHHHHHcccccccc
ccccccccEEEEEEEEEccccccEEEcccccEHHHHHHHHHHHccccccHHHEEEEEEcccccccccccccccEEEEEccccEEEEEEcccccccHccccccccccHHHcccccccccHHHHHHHHHHHHHHcccc
mgmgeiseSVEITVktigpappsrlsvsspikvRDLRKLIATssanhlpienlrLVFRgkvlddtqddddrddvylqlsngdsviaavkpkppprhlrddtciddddldlkfklpqstsrWKRKLLLfspqqvkas
MGMGEISESVEItvktigpappsrlsvsspiKVRDLRKLIatssanhlpienlrlvFRGKVLDDTQDDDDRDDVYLqlsngdsviaavkpkppprhlrddtciddddlDLKFklpqstsrwkrklllfspqqvkas
MGMGEISESVEITVKTIGPAPPSRLSVSSPIKVRDLRKLIATSSANHLPIENLRLVFRGKVLddtqddddrddVYLQLSNGDSVIAAVKPKPPPRHlrddtciddddldlKFKLPQSTSRWKRKLLLFSPQQVKAS
********************************VRDLRKLIATSSANHLPIENLRLVFRGKV*****************************************I****LDLKFK*******WKRKLLL*********
***********ITVKTIGPAPPSRLSVSSPIKVRDLRKLIATSSANHLPIENLRLVFRGKVLDDTQDDDDRDDVYLQLSNGDSVIAAVKP*****************LDLKFKLPQSTSRWKRKLLLFSPQQVK**
********SVEITVKTIGPAPPSRLSVSSPIKVRDLRKLIATSSANHLPIENLRLVFRGKVLDDTQDDDDRDDVYLQLSNGDSVIAAVKPKPPPRHLRDDTCIDDDDLDLKFKLPQSTSRWKRKLLLF********
******SESVEITVKTIGPAPPSRLSVSSPIKVRDLRKLIATSSANHLPIENLRLVFRGKVLDDTQDDDDRDDVYLQLSNGDSVIAAVKPKPPPRHLR****IDDDDLDLKFKLPQSTSRWKRKLLLFSPQQV***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGMGEISESVEITVKTIGPAPPSRLSVSSPIKVRDLRKLIATSSANHLPIENLRLVFRGKVLDDTQDDDDRDDVYLQLSNGDSVIAAVKPKPPPRHLRDDTCIDDDDLDLKFKLPQSTSRWKRKLLLFSPQQVKAS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query136
225427236231 PREDICTED: uncharacterized protein LOC10 0.897 0.528 0.629 2e-32
297742113212 unnamed protein product [Vitis vinifera] 0.882 0.566 0.64 2e-32
224126517230 predicted protein [Populus trichocarpa] 0.904 0.534 0.574 1e-31
255557629230 conserved hypothetical protein [Ricinus 0.882 0.521 0.629 2e-30
351726676224 uncharacterized protein LOC100499994 [Gl 0.882 0.535 0.546 9e-27
357476699205 hypothetical protein MTR_4g098640 [Medic 0.897 0.595 0.584 1e-25
357476697221 hypothetical protein MTR_4g098640 [Medic 0.897 0.552 0.584 2e-25
388498058221 unknown [Medicago truncatula] 0.897 0.552 0.584 2e-25
449461997 240 PREDICTED: uncharacterized protein LOC10 0.882 0.5 0.543 1e-24
363807098218 uncharacterized protein LOC100793775 [Gl 0.882 0.550 0.531 3e-24
>gi|225427236|ref|XP_002280752.1| PREDICTED: uncharacterized protein LOC100254109 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 80/127 (62%), Positives = 97/127 (76%), Gaps = 5/127 (3%)

Query: 8   ESVEITVKTIGPAPPSRLSVSSPIKVRDLRKLIATSSANHLPIENLRLVFRGKVLDDTQD 67
           + V+IT+KTIGP+PP RL V SPI V DLRKL+A  S  HLPIENLRL+ RG VL DT+D
Sbjct: 19  KMVDITLKTIGPSPPFRLRVPSPITVHDLRKLVA--SNGHLPIENLRLILRGNVLHDTKD 76

Query: 68  DDDRDDVYLQLSNGDSVIAAVKPKPPPRHLRDDTCIDDDDLDLKFKLPQSTSRWKRKLLL 127
            DD   V LQL++GDS+I AVKPKPPP+ +RD    +DDD +LKF+LPQSTSRWKRKL  
Sbjct: 77  GDD---VSLQLNDGDSLIVAVKPKPPPKQVRDGFEDEDDDDNLKFQLPQSTSRWKRKLFC 133

Query: 128 FSPQQVK 134
           F   ++K
Sbjct: 134 FLHDKLK 140




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297742113|emb|CBI33900.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224126517|ref|XP_002329574.1| predicted protein [Populus trichocarpa] gi|222870283|gb|EEF07414.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255557629|ref|XP_002519844.1| conserved hypothetical protein [Ricinus communis] gi|223540890|gb|EEF42448.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|351726676|ref|NP_001235343.1| uncharacterized protein LOC100499994 [Glycine max] gi|255628389|gb|ACU14539.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|357476699|ref|XP_003608635.1| hypothetical protein MTR_4g098640 [Medicago truncatula] gi|355509690|gb|AES90832.1| hypothetical protein MTR_4g098640 [Medicago truncatula] Back     alignment and taxonomy information
>gi|357476697|ref|XP_003608634.1| hypothetical protein MTR_4g098640 [Medicago truncatula] gi|355509689|gb|AES90831.1| hypothetical protein MTR_4g098640 [Medicago truncatula] Back     alignment and taxonomy information
>gi|388498058|gb|AFK37095.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|449461997|ref|XP_004148728.1| PREDICTED: uncharacterized protein LOC101223066 [Cucumis sativus] gi|449527539|ref|XP_004170768.1| PREDICTED: uncharacterized protein LOC101231425 [Cucumis sativus] Back     alignment and taxonomy information
>gi|363807098|ref|NP_001242590.1| uncharacterized protein LOC100793775 [Glycine max] gi|255647291|gb|ACU24112.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query136
TAIR|locus:2062445225 AT2G35360 "AT2G35360" [Arabido 0.867 0.524 0.428 7.5e-18
TAIR|locus:2062445 AT2G35360 "AT2G35360" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 217 (81.4 bits), Expect = 7.5e-18, P = 7.5e-18
 Identities = 54/126 (42%), Positives = 67/126 (53%)

Query:     9 SVEITVKTIGPAPPSRLSVSSPIKVRDLRKLIATSSANHLPIENLRLVFRGKVLXXXXXX 68
             +VEIT KTIGPA PS++ V+S IK+RDLR  IA       P+  LR++ RGK L      
Sbjct:    17 TVEITYKTIGPARPSQIRVASHIKIRDLRNAIAEKGK--FPVSTLRMILRGKALQDEEDG 74

Query:    69 XXXXXVYLQLSNGDSVIAAVKPKPPPRHXXXXXXXXXXXXXXKFKLPQSTSRWKRKLLLF 128
                  +Y+ L + DS I AV P PP                 KFKLP S SRWKRKL  F
Sbjct:    75 DD---LYVTLKDQDSFIVAVIPNPP---AGVESFDDDDDDDLKFKLPPSASRWKRKLYYF 128

Query:   129 SPQQVK 134
                ++K
Sbjct:   129 LRNKLK 134


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.316   0.132   0.374    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      136       111   0.00091  102 3  11 22  0.47    30
                                                     29  0.42    32


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  493 (52 KB)
  Total size of DFA:  95 KB (2069 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  11.11u 0.10s 11.21t   Elapsed:  00:00:03
  Total cpu time:  11.11u 0.10s 11.21t   Elapsed:  00:00:03
  Start:  Thu May  9 21:01:09 2013   End:  Thu May  9 21:01:12 2013


GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query136
cd0180972 cd01809, Scythe_N, Ubiquitin-like domain of Scythe 9e-06
cd0176969 cd01769, UBL, Ubiquitin-like domain of UBL 0.004
>gnl|CDD|176404 cd01809, Scythe_N, Ubiquitin-like domain of Scythe protein Back     alignment and domain information
 Score = 40.7 bits (96), Expect = 9e-06
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 10 VEITVKTIGPAPPSRLSVSSPIKVRDLRKLIATSSANHLPIENLRLVFRGKVLDDTQ 66
          +EI VKT+  +     +V   I V DL++ IA      +P+E  RL++ G+VL D +
Sbjct: 1  IEIKVKTLD-SQTHTFTVEEEITVLDLKEKIA--EEVGIPVEQQRLIYSGRVLKDDE 54


Scythe protein (also known as Bat3) is an apoptotic regulator that is highly conserved in eukaryotes and contains a ubiquitin-like domain near its N-terminus. Scythe binds reaper, a potent apoptotic inducer, and Scythe/Reaper are thought to signal apoptosis, in part through regulating the folding and activity of apoptotic signaling molecules. Length = 72

>gnl|CDD|176364 cd01769, UBL, Ubiquitin-like domain of UBL Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 136
cd0180774 GDX_N ubiquitin-like domain of GDX. GDX contains a 99.78
cd0179173 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know 99.78
cd0179778 NIRF_N amino-terminal ubiquitin-like domain of Np9 99.76
cd0180577 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo 99.75
cd0180478 midnolin_N Ubiquitin-like domain of midnolin. midn 99.75
cd0179079 Herp_N Homocysteine-responsive endoplasmic reticul 99.73
cd01802103 AN1_N ubiquitin-like domain of AN1. AN1 (also know 99.71
cd0179374 Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui 99.71
PTZ0004476 ubiquitin; Provisional 99.7
cd0179280 ISG15_repeat1 ISG15 ubiquitin-like protein, first 99.7
cd0179470 DC_UbP_C dendritic cell derived ubiquitin-like pro 99.7
cd0181374 UBP_N UBP ubiquitin processing protease. The UBP ( 99.69
cd0180676 Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn 99.69
cd0180972 Scythe_N Ubiquitin-like domain of Scythe protein. 99.68
cd0181074 ISG15_repeat2 ISG15 ubiquitin-like protein, second 99.68
cd0181271 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter 99.68
cd0180871 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC 99.68
cd0179870 parkin_N amino-terminal ubiquitin-like of parkin p 99.68
cd0180376 Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 99.67
PF0024069 ubiquitin: Ubiquitin family; InterPro: IPR000626 U 99.67
cd0179671 DDI1_N DNA damage inducible protein 1 ubiquitin-li 99.65
TIGR00601 378 rad23 UV excision repair protein Rad23. All protei 99.6
smart0021364 UBQ Ubiquitin homologues. Ubiquitin-mediated prote 99.56
cd0180076 SF3a120_C Ubiquitin-like domain of Mammalian splic 99.54
KOG0010 493 consensus Ubiquitin-like protein [Posttranslationa 99.54
cd0176387 Sumo Small ubiquitin-related modifier (SUMO). Smal 99.52
cd0181575 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC 99.47
KOG000570 consensus Ubiquitin-like protein [Cell cycle contr 99.44
cd01814113 NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT 99.41
cd0179975 Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO 99.4
KOG0011 340 consensus Nucleotide excision repair factor NEF2, 99.4
cd0176969 UBL Ubiquitin-like domain of UBL. UBLs function by 99.4
KOG0004156 consensus Ubiquitin/40S ribosomal protein S27a fus 99.32
KOG0003128 consensus Ubiquitin/60s ribosomal protein L40 fusi 99.27
cd0178984 Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol 99.22
PF1197672 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter 99.18
cd01795107 USP48_C USP ubiquitin-specific protease. The USP ( 99.13
cd0180177 Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N- 99.13
PLN02560 308 enoyl-CoA reductase 99.1
PF1456087 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K 98.94
KOG4248 1143 consensus Ubiquitin-like protein, regulator of apo 98.94
PF13881111 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB 98.84
KOG1872 473 consensus Ubiquitin-specific protease [Posttransla 98.78
KOG000175 consensus Ubiquitin and ubiquitin-like proteins [P 98.7
PF1154380 UN_NPL4: Nuclear pore localisation protein NPL4; I 98.64
cd01788119 ElonginB Ubiquitin-like domain of Elongin B. Elong 98.51
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 98.51
KOG0006 446 consensus E3 ubiquitin-protein ligase (Parkin prot 98.06
PF1030297 DUF2407: DUF2407 ubiquitin-like domain; InterPro: 97.85
KOG176999 consensus Ubiquitin-like proteins [Posttranslation 97.61
KOG4583 391 consensus Membrane-associated ER protein involved 97.49
cd0181180 OASL_repeat1 2'-5' oligoadenylate synthetase-like 97.47
KOG349373 consensus Ubiquitin-like protein [Posttranslationa 97.36
PF0078982 UBX: UBX domain; InterPro: IPR001012 The UBX domai 97.34
KOG4495110 consensus RNA polymerase II transcription elongati 97.29
PF0881779 YukD: WXG100 protein secretion system (Wss), prote 97.25
KOG3206 234 consensus Alpha-tubulin folding cofactor B [Posttr 96.97
KOG1639 297 consensus Steroid reductase required for elongatio 96.84
smart0016680 UBX Domain present in ubiquitin-regulatory protein 96.81
cd0176777 UBX UBX (ubiquitin regulatory X) domain. The UBX ( 96.68
COG541781 Uncharacterized small protein [Function unknown] 96.63
cd0177485 Faf1_like2_UBX Faf1 ike-2 UBX domain. Faf1_like2 i 96.34
KOG0013231 consensus Uncharacterized conserved protein [Funct 96.03
cd0177279 SAKS1_UBX SAKS1-like UBX domain. SAKS1 (SAPK-subst 96.02
KOG3249181 consensus Uncharacterized conserved protein [Funct 95.98
cd0177079 p47_UBX p47-like ubiquitin domain. p47_UBX p47 is 95.93
cd0177180 Faf1_UBX Faf1 UBX domain. Faf1 (fas-associated fac 95.76
PF1147065 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: 95.73
COG5227103 SMT3 Ubiquitin-like protein (sentrin) [Posttransla 94.89
cd0177382 Faf1_like1_UBX Faf1 ike-1 UBX domain. Faf1_like1 i 94.76
PF13019162 Telomere_Sde2: Telomere stability and silencing 93.89
PRK0643767 hypothetical protein; Provisional 93.3
PLN0279982 Molybdopterin synthase sulfur carrier subunit 92.35
KOG0012 380 consensus DNA damage inducible protein [Replicatio 92.27
KOG2982418 consensus Uncharacterized conserved protein [Funct 91.86
PRK0836470 sulfur carrier protein ThiS; Provisional 91.7
PF1504476 CLU_N: Mitochondrial function, CLU-N-term 91.68
cd0640680 PB1_P67 A PB1 domain is present in p67 proteins wh 91.01
smart0066681 PB1 PB1 domain. Phox and Bem1p domain, present in 90.84
cd0640986 PB1_MUG70 The MUG70 protein is a product of the me 90.56
PF1445357 ThiS-like: ThiS-like ubiquitin 89.66
cd0075480 MoaD Ubiquitin domain of MoaD-like proteins. MoaD 89.4
PF0056484 PB1: PB1 domain; InterPro: IPR000270 The Phox and 89.04
PRK0586365 sulfur carrier protein ThiS; Provisional 89.04
PRK0177795 hypothetical protein; Validated 88.23
PRK0744070 hypothetical protein; Provisional 88.04
cd0640782 PB1_NLP A PB1 domain is present in NIN like protei 87.18
PF1473287 UAE_UbL: Ubiquitin/SUMO-activating enzyme ubiquiti 86.26
PF10209122 DUF2340: Uncharacterized conserved protein (DUF234 86.13
COG210468 ThiS Sulfur transfer protein involved in thiamine 85.6
TIGR0168280 moaD molybdopterin converting factor, subunit 1, n 85.28
PRK0565966 sulfur carrier protein ThiS; Validated 85.05
cd0056565 ThiS ThiaminS ubiquitin-like sulfur carrier protei 83.45
TIGR0168364 thiS thiamine biosynthesis protein ThiS. This mode 82.63
cd0599281 PB1 The PB1 domain is a modular domain mediating s 81.19
>cd01807 GDX_N ubiquitin-like domain of GDX Back     alignment and domain information
Probab=99.78  E-value=7.7e-19  Score=116.87  Aligned_cols=73  Identities=29%  Similarity=0.404  Sum_probs=67.1

Q ss_pred             eEEEEEeCCCCCcEEEEecCCCcHHHHHHHHHhccCCCCCCCceEEEecCeecCCCCCCCCCCccccCCCCCCEEEEEec
Q 032671           10 VEITVKTIGPAPPSRLSVSSPIKVRDLRKLIATSSANHLPIENLRLVFRGKVLDDTQDDDDRDDVYLQLSNGDSVIAAVK   89 (136)
Q Consensus        10 m~I~VKt~~~~~~~~v~v~~~~TV~eLK~~Ia~~~~~gi~~~~QRLI~~GK~L~D~~t~d~~~L~~~~I~dG~tIlv~~~   89 (136)
                      |+|+||+..|+. +.++|+++.||++||++|++  ++|+|+++|||+|+|+.|.|+.+     |++|||++|++|.++..
T Consensus         1 m~i~vk~~~G~~-~~l~v~~~~tV~~lK~~i~~--~~gi~~~~q~L~~~G~~L~d~~~-----L~~~~i~~~~~l~l~~~   72 (74)
T cd01807           1 MFLTVKLLQGRE-CSLQVSEKESVSTLKKLVSE--HLNVPEEQQRLLFKGKALADDKR-----LSDYSIGPNAKLNLVVR   72 (74)
T ss_pred             CEEEEEeCCCCE-EEEEECCCCcHHHHHHHHHH--HHCCCHHHeEEEECCEECCCCCC-----HHHCCCCCCCEEEEEEc
Confidence            789999999975 88999999999999999999  99999999999999999999988     99999999999955544


Q ss_pred             C
Q 032671           90 P   90 (136)
Q Consensus        90 p   90 (136)
                      |
T Consensus        73 ~   73 (74)
T cd01807          73 P   73 (74)
T ss_pred             C
Confidence            3



GDX contains an N-terminal ubiquitin-like domain as well as an uncharacterized c-terminal domain. The function of GDX is unknown.

>cd01791 Ubl5 UBL5 ubiquitin-like modifier Back     alignment and domain information
>cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF Back     alignment and domain information
>cd01805 RAD23_N Ubiquitin-like domain of RAD23 Back     alignment and domain information
>cd01804 midnolin_N Ubiquitin-like domain of midnolin Back     alignment and domain information
>cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein Back     alignment and domain information
>cd01802 AN1_N ubiquitin-like domain of AN1 Back     alignment and domain information
>cd01793 Fubi Fubi ubiquitin-like protein Back     alignment and domain information
>PTZ00044 ubiquitin; Provisional Back     alignment and domain information
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 Back     alignment and domain information
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein Back     alignment and domain information
>cd01813 UBP_N UBP ubiquitin processing protease Back     alignment and domain information
>cd01806 Nedd8 Nebb8-like ubiquitin protein Back     alignment and domain information
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 Back     alignment and domain information
>cd01812 BAG1_N Ubiquitin-like domain of BAG1 Back     alignment and domain information
>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 Back     alignment and domain information
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein Back     alignment and domain information
>cd01803 Ubiquitin Ubiquitin Back     alignment and domain information
>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade Back     alignment and domain information
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>smart00213 UBQ Ubiquitin homologues Back     alignment and domain information
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 Back     alignment and domain information
>KOG0010 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>cd01763 Sumo Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
>cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP Back     alignment and domain information
>KOG0005 consensus Ubiquitin-like protein [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4 Back     alignment and domain information
>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 Back     alignment and domain information
>KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair] Back     alignment and domain information
>cd01769 UBL Ubiquitin-like domain of UBL Back     alignment and domain information
>KOG0004 consensus Ubiquitin/40S ribosomal protein S27a fusion [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0003 consensus Ubiquitin/60s ribosomal protein L40 fusion [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B Back     alignment and domain information
>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins Back     alignment and domain information
>cd01795 USP48_C USP ubiquitin-specific protease Back     alignment and domain information
>cd01801 Tsc13_N Ubiquitin-like domain of Tsc13 Back     alignment and domain information
>PLN02560 enoyl-CoA reductase Back     alignment and domain information
>PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A Back     alignment and domain information
>KOG4248 consensus Ubiquitin-like protein, regulator of apoptosis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A Back     alignment and domain information
>KOG1872 consensus Ubiquitin-specific protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0001 consensus Ubiquitin and ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway Back     alignment and domain information
>cd01788 ElonginB Ubiquitin-like domain of Elongin B Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10302 DUF2407: DUF2407 ubiquitin-like domain; InterPro: IPR019413 This entry represents a family of proteins of unknown function found in fungi Back     alignment and domain information
>KOG1769 consensus Ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4583 consensus Membrane-associated ER protein involved in stress response (contains ubiquitin-like domain) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01811 OASL_repeat1 2'-5' oligoadenylate synthetase-like protein, repeat 1 of 2 Back     alignment and domain information
>KOG3493 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast Back     alignment and domain information
>KOG4495 consensus RNA polymerase II transcription elongation factor Elongin/SIII, subunit elongin B [Transcription] Back     alignment and domain information
>PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold [] Back     alignment and domain information
>KOG3206 consensus Alpha-tubulin folding cofactor B [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1639 consensus Steroid reductase required for elongation of the very long chain fatty acids [Lipid transport and metabolism] Back     alignment and domain information
>smart00166 UBX Domain present in ubiquitin-regulatory proteins Back     alignment and domain information
>cd01767 UBX UBX (ubiquitin regulatory X) domain Back     alignment and domain information
>COG5417 Uncharacterized small protein [Function unknown] Back     alignment and domain information
>cd01774 Faf1_like2_UBX Faf1 ike-2 UBX domain Back     alignment and domain information
>KOG0013 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd01772 SAKS1_UBX SAKS1-like UBX domain Back     alignment and domain information
>KOG3249 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd01770 p47_UBX p47-like ubiquitin domain Back     alignment and domain information
>cd01771 Faf1_UBX Faf1 UBX domain Back     alignment and domain information
>PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly Back     alignment and domain information
>COG5227 SMT3 Ubiquitin-like protein (sentrin) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01773 Faf1_like1_UBX Faf1 ike-1 UBX domain Back     alignment and domain information
>PF13019 Telomere_Sde2: Telomere stability and silencing Back     alignment and domain information
>PRK06437 hypothetical protein; Provisional Back     alignment and domain information
>PLN02799 Molybdopterin synthase sulfur carrier subunit Back     alignment and domain information
>KOG0012 consensus DNA damage inducible protein [Replication, recombination and repair] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK08364 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PF15044 CLU_N: Mitochondrial function, CLU-N-term Back     alignment and domain information
>cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of NADPH oxidase during phagocytosis Back     alignment and domain information
>smart00666 PB1 PB1 domain Back     alignment and domain information
>cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain Back     alignment and domain information
>PF14453 ThiS-like: ThiS-like ubiquitin Back     alignment and domain information
>cd00754 MoaD Ubiquitin domain of MoaD-like proteins Back     alignment and domain information
>PF00564 PB1: PB1 domain; InterPro: IPR000270 The Phox and Bem1p domain, is present in many eukaryotic cytoplasmic signalling proteins Back     alignment and domain information
>PRK05863 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PRK01777 hypothetical protein; Validated Back     alignment and domain information
>PRK07440 hypothetical protein; Provisional Back     alignment and domain information
>cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium) Back     alignment and domain information
>PF14732 UAE_UbL: Ubiquitin/SUMO-activating enzyme ubiquitin-like domain; PDB: 1Y8Q_B 1Y8R_E 3KYD_B 3KYC_B Back     alignment and domain information
>PF10209 DUF2340: Uncharacterized conserved protein (DUF2340); InterPro: IPR018794 This entry consists of small proteins of approximately 150 amino acids whose function is unknown Back     alignment and domain information
>COG2104 ThiS Sulfur transfer protein involved in thiamine biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR01682 moaD molybdopterin converting factor, subunit 1, non-archaeal Back     alignment and domain information
>PRK05659 sulfur carrier protein ThiS; Validated Back     alignment and domain information
>cd00565 ThiS ThiaminS ubiquitin-like sulfur carrier protein Back     alignment and domain information
>TIGR01683 thiS thiamine biosynthesis protein ThiS Back     alignment and domain information
>cd05992 PB1 The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query136
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 2e-07
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 3e-06
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 2e-05
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 2e-05
2xzm_9189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 7e-05
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 9e-05
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 1e-04
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 1e-04
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 3e-04
1oqy_A 368 HHR23A, UV excision repair protein RAD23 homolog A 4e-04
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 5e-04
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 7e-04
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 93 Back     alignment and structure
 Score = 44.9 bits (106), Expect = 2e-07
 Identities = 19/90 (21%), Positives = 31/90 (34%), Gaps = 4/90 (4%)

Query: 7  SESVEITVKTIGPAPPS-RLSVSSPIKVRDLRKLIATSSANHLPIENLRLVFRGKVLDDT 65
          S  V + VK+         LS      V  L+  ++         E+ RL++ GK+L D 
Sbjct: 5  SSGVTLLVKSPNQRHRDLELSGDRGWSVGHLKAHLSRVYPERPRPEDQRLIYSGKLLLDH 64

Query: 66 QDDDDRDDVYLQLSNGDSVIAAVKPKPPPR 95
          Q      D+  +      +      K  P 
Sbjct: 65 QCL---RDLLPKQEKRHVLHLVCNVKSGPS 91


>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 125 Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 96 Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Length = 189 Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Length = 100 Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 106 Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Length = 77 Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Length = 368 Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Length = 90 Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 102 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query136
4a20_A98 Ubiquitin-like protein MDY2; protein binding, GET- 99.8
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 99.8
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 99.8
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 99.79
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 99.79
2lxa_A87 Ubiquitin-like protein MDY2; ubiquitin-like domain 99.79
3m62_B106 UV excision repair protein RAD23; armadillo-like r 99.78
3v6c_B91 Ubiquitin; structural genomics, structural genomic 99.78
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 99.78
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 99.78
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 99.78
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 99.77
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 99.77
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 99.77
1wju_A100 NEDD8 ultimate buster-1; ubiquitin-like domain, st 99.77
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 99.76
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 99.76
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 99.76
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 99.76
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 99.76
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 99.76
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 99.75
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 99.75
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 99.75
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 99.75
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 99.75
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 99.75
2daf_A118 FLJ35834 protein; hypothetical protein FLJ35834, u 99.74
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 99.74
1wxv_A92 BAG-family molecular chaperone regulator-1; struct 99.74
4hcn_B98 Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas 99.74
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 99.74
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 99.74
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 99.74
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 99.74
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 99.74
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 99.73
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 99.73
1x1m_A107 Ubiquitin-like protein SB132; structural genomics, 99.73
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 99.73
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 99.72
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 99.72
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 99.72
3vdz_A111 Ubiquitin-40S ribosomal protein S27A; gadolinium, 99.72
1wia_A95 Hypothetical ubiquitin-like protein (riken cDNA 20 99.71
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 99.71
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 99.7
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 99.7
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 99.69
1we6_A111 Splicing factor, putative; structural genomics, ub 99.69
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 99.51
1wgh_A116 Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo 99.68
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 99.68
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 99.68
2dzj_A88 Synaptic glycoprotein SC2; ubiquitin-like fold, st 99.68
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 99.67
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 99.67
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 99.66
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 99.66
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 99.66
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 99.66
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 99.66
1v2y_A105 3300001G02RIK protein; hypothetical protein, ubiqu 99.65
2gow_A125 HCG-1 protein, ubiquitin-like protein 3; BC059385, 99.65
4dbg_A105 Ranbp-type and C3HC4-type zinc finger-containing; 99.65
1se9_A126 Ubiquitin family; ubiquitin-like, cell-free, wheat 99.64
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 99.63
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 99.63
2fnj_B118 Transcription elongation factor B polypeptide 2; b 99.62
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 99.62
1t0y_A122 Tubulin folding cofactor B; ubiquitin-like, cytosk 99.62
4ajy_B118 Transcription elongation factor B polypeptide 2; E 99.61
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 99.6
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 99.59
4b6w_A86 Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik 99.58
2kj6_A97 Tubulin folding cofactor B; methods development, N 99.58
2dzm_A100 FAS-associated factor 1; ubiquitin-like domain, HF 99.58
3shq_A 320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 99.58
2kjr_A95 CG11242; UBL, ubiquitin, ubiquitin-like, structura 99.57
1v6e_A95 Cytoskeleton-associated protein 1; tubulin-specifi 99.57
3u5c_f152 40S ribosomal protein S31; translation, ribosome, 99.56
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 99.56
1oqy_A 368 HHR23A, UV excision repair protein RAD23 homolog A 99.54
1wf9_A107 NPL4 family protein; beta-grAsp fold like domain, 99.54
3ai5_A307 Yeast enhanced green fluorescent protein, ubiquit; 99.51
2kzr_A86 Ubiquitin thioesterase OTU1; structural genomics, 99.5
2io1_B94 Small ubiquitin-related modifier 3 precursor; SUMO 99.4
2xzm_9189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 99.35
2io0_B91 Small ubiquitin-related modifier 2 precursor; SUMO 99.33
3a4r_A79 Nfatc2-interacting protein; ubiquitin fold, coiled 99.32
1wjn_A97 Tubulin-folding protein TBCE; ubiquitin-like domai 99.32
1wm3_A72 Ubiquitin-like protein SMT3B; ubiquitin fold, half 99.29
2d07_B93 Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho 99.26
1wz0_A104 Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li 99.21
2k8h_A110 Small ubiquitin protein; SUMO, post-translational 99.19
2eke_C106 Ubiquitin-like protein SMT3; UBC9, SUMO binding mo 99.16
3kyd_D115 Small ubiquitin-related modifier 1; SUMO, thioeste 98.9
3pge_A200 SUMO-modified proliferating cell nuclear antigen; 98.66
2pjh_A80 Protein NPL4, nuclear protein localization protein 98.65
2jxx_A97 Nfatc2-interacting protein; nuclear factor of acti 98.5
3tix_A207 Ubiquitin-like protein SMT3, RNA-induced transcri 98.5
3goe_A82 DNA repair protein RAD60; SUMO-like domain, sumoyl 98.47
4efo_A94 Serine/threonine-protein kinase TBK1; ubiquitin li 98.3
3v7o_A227 Minor nucleoprotein VP30; ssgcid, seattle structur 98.25
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 98.03
2l76_A95 Nfatc2-interacting protein; ubiquitin-like domain, 97.94
3ix6_A 360 TS, tsase, thymidylate synthase; niaid, ssgcid, se 97.89
4da1_A 389 Protein phosphatase 1K, mitochondrial; metal-ION-a 97.74
2bps_A81 YUKD protein; ubiquitin-like protein, ubiquitin; 2 97.48
3qx1_A84 FAS-associated factor 1; UBX, protein binding, P97 97.4
2al3_A90 TUG long isoform; TUG UBL1 insulin, endocytosis/ex 97.34
2kc2_A128 Talin-1, F1; FERM, adhesion, cell membrane, cell p 97.06
2dzk_A109 UBX domain-containing protein 2; ubiquitin-like fo 96.98
1wj4_A124 KIAA0794 protein; UBX domain, beta-grAsp fold, str 96.25
2cr5_A109 Reproduction 8; UBX domain, D0H8S2298E protein, st 96.0
3rpf_C74 Molybdopterin converting factor, subunit 1 (MOAD); 95.4
2l32_A74 Small archaeal modifier protein 2; protein BIN; NM 95.25
1s3s_G127 P47 protein; AAA ATPase, protein-protein complex, 95.17
4e71_A111 Plexin-B2, MM1; transmembrane, signaling, RBD, str 95.12
3jyu_A231 Ubiquitin carboxyl-terminal hydrolase; domain in u 94.28
2r2o_A138 Plexin-B1; effector domain, structural genomics, s 94.1
1ryj_A70 Unknown; beta/alpha protein, structural genomics, 94.03
4a3p_A217 Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {H 93.97
1oey_A83 P67-PHOX, neutrophil cytosol factor 2; immune syst 93.96
3kuz_A126 Plexin-C1; structural genomics, structural genomic 93.41
3ivf_A 371 Talin-1; FERM domain, cell membrane, cell projecti 93.22
1wgk_A114 Riken cDNA 2900073H19 protein; THis domain, ubiqut 93.18
3h6n_A127 Plexin-D1; structural genomics consortium, SGC, me 93.18
1vjk_A98 Molybdopterin converting factor, subunit 1; struct 93.13
4e74_A117 Plexin-A4; RBD, structural genomics, structural ge 92.94
2daj_A91 KIAA0977 protein, COBL-like 1; ubiquitin-like doma 90.95
2kvr_A130 Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubi 90.69
2qjl_A99 URM1, ubiquitin-related modifier 1; ubiquitin-like 88.95
1tyg_B87 YJBS; alpha beta barrel, protein-protein complex, 87.43
3onh_A127 Ubiquitin-activating enzyme E1-like; ligase, SUMO 87.1
2c7h_A86 RBBP6, retinoblastoma-binding protein 6, isoform 3 86.77
2k9x_A110 Tburm1, uncharacterized protein; unknown function; 85.03
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 84.88
2kmm_A73 Guanosine-3',5'-BIS(diphosphate) 3'- pyrophosphohy 84.75
1vd2_A89 Protein kinase C, IOTA type; PB1 domain, OPCA moti 83.87
1fm0_D81 Molybdopterin convertin factor, subunit 1; molybde 82.75
3po0_A89 Small archaeal modifier protein 1; ubiquitin-like 82.24
1wgy_A104 RAP guanine nucleotide exchange factor 5; ubiquiti 80.98
3hm6_X 644 Plexin-B1; structural genomics consortium, SGC, me 80.94
2ylm_A 530 Ubiquitin carboxyl-terminal hydrolase 7; UBL; 2.70 80.77
>4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A Back     alignment and structure
Probab=99.80  E-value=2.8e-19  Score=125.02  Aligned_cols=75  Identities=19%  Similarity=0.332  Sum_probs=66.2

Q ss_pred             CCceEEEEEeCCCCCcEEE--EecCCCcHHHHHHHH-HhccCCCCCCCceEEEecCeecCCCCCCCCCCccccCC-CCCC
Q 032671            7 SESVEITVKTIGPAPPSRL--SVSSPIKVRDLRKLI-ATSSANHLPIENLRLVFRGKVLDDTQDDDDRDDVYLQL-SNGD   82 (136)
Q Consensus         7 ~~~m~I~VKt~~~~~~~~v--~v~~~~TV~eLK~~I-a~~~~~gi~~~~QRLI~~GK~L~D~~t~d~~~L~~~~I-~dG~   82 (136)
                      .++|+|+||+.+|+. +.+  +++++.||++||++| ++  ..|+|+++|||||+|+.|+|+.+     |++|+| ++|+
T Consensus        17 ~~~m~I~VKtl~g~~-~~i~v~v~~~~TV~~lK~~I~~~--~~gip~~~QrLi~~Gk~L~D~~t-----L~dy~I~~~g~   88 (98)
T 4a20_A           17 NAAVHLTLKKIQAPK-FSIEHDFSPSDTILQIKQHLISE--EKASHISEIKLLLKGKVLHDNLF-----LSDLKVTPANS   88 (98)
T ss_dssp             -CCEEEEEEECSSSC-EEEEEEECTTCBHHHHHHHHHHT--TSCSCGGGEEEEETTEEECTTCB-----GGGSCCBTTBC
T ss_pred             CCCEEEEEEcCCCCE-EEEEEecCCCChHHHHHHHHHHH--hcCCChhhEEEEECCEECcCcCC-----HHHcCcCCCCC
Confidence            578999999999975 665  666999999999999 77  78999999999999999999888     999999 9999


Q ss_pred             EEEEEec
Q 032671           83 SVIAAVK   89 (136)
Q Consensus        83 tIlv~~~   89 (136)
                      +|++++.
T Consensus        89 ti~lmvs   95 (98)
T 4a20_A           89 TITVMIK   95 (98)
T ss_dssp             EEEEEEC
T ss_pred             EEEEEEe
Confidence            9955543



>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Back     alignment and structure
>2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Back     alignment and structure
>1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A Back     alignment and structure
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Back     alignment and structure
>1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Back     alignment and structure
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Back     alignment and structure
>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A Back     alignment and structure
>1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Back     alignment and structure
>2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Back     alignment and structure
>1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 Back     alignment and structure
>4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} Back     alignment and structure
>2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} Back     alignment and structure
>1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* Back     alignment and structure
>2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} Back     alignment and structure
>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Back     alignment and structure
>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Back     alignment and structure
>1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Back     alignment and structure
>2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Back     alignment and structure
>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Back     alignment and structure
>2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 Back     alignment and structure
>3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Back     alignment and structure
>2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} Back     alignment and structure
>3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* Back     alignment and structure
>4efo_A Serine/threonine-protein kinase TBK1; ubiquitin like domain, transferase; 1.77A {Homo sapiens} Back     alignment and structure
>3v7o_A Minor nucleoprotein VP30; ssgcid, seattle structural genomics center for infectious disease, SMT, transcription; 2.25A {Reston ebolavirus} Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>2l76_A Nfatc2-interacting protein; ubiquitin-like domain, structural genomics, PSI-biology, Pro structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3ix6_A TS, tsase, thymidylate synthase; niaid, ssgcid, seattle structural center for infectious DISE brucellosis, orchitis, epididymitis, mastitis; 2.20A {Brucella melitensis} Back     alignment and structure
>4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A Back     alignment and structure
>2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis} Back     alignment and structure
>3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A Back     alignment and structure
>2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>2kc2_A Talin-1, F1; FERM, adhesion, cell membrane, cell projection, cytoplasm, cytoskeleton, membrane, phosphoprotein, structural protein; NMR {Mus musculus} Back     alignment and structure
>2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A Back     alignment and structure
>1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 Back     alignment and structure
>2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>3rpf_C Molybdopterin converting factor, subunit 1 (MOAD); MCSG, PSI-biology, structural genomics, midwest center for S genomics, transferase; 1.90A {Helicobacter pylori} Back     alignment and structure
>2l32_A Small archaeal modifier protein 2; protein BIN; NMR {Haloferax volcanii} Back     alignment and structure
>1s3s_G P47 protein; AAA ATPase, protein-protein complex, UBX domain, protein binding; HET: ADP; 2.90A {Rattus norvegicus} SCOP: d.15.1.2 PDB: 1i42_A 1jru_A Back     alignment and structure
>4e71_A Plexin-B2, MM1; transmembrane, signaling, RBD, structural genomics consortium, SGC, signaling protein; 2.26A {Homo sapiens} Back     alignment and structure
>3jyu_A Ubiquitin carboxyl-terminal hydrolase; domain in ubiquitin-specific peptidases (DUSP), proto- oncogene, ubiquitin-fold, UBL, protease, thioesterase; HET: 1PS; 2.37A {Mus musculus} Back     alignment and structure
>2r2o_A Plexin-B1; effector domain, structural genomics, structural GEN consortium, SGC, glycoprotein, membrane, phosphorylation, R secreted, transmembrane; 2.00A {Homo sapiens} PDB: 2rex_A* 2jph_A Back     alignment and structure
>1ryj_A Unknown; beta/alpha protein, structural genomics, protein structure initiative, OCSP, NESG, PSI; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.15.3.2 Back     alignment and structure
>4a3p_A Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {Homo sapiens} PDB: 4a3o_A 3pv1_A 3ppa_A* 3t9l_A 3lmn_A Back     alignment and structure
>1oey_A P67-PHOX, neutrophil cytosol factor 2; immune system, PB1 heterodimer/complex, NADPH oxidase, PB1 D heterodimerization; 2.0A {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
>3kuz_A Plexin-C1; structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Back     alignment and structure
>1wgk_A Riken cDNA 2900073H19 protein; THis domain, ubiqutin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.3.3 PDB: 1xo3_A Back     alignment and structure
>3h6n_A Plexin-D1; structural genomics consortium, SGC, membrane, transmembrane, receptor, alternative splicing, cell membrane, glycoprotein, polymorphism; 2.00A {Homo sapiens} Back     alignment and structure
>1vjk_A Molybdopterin converting factor, subunit 1; structural genomics, PSI, protein structure INI southeast collaboratory for structural genomics; 1.51A {Pyrococcus furiosus} SCOP: d.15.3.1 Back     alignment and structure
>4e74_A Plexin-A4; RBD, structural genomics, structural genomics consor SGC, signaling protein; 1.58A {Homo sapiens} PDB: 3q3j_A* Back     alignment and structure
>2daj_A KIAA0977 protein, COBL-like 1; ubiquitin-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvr_A Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubiquitin-like domain, UBL, ubiquitin specific protease, HOST-virus interaction, nucleus, protease; NMR {Homo sapiens} Back     alignment and structure
>2qjl_A URM1, ubiquitin-related modifier 1; ubiquitin-like protein, signaling protein; 1.44A {Saccharomyces cerevisiae} PDB: 2pko_A 2ax5_A Back     alignment and structure
>1tyg_B YJBS; alpha beta barrel, protein-protein complex, THis, BIOS protein; 3.15A {Bacillus subtilis} SCOP: d.15.3.2 Back     alignment and structure
>3onh_A Ubiquitin-activating enzyme E1-like; ligase, SUMO conjugation, UBC9; 1.60A {Saccharomyces cerevisiae} PDB: 3ong_A Back     alignment and structure
>2c7h_A RBBP6, retinoblastoma-binding protein 6, isoform 3; P53-associated, mRNA processing, splicing-associated, oesophageal cancer; NMR {Homo sapiens} Back     alignment and structure
>2k9x_A Tburm1, uncharacterized protein; unknown function; NMR {Trypanosoma brucei} Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>2kmm_A Guanosine-3',5'-BIS(diphosphate) 3'- pyrophosphohydrolase; methods development, TGS domain, predominantly beta-sheet structure; NMR {Porphyromonas gingivalis} Back     alignment and structure
>1vd2_A Protein kinase C, IOTA type; PB1 domain, OPCA motif, APKC, ZIP/P62, MEK5, molecular recognition, transferase; NMR {Homo sapiens} SCOP: d.15.2.2 PDB: 1wmh_A Back     alignment and structure
>1fm0_D Molybdopterin convertin factor, subunit 1; molybdenum cofactor biosynthesis, transferase; 1.45A {Escherichia coli} SCOP: d.15.3.1 PDB: 1fma_D 1jw9_D 1jwa_D* 1jwb_D* 3bii_D 1nvi_D Back     alignment and structure
>3po0_A Small archaeal modifier protein 1; ubiquitin-like protein, protein binding; 1.55A {Haloferax volcanii} PDB: 2l83_A Back     alignment and structure
>1wgy_A RAP guanine nucleotide exchange factor 5; ubiquitin fold, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.5 Back     alignment and structure
>3hm6_X Plexin-B1; structural genomics consortium, SGC, membrane, transmembrane receptor, cell membrane, glycoprotein, phosphoprotein; 2.40A {Homo sapiens} PDB: 3sua_D* 3su8_X* Back     alignment and structure
>2ylm_A Ubiquitin carboxyl-terminal hydrolase 7; UBL; 2.70A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 136
d1wgda_93 d.15.1.1 (A:) Homocysteine-responsive endoplasmic 6e-09
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ubiquitin-related
domain: Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 47.9 bits (114), Expect = 6e-09
 Identities = 18/89 (20%), Positives = 30/89 (33%), Gaps = 4/89 (4%)

Query: 7  SESVEITVKTIGPAPPSR-LSVSSPIKVRDLRKLIATSSANHLPIENLRLVFRGKVLDDT 65
          S  V + VK+         LS      V  L+  ++         E+ RL++ GK+L   
Sbjct: 5  SSGVTLLVKSPNQRHRDLELSGDRGWSVGHLKAHLSRVYPERPRPEDQRLIYSGKLL--- 61

Query: 66 QDDDDRDDVYLQLSNGDSVIAAVKPKPPP 94
           D     D+  +      +      K  P
Sbjct: 62 LDHQCLRDLLPKQEKRHVLHLVCNVKSGP 90


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query136
d1wh3a_87 2'-5'-oligoadenylate synthetase-like protein, OASL 99.83
d1ttna180 Dendritic cell-derived ubiquitin-like protein {Hum 99.81
d2zeqa178 Ubiquitin-like domain of parkin {Mouse (Mus muscul 99.81
d1uela_95 Ubiquitin-like domain of Rad23 homolog B (Hhr23B) 99.8
d1bt0a_73 Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI 99.8
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 99.8
d1wy8a176 Ubiquitin-like PHD and RING finger domain-containi 99.8
d1yqba184 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 99.8
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 99.8
d1oqya477 Ubiquitin-like domain of Rad23 homolog A (Hhr23a) 99.79
d2bwfa173 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.79
d2faza176 Ubiquitin-like PHD and RING finger domain-containi 99.79
d1wgga_96 Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M 99.79
d1wx9a173 Large proline-rich protein BAT3 {Human (Homo sapie 99.78
d1z2ma176 Interferon-induced 15 kDa protein {Human (Homo sap 99.78
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 99.77
d1wx8a183 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 99.76
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 99.75
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 99.75
d1se9a_101 Hypothetical protein At3g01050 {Thale cress (Arabi 99.74
d1v5ta_90 8430435i17rik protein {Mouse (Mus musculus) [TaxId 99.74
d1wiaa_95 Ubiquitin-like protein bab25500 (2010008E23Rik) {M 99.73
d1wgha_116 Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu 99.72
d1v5oa_102 1700011n24rik protein {Mouse (Mus musculus) [TaxId 99.71
d1wjua_100 NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens 99.71
d1v2ya_105 Ubiquitin-like protein 3300001g02rik {Mouse (Mus m 99.7
d1v86a_95 hypothetical D7wsu128e protein {Mouse (Mus musculu 99.69
d1wgda_93 Homocysteine-responsive endoplasmic reticulum-resi 99.69
d1wxva181 Bag-family molecular chaperone regulator-1 {Human 99.69
d1zkha186 Splicing factor 3 subunit 1, C-terminal domain {Hu 99.68
d1we6a_111 Splicing factor 3 subunit 1, C-terminal domain {Th 99.66
d1v6ea_95 Ubiquitin-like domain of tubulin folding cofactor 99.62
d1wjna_97 Tubulin-folding protein TbcE {Mouse (Mus musculus) 99.57
d2c9wb1103 Elongin B {Human (Homo sapiens) [TaxId: 9606]} 99.49
d1t0ya_90 Ubiquitin-like domain of tubulin folding cofactor 99.43
d1euvb_79 SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy 99.42
d1x1ma194 Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta 99.4
d2uyzb177 SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax 99.33
d1wm3a_72 SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} 98.64
d1wf9a194 NPL4-like protein 1 {Thale cress (Arabidopsis thal 98.52
d2al3a176 Tether containing UBX domain for GLUT4 (Tug) {Mous 97.0
d1i42a_89 p47 {Rat (Rattus norvegicus) [TaxId: 10116]} 96.72
d2cr5a196 UBX domain-containing protein 6 (Reproduction 8) { 96.49
d1h8ca_82 Fas-associated factor 1, Faf1 {Human (Homo sapiens 96.41
d1wj4a_124 Hypothetical protein KIAA0794 {Human (Homo sapiens 95.79
d1vjka_88 Molybdopterin synthase subunit MoaD {Pyrococcus fu 95.53
d1wgya_104 Rap guanine nucleotide exchange factor 5, RapGEF5 86.71
d1xo3a_101 C9orf74 homolog {Mouse (Mus musculus) [TaxId: 1009 85.86
d1ip9a_85 Bud emergence mediator Bemp1 {Baker's yeast (Sacch 83.47
d1y8xb192 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 80.56
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ubiquitin-related
domain: 2'-5'-oligoadenylate synthetase-like protein, OASL
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.83  E-value=7.3e-21  Score=128.10  Aligned_cols=80  Identities=19%  Similarity=0.253  Sum_probs=71.6

Q ss_pred             CCCCceEEEEEeCCCCCcEEEEecCCCcHHHHHHHHHhccCCCCCCCceEEEecCeecCCCCCCCCCCccccCCCCCCEE
Q 032671            5 EISESVEITVKTIGPAPPSRLSVSSPIKVRDLRKLIATSSANHLPIENLRLVFRGKVLDDTQDDDDRDDVYLQLSNGDSV   84 (136)
Q Consensus         5 e~~~~m~I~VKt~~~~~~~~v~v~~~~TV~eLK~~Ia~~~~~gi~~~~QRLI~~GK~L~D~~t~d~~~L~~~~I~dG~tI   84 (136)
                      ..++.|+|+||+..++. +.++|+++.||.+||++|+.  ++|+|+++|||+|+||.|+|+.+     |.+|+|++|++|
T Consensus         3 ~~s~~mqI~Vk~~~g~~-~~l~v~~~~tV~~lK~~I~~--~~gip~~~qrLi~~Gk~L~d~~t-----L~~y~I~~~stl   74 (87)
T d1wh3a_           3 SGSSGIQVFVKNPDGGS-YAYAINPNSFILGLKQQIED--QQGLPKKQQQLEFQGQVLQDWLG-----LGIYGIQDSDTL   74 (87)
T ss_dssp             CCSSSEEEEEEETTTEE-EEEEECSSSBHHHHHHHHHH--HTCCCTTTEEEEETTEECCSSSB-----HHHHTCCTTEEE
T ss_pred             CCCCcEEEEEECCCCCE-EEEEECCcCcHHHHHHHHHH--HHCcChHHeEEEeeceEcCCCCc-----HHHcCCCCCCEE
Confidence            35688999999999965 89999999999999999999  99999999999999999999888     999999999999


Q ss_pred             -EEEecCCC
Q 032671           85 -IAAVKPKP   92 (136)
Q Consensus        85 -lv~~~p~~   92 (136)
                       ++...+..
T Consensus        75 ~l~~r~~~g   83 (87)
T d1wh3a_          75 ILSKKKGSG   83 (87)
T ss_dssp             EEEECSCCC
T ss_pred             EEEecCCCC
Confidence             44444433



>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Back     information, alignment and structure
>d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjka_ d.15.3.1 (A:) Molybdopterin synthase subunit MoaD {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wgya_ d.15.1.5 (A:) Rap guanine nucleotide exchange factor 5, RapGEF5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xo3a_ d.15.3.3 (A:) C9orf74 homolog {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ip9a_ d.15.2.2 (A:) Bud emergence mediator Bemp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y8xb1 c.111.1.2 (B:349-440) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure