Citrus Sinensis ID: 032677

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130------
MYQQDIKNDDSNNNSFAMTHSTHWNRSEDKLFEHALVMFPEESPDRWQKIASQLPGKSAVEVREHYEALVHDVYEIDSGRVELPSYADDSDWDSPSQISFAPKSTKHGDPERKKGTPWTEEEHKLFLIGLKKIRQG
cccccccccccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccc
ccHHHHHccccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHcccccccHHHHHHHHHHHHHcccc
myqqdiknddsnnnsfamthsthwnrsedKLFEHAlvmfpeespdrWQKIasqlpgksaVEVREHYEALVHDVyeidsgrvelpsyaddsdwdspsqisfapkstkhgdperkkgtpwteEEHKLFLIGLKKIRQG
myqqdiknddsnnnsFAMTHSTHWNRSEDKLFEHALVMFPEESPDRWQKIASQLPGKSAVEVREHYEALVHDVYEIDSGRVELPSYADDSDWDSPSQIsfapkstkhgdperkkgtpwteeehkLFLIglkkirqg
MYQQDIKNDDSNNNSFAMTHSTHWNRSEDKLFEHALVMFPEESPDRWQKIASQLPGKSAVEVREHYEALVHDVYEIDSGRVELPSYADDSDWDSPSQISFAPKSTKHGDPERKKGTPWTEEEHKLFLIGLKKIRQG
******************************LFEHALVMF*******************AVEVREHYEALVHDVYEIDSGRV******************************************KLFLIGL******
****************************DKLFEHALVMFPEESPDRWQKIASQLPGKSAVEVREHYEALVHDVYEIDSGRVELPSYADDSDWDSPSQISFAPKSTK***********WTEEEHKLFLIGLKKIRQ*
********DDSNNNSFAMTHSTHWNRSEDKLFEHALVMFPEESPDRWQKIASQLPGKSAVEVREHYEALVHDVYEIDSGRVELPSYADDSDWDSPSQISFA****************WTEEEHKLFLIGLKKIRQG
********************STHWNRSEDKLFEHALVMFPEESPDRWQKIASQLPGKSAVEVREHYEALVHDVYEIDSGRVELPSYA***************************GTPWTEEEHKLFLIGLKKIR**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYQQDIKNDDSNNNSFAMTHSTHWNRSEDKLFEHALVMFPEESPDRWQKIASQLPGKSAVEVREHYEALVHDVYEIDSGRVELPSYADDSDWDSPSQISFAPKSTKHGDPERKKGTPWTEEEHKLFLIGLKKIRQG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query136 2.2.26 [Sep-21-2011]
Q8S9H7 307 Transcription factor DIVA N/A no 0.852 0.377 0.407 1e-21
Q6NNN081 Protein RADIALIS-like 3 O no no 0.5 0.839 0.485 9e-14
Q1A17397 Protein RADIALIS-like 6 O no no 0.463 0.649 0.444 2e-12
Q1G3C477 Protein RADIALIS-like 4 O no no 0.433 0.766 0.559 6e-12
Q58FS393 Transcription factor RADI N/A no 0.463 0.677 0.428 4e-11
F4JVB8100 Protein RADIALIS-like 1 O no no 0.463 0.63 0.412 5e-11
Q8GW75100 Protein RADIALIS-like 5 O no no 0.433 0.59 0.440 2e-09
Q9SIJ5101 Protein RADIALIS-like 2 O no no 0.463 0.623 0.365 2e-08
P54103621 DnaJ homolog subfamily C yes no 0.389 0.085 0.415 4e-06
Q2V9B0 297 Transcription factor MYB1 N/A no 0.191 0.087 0.730 5e-06
>sp|Q8S9H7|DIV_ANTMA Transcription factor DIVARICATA OS=Antirrhinum majus GN=DIVARICATA PE=2 SV=1 Back     alignment and function desciption
 Score =  102 bits (253), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 53/130 (40%), Positives = 77/130 (59%), Gaps = 14/130 (10%)

Query: 21  STHWNRSEDKLFEHALVMFPEESPDRWQKIASQLPGKSAVEVREHYEALVHDVYEIDSGR 80
           +T W  +E+K FE+AL +F E +P+RW+++A ++PGK+  +V   Y+ L  DV  I++G 
Sbjct: 23  TTRWTAAENKAFENALAVFDENTPNRWERVAERVPGKTVGDVMRQYKELEDDVSSIEAGF 82

Query: 81  VELPSYADDS----DWDS-------PSQISFAPKSTKHGDP---ERKKGTPWTEEEHKLF 126
           V +P Y+  S    +W S               + +  G P   ERKKG PWTEEEHKLF
Sbjct: 83  VPVPGYSTSSPFTLEWGSGHGFDGFKQSYGTGGRKSSSGRPSEQERKKGVPWTEEEHKLF 142

Query: 127 LIGLKKIRQG 136
           L+GLKK  +G
Sbjct: 143 LMGLKKYGKG 152
Involved in the dorsovental asymmetry of flowers. Promotes ventral identity.
Antirrhinum majus (taxid: 4151)
>sp|Q6NNN0|RADL3_ARATH Protein RADIALIS-like 3 OS=Arabidopsis thaliana GN=RL3 PE=2 SV=1 Back     alignment and function description
>sp|Q1A173|RADL6_ARATH Protein RADIALIS-like 6 OS=Arabidopsis thaliana GN=RL6 PE=2 SV=1 Back     alignment and function description
>sp|Q1G3C4|RADL4_ARATH Protein RADIALIS-like 4 OS=Arabidopsis thaliana GN=RL4 PE=2 SV=1 Back     alignment and function description
>sp|Q58FS3|RAD_ANTMA Transcription factor RADIALIS OS=Antirrhinum majus GN=RAD PE=1 SV=1 Back     alignment and function description
>sp|F4JVB8|RADL1_ARATH Protein RADIALIS-like 1 OS=Arabidopsis thaliana GN=RL1 PE=2 SV=1 Back     alignment and function description
>sp|Q8GW75|RADL5_ARATH Protein RADIALIS-like 5 OS=Arabidopsis thaliana GN=RL5 PE=3 SV=1 Back     alignment and function description
>sp|Q9SIJ5|RADL2_ARATH Protein RADIALIS-like 2 OS=Arabidopsis thaliana GN=RL2 PE=2 SV=1 Back     alignment and function description
>sp|P54103|DNJC2_MOUSE DnaJ homolog subfamily C member 2 OS=Mus musculus GN=Dnajc2 PE=1 SV=2 Back     alignment and function description
>sp|Q2V9B0|MY1R1_SOLTU Transcription factor MYB1R1 OS=Solanum tuberosum PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query136
351725743236 syringolide-induced protein 1-3-1B [Glyc 0.867 0.5 0.646 8e-41
449446301233 PREDICTED: transcription factor DIVARICA 0.852 0.497 0.677 4e-40
358346346 244 DnaJ homolog subfamily C member [Medicag 1.0 0.557 0.576 5e-40
351725775233 syringolide-induced protein 1-3-1A [Glyc 0.845 0.493 0.645 9e-40
110931666233 MYB transcription factor MYB69 [Glycine 0.845 0.493 0.645 2e-39
297810569213 hypothetical protein ARALYDRAFT_908364 [ 0.823 0.525 0.686 3e-38
225464896224 PREDICTED: myb-like protein H [Vitis vin 0.808 0.491 0.632 1e-32
296084883225 unnamed protein product [Vitis vinifera] 0.808 0.488 0.632 1e-32
255565691214 DNA binding protein, putative [Ricinus c 0.852 0.542 0.598 1e-32
15238311215 duplicated SANT DNA-binding domain-conta 0.823 0.520 0.636 2e-32
>gi|351725743|ref|NP_001237103.1| syringolide-induced protein 1-3-1B [Glycine max] gi|19911579|dbj|BAB86893.1| syringolide-induced protein 1-3-1B [Glycine max] Back     alignment and taxonomy information
 Score =  171 bits (433), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 84/130 (64%), Positives = 96/130 (73%), Gaps = 12/130 (9%)

Query: 19  THSTHWNRSEDKLFEHALVMFPEESPDRWQKIASQLPGKSAVEVREHYEALVHDVYEIDS 78
           T  T W R  DKLFE AL++ PE+ PDRW+KIA Q+PGKSAVEVREHYEALVHDV+EIDS
Sbjct: 12  TQPTQWTRYHDKLFERALLVVPEDLPDRWEKIADQVPGKSAVEVREHYEALVHDVFEIDS 71

Query: 79  GRVELPSYADD------------SDWDSPSQISFAPKSTKHGDPERKKGTPWTEEEHKLF 126
           GRVE+PSY DD            S WD+ +QISF  K  + GD ERKKGTPWTEEEH+LF
Sbjct: 72  GRVEVPSYVDDSVATPPSGGAEISTWDNANQISFGSKPKQQGDNERKKGTPWTEEEHRLF 131

Query: 127 LIGLKKIRQG 136
           LIGL K  +G
Sbjct: 132 LIGLSKFGKG 141

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449446301|ref|XP_004140910.1| PREDICTED: transcription factor DIVARICATA-like [Cucumis sativus] gi|449524322|ref|XP_004169172.1| PREDICTED: transcription factor DIVARICATA-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|358346346|ref|XP_003637230.1| DnaJ homolog subfamily C member [Medicago truncatula] gi|355503165|gb|AES84368.1| DnaJ homolog subfamily C member [Medicago truncatula] Back     alignment and taxonomy information
>gi|351725775|ref|NP_001237360.1| syringolide-induced protein 1-3-1A [Glycine max] gi|19911577|dbj|BAB86892.1| syringolide-induced protein 1-3-1A [Glycine max] Back     alignment and taxonomy information
>gi|110931666|gb|ABH02832.1| MYB transcription factor MYB69 [Glycine max] Back     alignment and taxonomy information
>gi|297810569|ref|XP_002873168.1| hypothetical protein ARALYDRAFT_908364 [Arabidopsis lyrata subsp. lyrata] gi|297319005|gb|EFH49427.1| hypothetical protein ARALYDRAFT_908364 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|225464896|ref|XP_002273261.1| PREDICTED: myb-like protein H [Vitis vinifera] Back     alignment and taxonomy information
>gi|296084883|emb|CBI28292.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255565691|ref|XP_002523835.1| DNA binding protein, putative [Ricinus communis] gi|223536923|gb|EEF38561.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|15238311|ref|NP_196096.1| duplicated SANT DNA-binding domain-containing protein [Arabidopsis thaliana] gi|7413538|emb|CAB86018.1| I-box binding factor-like protein [Arabidopsis thaliana] gi|9758451|dbj|BAB08980.1| I-box binding factor-like protein [Arabidopsis thaliana] gi|15293085|gb|AAK93653.1| putative I-box binding factor [Arabidopsis thaliana] gi|20258889|gb|AAM14116.1| putative I-box binding factor [Arabidopsis thaliana] gi|21593953|gb|AAM65901.1| I-box binding factor-like protein [Arabidopsis thaliana] gi|225898887|dbj|BAH30574.1| hypothetical protein [Arabidopsis thaliana] gi|332003398|gb|AED90781.1| duplicated SANT DNA-binding domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query136
TAIR|locus:2175478215 AT5G04760 [Arabidopsis thalian 0.823 0.520 0.661 4.3e-38
TAIR|locus:2074723 263 AT3G11280 [Arabidopsis thalian 0.889 0.460 0.424 2.6e-24
TAIR|locus:2042872 298 AT2G38090 [Arabidopsis thalian 0.610 0.278 0.383 4.9e-24
UNIPROTKB|Q8S9H7 307 DIVARICATA "Transcription fact 0.852 0.377 0.415 7e-22
TAIR|locus:2159607 298 AT5G08520 [Arabidopsis thalian 0.830 0.379 0.433 3e-21
TAIR|locus:2166459 277 AT5G05790 [Arabidopsis thalian 0.852 0.418 0.379 1.7e-20
TAIR|locus:2154508 288 AT5G58900 [Arabidopsis thalian 0.941 0.444 0.384 2.1e-20
TAIR|locus:2028461 314 AT1G49010 [Arabidopsis thalian 0.463 0.200 0.424 1.8e-19
TAIR|locus:2150149 267 AT5G01200 [Arabidopsis thalian 0.720 0.367 0.3 2.5e-18
TAIR|locus:2075775 287 AT3G10580 [Arabidopsis thalian 0.786 0.372 0.482 7.5e-18
TAIR|locus:2175478 AT5G04760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 408 (148.7 bits), Expect = 4.3e-38, P = 4.3e-38
 Identities = 80/121 (66%), Positives = 94/121 (77%)

Query:    21 STHWNRSEDKLFEHALVMFPEESPDRWQKIASQLPGKSAVEVREHYEALVHDVYEIDSGR 80
             S+ W RSEDK+FE ALV+FPE SP+RW++IA QL  KSA EVREHYE LVHDV+EIDSGR
Sbjct:     3 SSQWTRSEDKMFEQALVLFPEGSPNRWERIADQLH-KSAGEVREHYEVLVHDVFEIDSGR 61

Query:    81 VELPSYADDS-----DWDSPSQISFAPKSTKHGDPERKKGTPWTEEEHKLFLIGLKKIRQ 135
             V++P Y DDS      WDS  QISF    +KHG+ ERK+GTPWTE EHKLFLIGLK+  +
Sbjct:    62 VDVPDYMDDSAAAAAGWDSAGQISFG---SKHGESERKRGTPWTENEHKLFLIGLKRYGK 118

Query:   136 G 136
             G
Sbjct:   119 G 119
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
GO:0010286 "heat acclimation" evidence=RCA
TAIR|locus:2074723 AT3G11280 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042872 AT2G38090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q8S9H7 DIVARICATA "Transcription factor DIVARICATA" [Antirrhinum majus (taxid:4151)] Back     alignment and assigned GO terms
TAIR|locus:2159607 AT5G08520 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166459 AT5G05790 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154508 AT5G58900 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2028461 AT1G49010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150149 AT5G01200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075775 AT3G10580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query136
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 5e-07
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 8e-07
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 6e-06
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information 
 Score = 43.4 bits (103), Expect = 5e-07
 Identities = 15/50 (30%), Positives = 27/50 (54%), Gaps = 3/50 (6%)

Query: 22 THWNRSEDKLFEHALVMFPEESPDRWQKIASQLPGKSAVEVREHYEALVH 71
            W   ED+L    +  + +   + W+KIA +LPG++A + RE +  L+ 
Sbjct: 2  GEWTEEEDELLIELVKKYGK---NNWEKIAKELPGRTAEQCRERWRNLLK 48

Length = 49
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 136
PLN03212 249 Transcription repressor MYB5; Provisional 99.49
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.44
PLN03091 459 hypothetical protein; Provisional 99.39
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.32
KOG0048 238 consensus Transcription factor, Myb superfamily [T 99.26
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.22
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.15
KOG0724 335 consensus Zuotin and related molecular chaperones 99.08
KOG0049 939 consensus Transcription factor, Myb superfamily [T 98.9
PLN03212249 Transcription repressor MYB5; Provisional 98.62
PLN03091 459 hypothetical protein; Provisional 98.47
KOG0049 939 consensus Transcription factor, Myb superfamily [T 98.36
KOG0048238 consensus Transcription factor, Myb superfamily [T 98.29
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 98.22
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 98.11
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.95
KOG0051 607 consensus RNA polymerase I termination factor, Myb 97.83
COG5259 531 RSC8 RSC chromatin remodeling complex subunit RSC8 97.82
KOG1279 506 consensus Chromatin remodeling factor subunit and 97.59
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 97.58
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 97.54
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 97.52
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 97.22
KOG4167 907 consensus Predicted DNA-binding protein, contains 97.14
COG5147 512 REB1 Myb superfamily proteins, including transcrip 96.95
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 96.9
PLN031421033 Probable chromatin-remodeling complex ATPase chain 96.8
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 96.47
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 96.47
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 96.43
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 96.37
COG5147 512 REB1 Myb superfamily proteins, including transcrip 95.93
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 95.09
KOG1194 534 consensus Predicted DNA-binding protein, contains 95.06
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 94.7
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 93.64
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 93.53
KOG4329 445 consensus DNA-binding protein [General function pr 92.17
PRK13923170 putative spore coat protein regulator protein YlbO 91.91
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 91.65
smart0059589 MADF subfamily of SANT domain. 91.02
KOG0051607 consensus RNA polymerase I termination factor, Myb 90.45
KOG4282 345 consensus Transcription factor GT-2 and related pr 89.24
KOG4329445 consensus DNA-binding protein [General function pr 88.87
KOG2656 445 consensus DNA methyltransferase 1-associated prote 87.13
KOG4468 782 consensus Polycomb-group transcriptional regulator 86.79
PF1340442 HTH_AsnC-type: AsnC-type helix-turn-helix domain; 83.6
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 82.11
PF1054585 MADF_DNA_bdg: Alcohol dehydrogenase transcription 81.33
KOG3554 693 consensus Histone deacetylase complex, MTA1 compon 80.35
cd0008659 homeodomain Homeodomain; DNA binding domains invol 80.06
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information 
Probab=99.49  E-value=8.9e-14  Score=111.23  Aligned_cols=74  Identities=19%  Similarity=0.308  Sum_probs=64.1

Q ss_pred             CCCCCCHHHHHHHHHHHhhCCCCCChHHHHHHHhC-CCCCHHHHHHHHHHHHHhHhhhccCCccCCCCCCCCCCCCCCcc
Q 032677           20 HSTHWNRSEDKLFEHALVMFPEESPDRWQKIASQL-PGKSAVEVREHYEALVHDVYEIDSGRVELPSYADDSDWDSPSQI   98 (136)
Q Consensus        20 ~~~~WT~eEdk~le~al~~~~~~~~~rW~~IA~~v-pgrt~~qv~~ry~~l~~dv~~ie~g~v~~p~~~~~~~~~s~~~~   98 (136)
                      ..++||+|||++|..++++|+.   .+|..||..+ |+||.+||++||.+.+.            |..            
T Consensus        24 KRg~WT~EEDe~L~~lV~kyG~---~nW~~IAk~~g~gRT~KQCReRW~N~L~------------P~I------------   76 (249)
T PLN03212         24 KRGPWTVEEDEILVSFIKKEGE---GRWRSLPKRAGLLRCGKSCRLRWMNYLR------------PSV------------   76 (249)
T ss_pred             cCCCCCHHHHHHHHHHHHHhCc---ccHHHHHHhhhcCCCcchHHHHHHHhhc------------hhc------------
Confidence            3578999999999999999985   4799999998 59999999999999984            222            


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHhhCC
Q 032677           99 SFAPKSTKHGDPERKKGTPWTEEEHKLFLIGLKKIRQ  135 (136)
Q Consensus        99 ~~~~k~~~~~~~erkkg~pWTeeEhrlfL~gL~kyGK  135 (136)
                                    ++ .+||+||+.++|....+||.
T Consensus        77 --------------~k-gpWT~EED~lLlel~~~~Gn   98 (249)
T PLN03212         77 --------------KR-GGITSDEEDLILRLHRLLGN   98 (249)
T ss_pred             --------------cc-CCCChHHHHHHHHHHHhccc
Confidence                          22 58999999999999999985

>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>KOG4329 consensus DNA-binding protein [General function prediction only] Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>smart00595 MADF subfamily of SANT domain Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>KOG4329 consensus DNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG4468 consensus Polycomb-group transcriptional regulator [Transcription] Back     alignment and domain information
>PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>PF10545 MADF_DNA_bdg: Alcohol dehydrogenase transcription factor Myb/SANT-like; InterPro: IPR006578 The MADF (myb/SANT-like domain in Adf-1) domain is an approximately 80-amino-acid module that directs sequence specific DNA binding to a site consisting of multiple tri-nucleotide repeats Back     alignment and domain information
>KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query136
2cjj_A93 Crystal Structure Of The Myb Domain Of The Rad Tran 4e-12
2m2e_A73 Solution Nmr Structure Of The Sant Domain Of Human 5e-07
4eef_G74 Crystal Structure Of The Designed Inhibitor Protein 9e-07
2cqr_A73 Solution Structure Of Rsgi Ruh-043, A Myb Dna-Bindi 5e-04
>pdb|2CJJ|A Chain A, Crystal Structure Of The Myb Domain Of The Rad Transcription Factor From Antirrhinum Majus Length = 93 Back     alignment and structure 
Iteration: 1

 Score = 66.6 bits (161), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 44/63 (69%)
Query: 24 WNRSEDKLFEHALVMFPEESPDRWQKIASQLPGKSAVEVREHYEALVHDVYEIDSGRVEL 83
          W+  E+K FE AL ++ +++PDRW  +A  + G++  EV++HYE LV D+  I+SG+V  
Sbjct: 11 WSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYIESGKVPF 70
Query: 84 PSY 86
          P+Y
Sbjct: 71 PNY 73
>pdb|2M2E|A Chain A, Solution Nmr Structure Of The Sant Domain Of Human Dnajc2, Northeast Structural Genomics Consortium Target Hr8254a Length = 73 Back     alignment and structure
>pdb|4EEF|G Chain G, Crystal Structure Of The Designed Inhibitor Protein F-Hb80.4 In Complex With The 1918 Influenza Virus Hemagglutinin. Length = 74 Back     alignment and structure
>pdb|2CQR|A Chain A, Solution Structure Of Rsgi Ruh-043, A Myb Dna-Binding Domain In Human Cdna Length = 73 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query136
2cjj_A93 Radialis; plant development, DNA-binding protein, 9e-29
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 2e-21
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 2e-19
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 2e-08
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 6e-07
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 3e-05
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 2e-06
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 3e-06
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 1e-05
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 3e-05
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 4e-05
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 7e-05
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 3e-04
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Length = 93 Back     alignment and structure
 Score =   99 bits (249), Expect = 9e-29
 Identities = 27/74 (36%), Positives = 44/74 (59%)

Query: 17 AMTHSTHWNRSEDKLFEHALVMFPEESPDRWQKIASQLPGKSAVEVREHYEALVHDVYEI 76
                 W+  E+K FE AL ++ +++PDRW  +A  + G++  EV++HYE LV D+  I
Sbjct: 4  TRGSGRPWSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYI 63

Query: 77 DSGRVELPSYADDS 90
          +SG+V  P+Y    
Sbjct: 64 ESGKVPFPNYRTTG 77
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Length = 74 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Length = 94 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query136
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.92
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 99.91
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 99.81
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 99.79
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.79
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.73
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.72
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.7
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.69
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.65
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.62
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.6
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.58
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.56
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.55
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.52
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.46
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.46
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.46
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.44
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.43
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.4
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.39
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.39
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.33
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.27
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.2
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 99.18
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.14
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.14
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.7
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.1
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.08
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.05
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.03
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.03
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 98.99
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.93
2crg_A70 Metastasis associated protein MTA3; transcription 98.87
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 98.83
1ign_A 246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 98.83
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.81
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.78
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 98.64
2xag_B 482 REST corepressor 1; amine oxidase, chromatin regul 98.62
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 98.6
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.43
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 98.26
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 98.17
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.11
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.07
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 97.98
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 97.92
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 97.09
2crg_A70 Metastasis associated protein MTA3; transcription 97.83
2y9y_A 374 Imitation switch protein 1 (DEL_ATPase); transcrip 97.66
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 97.58
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 97.51
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 97.42
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 97.42
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 97.3
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 97.25
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.21
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 97.15
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 97.15
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 97.12
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 97.11
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 97.1
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 97.07
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 97.05
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.04
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 97.02
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 96.97
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 96.95
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 96.86
2xb0_X 270 Chromo domain-containing protein 1; hydrolase, DNA 96.7
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 96.42
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 96.29
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 96.21
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 96.08
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 96.0
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 95.72
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 94.66
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 95.65
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 95.63
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 93.92
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 93.78
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 88.78
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 87.55
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
Probab=99.92  E-value=5.7e-25  Score=152.12  Aligned_cols=73  Identities=37%  Similarity=0.776  Sum_probs=61.9

Q ss_pred             CCCCCCCCCCHHHHHHHHHHHhhCCCCCChHHHHHHHhCCCCCHHHHHHHHHHHHHhHhhhccCCccCCCCCC
Q 032677           16 FAMTHSTHWNRSEDKLFEHALVMFPEESPDRWQKIASQLPGKSAVEVREHYEALVHDVYEIDSGRVELPSYAD   88 (136)
Q Consensus        16 ~~~~~~~~WT~eEdk~le~al~~~~~~~~~rW~~IA~~vpgrt~~qv~~ry~~l~~dv~~ie~g~v~~p~~~~   88 (136)
                      ++.++.+.||.|||++|+.||++|+.++++||++||++|||||..||+.||..|++||..||+|.+|+|.|..
T Consensus         3 ~~~~~~~~WT~eEd~~L~~al~~~~~~~~~rW~~IA~~vpGRT~~q~k~ry~~l~~dv~~iesg~vp~P~y~~   75 (93)
T 2cjj_A            3 STRGSGRPWSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYIESGKVPFPNYRT   75 (93)
T ss_dssp             -----CCSCCHHHHHHHHHHHHHSCTTCTTHHHHHHHHSTTCCHHHHHHHHHHHHHHHHHHHHSSCCC-----
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHcCCCCCchHHHHHHHcCCCCHHHHHHHHHHHHHHHHHhhcCCCCCCCCCC
Confidence            4455678899999999999999999999999999999999999999999999999999999999999999964
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 136
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 4e-16
d2cqqa159 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 6e-15
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 1e-09
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 7e-05
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 1e-04
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 1e-04
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 4e-04
d1irza_64 a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis th 0.001
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: Radialis
species: Garden snapdragon (Antirrhinum majus) [TaxId: 4151]

 Score = 65.7 bits (160), Expect = 4e-16
 Identities = 25/58 (43%), Positives = 41/58 (70%)

Query: 24 WNRSEDKLFEHALVMFPEESPDRWQKIASQLPGKSAVEVREHYEALVHDVYEIDSGRV 81
          W+  E+K FE AL ++ +++PDRW  +A  + G++  EV++HYE LV D+  I+SG+V
Sbjct: 4  WSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYIESGKV 61
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query136
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.89
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.79
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.71
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.46
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.46
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.45
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.43
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.41
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.35
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.26
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.26
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.22
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.19
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.06
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.97
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.79
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 98.7
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 97.85
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 97.82
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.7
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 97.64
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 97.59
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 97.51
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 97.42
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 97.35
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 97.34
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.29
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 97.15
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 97.06
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 97.0
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 96.74
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 96.2
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 96.18
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 95.88
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 94.79
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 94.35
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 92.9
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 91.46
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 85.05
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 83.97
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 81.88
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 80.01
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: Radialis
species: Garden snapdragon (Antirrhinum majus) [TaxId: 4151]

Probab=99.89  E-value=1.4e-23  Score=133.73  Aligned_cols=63  Identities=40%  Similarity=0.843  Sum_probs=60.5

Q ss_pred             CCCCCHHHHHHHHHHHhhCCCCCChHHHHHHHhCCCCCHHHHHHHHHHHHHhHhhhccCCccC
Q 032677           21 STHWNRSEDKLFEHALVMFPEESPDRWQKIASQLPGKSAVEVREHYEALVHDVYEIDSGRVEL   83 (136)
Q Consensus        21 ~~~WT~eEdk~le~al~~~~~~~~~rW~~IA~~vpgrt~~qv~~ry~~l~~dv~~ie~g~v~~   83 (136)
                      +++||.|||++|+.||+.|+.+.+++|.+||+.|||||..||++||..|++||+.||+|.|||
T Consensus         1 G~~WT~eEd~~L~~~v~~~~~~~~~~W~~Ia~~l~gRt~~qc~~r~~~L~~dik~iesg~vpf   63 (63)
T d2cjja1           1 GRPWSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYIESGKVPF   63 (63)
T ss_dssp             CCSCCHHHHHHHHHHHHHSCTTCTTHHHHHHHHSTTCCHHHHHHHHHHHHHHHHHHHHSSCCC
T ss_pred             CcCCCHHHHHHHHHHHHHHCCCCchHHHHHHHHcCCCCHHHHHHHHHHHHHHhhccccCCCCC
Confidence            367999999999999999999989999999999999999999999999999999999999986
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure