Citrus Sinensis ID: 032685

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130------
MAATFVTIPAPLFSLKKNNIPSRSNHRLLGWRKQTLTVNAIATKWEPTKVVPQADRVLVRLEQLPEKSAGGILLPKAAVKFERYLMGEILTVGADVGQVNAGKKVLFSDISAYEVDLGADERHCFVKESDLLAVVE
cccccccccccccccccccccccccccccccccEEEEEEEEEEccccEEEEccccEEEEEEcccccEEcccEEEcccccccccccccEEEEEEccccccccccEEEEEcccccEEEEcccEEEEEEEcccEEEEEc
cccEEEEccccccccccccccccccccccHHHcccEEEEEEccccccccEEccccEEEEEEcccccccccEEEEccccccccccccEEEEEEcccccEEccccEEEEEccccEEEEEccccEEEEEEcccEEEEEc
maatfvtipaplfslkknnipsrsnhrllgwrkQTLTVNAIatkweptkvvpqaDRVLVRLeqlpeksaggillpKAAVKFERYLMGEILTVgadvgqvnagkkvlFSDISayevdlgaderhcfvkesdllavve
maatfvtipaplfslkknnipsrsnhrllgwrkQTLTVNaiatkweptkvvpqaDRVLVRLeqlpeksaggillpkAAVKFERYLMGEILTVgadvgqvnaGKKVLFSDISAYEVDLGADERHCFVkesdllavve
MAATFVTIPAPLFSLKKNNIPSRSNHRLLGWRKQTLTVNAIATKWEPTKVVPQADRVLVRLEQLPEKSAGGILLPKAAVKFERYLMGEILTVGADVGQVNAGKKVLFSDISAYEVDLGADERHCFVKESDLLAVVE
****FVTIPAPLFSLKKNNI***SNHRLLGWRKQTLTVNAIATKWEPTKVVPQADRVLVRLEQLPEKSAGGILLPKAAVKFERYLMGEILTVGADVGQVNAGKKVLFSDISAYEVDLGADERHCFVKESDLLA***
********PA**************************TVNAIATKWEPTKVVPQADRVLVRLEQLPEKSAGGILLPKAAVKFERYLMGEILTVGADVGQVNAGKKVLFSDISAYEVDLGADERHCFVKESDLLAVVE
MAATFVTIPAPLFSLKKNNIPSRSNHRLLGWRKQTLTVNAIATKWEPTKVVPQADRVLVRLEQLPEKSAGGILLPKAAVKFERYLMGEILTVGADVGQVNAGKKVLFSDISAYEVDLGADERHCFVKESDLLAVVE
**ATFVTIPAPLFSLKKN*I***SNHRLLGWRKQTLTVNAIATKWEPTKVVPQADRVLVRLEQLPEKSAGGILLPKAAVKFERYLMGEILTVGADVGQVNAGKKVLFSDISAYEVDLGADERHCFVKESDLLAVVE
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAATFVTIPAPLFSLKKNNIPSRSNHRLLGWRKQTLTVNAIATKWEPTKVVPQADRVLVRLEQLPEKSAGGILLPKAAVKFERYLMGEILTVGADVGQVNAGKKVLFSDISAYEVDLGADERHCFVKESDLLAVVE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query136 2.2.26 [Sep-21-2011]
Q2JL42103 10 kDa chaperonin OS=Syne yes no 0.602 0.796 0.425 1e-09
Q2JUN8103 10 kDa chaperonin OS=Syne yes no 0.602 0.796 0.414 2e-09
Q0I7U2103 10 kDa chaperonin OS=Syne yes no 0.625 0.825 0.402 1e-08
Q8L373103 10 kDa chaperonin OS=Cyan yes no 0.632 0.834 0.408 1e-08
A5GNB0103 10 kDa chaperonin OS=Syne yes no 0.625 0.825 0.381 2e-08
Q7TV92103 10 kDa chaperonin OS=Proc yes no 0.625 0.825 0.391 2e-08
A2BYG2103 10 kDa chaperonin OS=Proc yes no 0.625 0.825 0.381 3e-08
Q7TU43103 10 kDa chaperonin OS=Proc yes no 0.625 0.825 0.381 3e-08
A9BCC5103 10 kDa chaperonin OS=Proc yes no 0.625 0.825 0.381 3e-08
Q3AHM3103 10 kDa chaperonin OS=Syne yes no 0.625 0.825 0.391 3e-08
>sp|Q2JL42|CH10_SYNJB 10 kDa chaperonin OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=groS PE=3 SV=1 Back     alignment and function desciption
 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 57/94 (60%), Gaps = 12/94 (12%)

Query: 52  PQADRVLVRLEQLPEKSAGGILLPKAAVKFERYLMGEILTVGA----DVG-----QVNAG 102
           P  DRVLV++ Q  EK+AGGI LP  A   E+  +GE++ VG     D G     ++ AG
Sbjct: 13  PLGDRVLVKIAQQDEKTAGGIFLPDTA--KEKPQVGEVVAVGPGKRNDEGKLIPMELKAG 70

Query: 103 KKVLFSDISAYEVDLGADERHCFVKESDLLAVVE 136
            KVL+S  +  EV LG+DE +  + E D+LA+V+
Sbjct: 71  DKVLYSKYAGTEVKLGSDE-YVLLAERDILAIVQ 103
Binds to Cpn60 in the presence of Mg-ATP and suppresses the ATPase activity of the latter.
Synechococcus sp. (strain JA-2-3B'a(2-13)) (taxid: 321332)
>sp|Q2JUN8|CH10_SYNJA 10 kDa chaperonin OS=Synechococcus sp. (strain JA-3-3Ab) GN=groS PE=3 SV=1 Back     alignment and function description
>sp|Q0I7U2|CH10_SYNS3 10 kDa chaperonin OS=Synechococcus sp. (strain CC9311) GN=groS PE=3 SV=1 Back     alignment and function description
>sp|Q8L373|CH10_CYAP8 10 kDa chaperonin OS=Cyanothece sp. (strain PCC 8801) GN=groS PE=3 SV=2 Back     alignment and function description
>sp|A5GNB0|CH10_SYNPW 10 kDa chaperonin OS=Synechococcus sp. (strain WH7803) GN=groS PE=3 SV=1 Back     alignment and function description
>sp|Q7TV92|CH10_PROMA 10 kDa chaperonin OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=groS PE=3 SV=1 Back     alignment and function description
>sp|A2BYG2|CH10_PROM5 10 kDa chaperonin OS=Prochlorococcus marinus (strain MIT 9515) GN=groS PE=3 SV=1 Back     alignment and function description
>sp|Q7TU43|CH10_PROMP 10 kDa chaperonin OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=groS PE=3 SV=1 Back     alignment and function description
>sp|A9BCC5|CH10_PROM4 10 kDa chaperonin OS=Prochlorococcus marinus (strain MIT 9211) GN=groS PE=3 SV=1 Back     alignment and function description
>sp|Q3AHM3|CH10_SYNSC 10 kDa chaperonin OS=Synechococcus sp. (strain CC9605) GN=groS PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query136
225453275134 PREDICTED: 20 kDa chaperonin, chloroplas 0.985 1.0 0.742 9e-51
255571099137 ATP binding protein, putative [Ricinus c 1.0 0.992 0.686 9e-50
297828179138 CHL-CPN10 [Arabidopsis lyrata subsp. lyr 1.0 0.985 0.695 1e-49
224136510138 predicted protein [Populus trichocarpa] 1.0 0.985 0.681 2e-49
297820880137 hypothetical protein ARALYDRAFT_486490 [ 1.0 0.992 0.656 2e-48
18406593139 chloroplast chaperonin 10 [Arabidopsis t 1.0 0.978 0.697 6e-48
14423466139 Unknown protein [Arabidopsis thaliana] g 1.0 0.978 0.697 7e-48
388498574138 unknown [Lotus japonicus] gi|388502802|g 1.0 0.985 0.652 8e-47
119720758139 CHL-CPN10 [Brassica rapa] 0.992 0.971 0.664 9e-47
118197460139 chloroplast chaperonin 10 [Brassica rapa 0.985 0.964 0.661 2e-46
>gi|225453275|ref|XP_002267346.1| PREDICTED: 20 kDa chaperonin, chloroplastic [Vitis vinifera] gi|297734669|emb|CBI16720.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  204 bits (519), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 115/136 (84%), Gaps = 2/136 (1%)

Query: 1   MAATFVTIPAPLFSLKKNNIPSRSNHRLLGWRKQTLTVNAIATKWEPTKVVPQADRVLVR 60
           MA+TF+T+  P FS  K + PS S  RLLG R   L +NAIA KWEPTKVVPQADRVL+R
Sbjct: 1   MASTFITLARP-FSSHKPHTPSPSK-RLLGLRSSALKINAIAKKWEPTKVVPQADRVLIR 58

Query: 61  LEQLPEKSAGGILLPKAAVKFERYLMGEILTVGADVGQVNAGKKVLFSDISAYEVDLGAD 120
           L+ LPEKS+GG+LLPK+AVKFERYLMGEIL++GADVG+V AGKKVLFSDI+AYEVDLG D
Sbjct: 59  LQDLPEKSSGGVLLPKSAVKFERYLMGEILSIGADVGEVEAGKKVLFSDINAYEVDLGTD 118

Query: 121 ERHCFVKESDLLAVVE 136
            RHCF KESDLLAVVE
Sbjct: 119 GRHCFCKESDLLAVVE 134

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255571099|ref|XP_002526500.1| ATP binding protein, putative [Ricinus communis] gi|223534175|gb|EEF35891.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297828179|ref|XP_002881972.1| CHL-CPN10 [Arabidopsis lyrata subsp. lyrata] gi|297327811|gb|EFH58231.1| CHL-CPN10 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224136510|ref|XP_002326878.1| predicted protein [Populus trichocarpa] gi|118481330|gb|ABK92608.1| unknown [Populus trichocarpa] gi|222835193|gb|EEE73628.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297820880|ref|XP_002878323.1| hypothetical protein ARALYDRAFT_486490 [Arabidopsis lyrata subsp. lyrata] gi|297324161|gb|EFH54582.1| hypothetical protein ARALYDRAFT_486490 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18406593|ref|NP_566022.1| chloroplast chaperonin 10 [Arabidopsis thaliana] gi|3341685|gb|AAC27467.1| expressed protein [Arabidopsis thaliana] gi|14041813|dbj|BAB55457.1| chloroplast chaperonin 10 [Arabidopsis thaliana] gi|330255357|gb|AEC10451.1| chloroplast chaperonin 10 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|14423466|gb|AAK62415.1|AF386970_1 Unknown protein [Arabidopsis thaliana] gi|18377558|gb|AAL66945.1| unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|388498574|gb|AFK37353.1| unknown [Lotus japonicus] gi|388502802|gb|AFK39467.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|119720758|gb|ABL97949.1| CHL-CPN10 [Brassica rapa] Back     alignment and taxonomy information
>gi|118197460|gb|ABK78693.1| chloroplast chaperonin 10 [Brassica rapa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query136
TAIR|locus:2042381139 CHL-CPN10 "chloroplast chapero 1.0 0.978 0.697 1.6e-45
TAIR|locus:2101492138 AT3G60210 [Arabidopsis thalian 1.0 0.985 0.637 5e-44
TAIR|locus:2180454253 CPN20 "chaperonin 20" [Arabido 0.691 0.371 0.333 1.3e-08
FB|FBgn0036334103 CG11267 [Drosophila melanogast 0.632 0.834 0.343 4.2e-08
TIGR_CMR|CBU_171996 CBU_1719 "chaperonin, 10 kDa" 0.625 0.885 0.350 6.8e-08
FB|FBgn0038200102 CG9920 [Drosophila melanogaste 0.632 0.843 0.326 4.8e-07
TIGR_CMR|SPO_088695 SPO_0886 "chaperonin, 10 kDa" 0.602 0.863 0.351 7.8e-07
TIGR_CMR|BA_026694 BA_0266 "chaperonin, 10 kDa" [ 0.588 0.851 0.361 2.1e-06
TIGR_CMR|CPS_095696 CPS_0956 "chaperone protein Gr 0.610 0.864 0.340 2.6e-06
UNIPROTKB|P0A6F997 groS [Escherichia coli K-12 (t 0.602 0.845 0.368 5.5e-06
TAIR|locus:2042381 CHL-CPN10 "chloroplast chaperonin 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 478 (173.3 bits), Expect = 1.6e-45, P = 1.6e-45
 Identities = 97/139 (69%), Positives = 114/139 (82%)

Query:     1 MAATFV-TIPAPLFSLK-KNNIPSRSNHRLLGWRKQTLTVNAIATKWEPTKVVPQADRVL 58
             MA+TFV ++P P F+   K   PS +NH LLG R+  L + AI+TKWEPTKVVPQADRVL
Sbjct:     1 MASTFVCSLPNPFFAFPVKATTPSTANHTLLGSRRGCLRIKAISTKWEPTKVVPQADRVL 60

Query:    59 VRLEQLPEKSAGGILLPKAAVKFERYLMGEILTVGADVGQ-VNAGKKVLFSDISAYEVDL 117
             VRLE LP KS+GG+LLPKAAVKFERYL GEI++VG++VGQ V  GK+VLFSD+SAYEVDL
Sbjct:    61 VRLEDLPIKSSGGVLLPKAAVKFERYLTGEIISVGSEVGQQVGPGKRVLFSDVSAYEVDL 120

Query:   118 GADERHCFVKESDLLAVVE 136
             G D RHCF KESDLLA+VE
Sbjct:   121 GTDARHCFCKESDLLALVE 139
GO:0005737 "cytoplasm" evidence=IEA
GO:0006457 "protein folding" evidence=IEA;IDA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0051087 "chaperone binding" evidence=ISS
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0006569 "tryptophan catabolic process" evidence=RCA
GO:0009684 "indoleacetic acid biosynthetic process" evidence=RCA
TAIR|locus:2101492 AT3G60210 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180454 CPN20 "chaperonin 20" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0036334 CG11267 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_1719 CBU_1719 "chaperonin, 10 kDa" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
FB|FBgn0038200 CG9920 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_0886 SPO_0886 "chaperonin, 10 kDa" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|BA_0266 BA_0266 "chaperonin, 10 kDa" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_0956 CPS_0956 "chaperone protein GroES" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|P0A6F9 groS [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query136
cd0032093 cd00320, cpn10, Chaperonin 10 Kd subunit (cpn10 or 5e-21
smart0088393 smart00883, Cpn10, Chaperonin 10 Kd subunit 3e-18
pfam0016691 pfam00166, Cpn10, Chaperonin 10 Kd subunit 1e-16
PRK0036495 PRK00364, groES, co-chaperonin GroES; Reviewed 9e-14
COG023496 COG0234, GroS, Co-chaperonin GroES (HSP10) [Posttr 2e-13
PRK1453391 PRK14533, groES, co-chaperonin GroES; Provisional 4e-07
>gnl|CDD|238197 cd00320, cpn10, Chaperonin 10 Kd subunit (cpn10 or GroES); Cpn10 cooperates with chaperonin 60 (cpn60 or GroEL), an ATPase, to assist the folding and assembly of proteins and is found in eubacterial cytosol, as well as in the matrix of mitochondria and chloroplasts Back     alignment and domain information 
 Score = 80.6 bits (200), Expect = 5e-21
 Identities = 35/96 (36%), Positives = 51/96 (53%), Gaps = 12/96 (12%)

Query: 49  KVVPQADRVLVRLEQLPEKSAGGILLPKAAVKFERYLMGEILTVGADV---------GQV 99
           K+ P  DRVLV+  +  EK+ GGI+LP +A   E+   G+++ VG              V
Sbjct: 1   KIKPLGDRVLVKRIEAEEKTKGGIILPDSAK--EKPQEGKVVAVGPGRRNENGERVPLSV 58

Query: 100 NAGKKVLFSDISAYEVDLGADERHCFVKESDLLAVV 135
             G KVLF   +  EV L   E +  ++ESD+LAV+
Sbjct: 59  KVGDKVLFPKYAGTEVKLD-GEEYLILRESDILAVI 93

It forms heptameric rings with a dome-like structure, forming a lid to the large cavity of the tetradecameric cpn60 cylinder and thereby tightly regulating release and binding of proteins to the cpn60 surface. Length = 93
>gnl|CDD|197951 smart00883, Cpn10, Chaperonin 10 Kd subunit Back     alignment and domain information
>gnl|CDD|201050 pfam00166, Cpn10, Chaperonin 10 Kd subunit Back     alignment and domain information
>gnl|CDD|178988 PRK00364, groES, co-chaperonin GroES; Reviewed Back     alignment and domain information
>gnl|CDD|223312 COG0234, GroS, Co-chaperonin GroES (HSP10) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184730 PRK14533, groES, co-chaperonin GroES; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 136
COG023496 GroS Co-chaperonin GroES (HSP10) [Posttranslationa 100.0
PRK1453391 groES co-chaperonin GroES; Provisional 100.0
PTZ00414100 10 kDa heat shock protein; Provisional 100.0
PRK0036495 groES co-chaperonin GroES; Reviewed 99.98
cd0032093 cpn10 Chaperonin 10 Kd subunit (cpn10 or GroES); C 99.97
PF0016693 Cpn10: Chaperonin 10 Kd subunit; InterPro: IPR0208 99.96
KOG1641104 consensus Mitochondrial chaperonin [Posttranslatio 99.95
PF08240109 ADH_N: Alcohol dehydrogenase GroES-like domain; In 93.27
KOG1197 336 consensus Predicted quinone oxidoreductase [Energy 91.99
TIGR03366 280 HpnZ_proposed putative phosphonate catabolism asso 89.3
COG1062 366 AdhC Zn-dependent alcohol dehydrogenases, class II 88.47
COG0604 326 Qor NADPH:quinone reductase and related Zn-depende 87.73
KOG0025 354 consensus Zn2+-binding dehydrogenase (nuclear rece 84.62
TIGR02819 393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 84.14
KOG0022 375 consensus Alcohol dehydrogenase, class III [Second 83.4
cd08230 355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 80.55
TIGR01202 308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 80.31
>COG0234 GroS Co-chaperonin GroES (HSP10) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=6.1e-34  Score=204.85  Aligned_cols=86  Identities=43%  Similarity=0.675  Sum_probs=81.5

Q ss_pred             ceeeccCCeEEEEEecCCCcccceEEeccCccccccceeeEEEEEcCC----CC-----cccCCCEEEecCCCceEEEeC
Q 032685           48 TKVVPQADRVLVRLEQLPEKSAGGILLPKAAVKFERYLMGEILTVGAD----VG-----QVNAGKKVLFSDISAYEVDLG  118 (136)
Q Consensus        48 ~~l~PLgDRVLVk~~e~e~~T~gGIiLP~sa~~~ek~~~G~VVAVG~g----~g-----~VkvGD~Vlf~~y~G~ev~~~  118 (136)
                      |+|+||||||||++.+.|++|+|||+||++++  +|++.|+|+|||+|    +|     +||+||+|+|++|+|+++++|
T Consensus         1 m~ikPL~DRVlVk~~e~EekT~gGIvlpdsak--eK~~~g~VvAVG~G~~~~~g~~~~~~VkvGD~Vlf~ky~G~evk~d   78 (96)
T COG0234           1 MKIKPLGDRVLVKRVEEEEKTAGGIVLPDSAK--EKPQEGEVVAVGPGRRDENGELVPLDVKVGDRVLFGKYAGTEVKID   78 (96)
T ss_pred             CCceecCCEEEEEEchhhccccCcEEecCccc--cCCcceEEEEEccceecCCCCEeccccccCCEEEECccCCcEEEEC
Confidence            68999999999999999999999999999998  89999999999996    23     699999999999999999998


Q ss_pred             CCeeEEEEecCcEEEEeC
Q 032685          119 ADERHCFVKESDLLAVVE  136 (136)
Q Consensus       119 ~ge~y~ivre~DILAvle  136 (136)
                       |++|++++++||||+++
T Consensus        79 -geeylil~e~DILAiv~   95 (96)
T COG0234          79 -GEEYLILSESDILAIVE   95 (96)
T ss_pred             -CEEEEEechHHeeEEec
Confidence             89999999999999986

>PRK14533 groES co-chaperonin GroES; Provisional Back     alignment and domain information
>PTZ00414 10 kDa heat shock protein; Provisional Back     alignment and domain information
>PRK00364 groES co-chaperonin GroES; Reviewed Back     alignment and domain information
>cd00320 cpn10 Chaperonin 10 Kd subunit (cpn10 or GroES); Cpn10 cooperates with chaperonin 60 (cpn60 or GroEL), an ATPase, to assist the folding and assembly of proteins and is found in eubacterial cytosol, as well as in the matrix of mitochondria and chloroplasts Back     alignment and domain information
>PF00166 Cpn10: Chaperonin 10 Kd subunit; InterPro: IPR020818 The chaperonins are `helper' molecules required for correct folding and subsequent assembly of some proteins [] Back     alignment and domain information
>KOG1641 consensus Mitochondrial chaperonin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08240 ADH_N: Alcohol dehydrogenase GroES-like domain; InterPro: IPR013154 This is the catalytic domain of alcohol dehydrogenases (1 Back     alignment and domain information
>KOG1197 consensus Predicted quinone oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>KOG0025 consensus Zn2+-binding dehydrogenase (nuclear receptor binding factor-1) [Transcription; Energy production and conversion] Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query136
1aon_O97 Crystal Structure Of The Asymmetric Chaperonin Comp 7e-05
1we3_O100 Crystal Structure Of The Chaperonin Complex Cpn60CP 2e-04
1wnr_A94 Crystal Structure Of The Cpn10 From Thermus Thermop 4e-04
>pdb|1AON|O Chain O, Crystal Structure Of The Asymmetric Chaperonin Complex GroelGROES(ADP)7 Length = 97 Back     alignment and structure 
Iteration: 1

 Score = 42.4 bits (98), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 52/95 (54%), Gaps = 13/95 (13%)
Query: 52  PQADRVLVRLEQLPEKSAGGILLP-KAAVKFERYLMGEILTVGA----DVGQ-----VNA 101
           P  DRV+V+ +++  KSAGGI+L   AA K  R   GE+L VG     + G+     V  
Sbjct: 5   PLHDRVIVKRKEVETKSAGGIVLTGSAAAKSTR---GEVLAVGNGRILENGEVKPLDVKV 61
Query: 102 GKKVLFSDISAYEVDLGADERHCFVKESDLLAVVE 136
           G  V+F+D    + +   +E    + ESD+LA+VE
Sbjct: 62  GDIVIFNDGYGVKSEKIDNEEVLIMSESDILAIVE 96
>pdb|1WE3|O Chain O, Crystal Structure Of The Chaperonin Complex Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS Length = 100 Back     alignment and structure
>pdb|1WNR|A Chain A, Crystal Structure Of The Cpn10 From Thermus Thermophilus Hb8 Length = 94 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query136
1we3_O100 CPN10(groes); chaperonin, chaperone, groel, HSP60, 8e-14
1p3h_A99 10 kDa chaperonin; beta barrel, acidic cluster, fl 2e-13
1pcq_O97 Groes protein; chaperone; HET: ADP; 2.81A {Escheri 2e-13
3nx6_A95 10KDA chaperonin; bacterial blight, XOO4289, groes 4e-13
>1we3_O CPN10(groes); chaperonin, chaperone, groel, HSP60, HSP10, folding, ADP, ATP; HET: ADP; 2.80A {Thermus thermophilus} SCOP: b.35.1.1 PDB: 1wf4_o* 1wnr_A Length = 100 Back     alignment and structure
 Score = 61.8 bits (151), Expect = 8e-14
 Identities = 30/97 (30%), Positives = 51/97 (52%), Gaps = 12/97 (12%)

Query: 49  KVVPQADRVLVRLEQLPEKSAGGILLPKAAVKFERYLMGEILTVGA----DVGQ-----V 99
            + P  DRV+V+  +   K+ GGI+LP  A   E+   G+++ VG     + GQ     V
Sbjct: 7   VIKPLGDRVVVKRIEEEPKTKGGIVLPDTAK--EKPQKGKVIAVGTGRVLENGQRVPLEV 64

Query: 100 NAGKKVLFSDISAYEVDLGADERHCFVKESDLLAVVE 136
             G  V+F+     E+++  +E +  + E DLLAV++
Sbjct: 65  KEGDIVVFAKYGGTEIEIDGEE-YVILSERDLLAVLQ 100
>1p3h_A 10 kDa chaperonin; beta barrel, acidic cluster, flexible loop, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: b.35.1.1 PDB: 1hx5_A 1lep_A 1p82_A 1p83_A Length = 99 Back     alignment and structure
>1pcq_O Groes protein; chaperone; HET: ADP; 2.81A {Escherichia coli} SCOP: b.35.1.1 PDB: 1gru_O 1aon_O* 1pf9_O* 1svt_O* 1sx4_O* 2c7c_O 2c7d_O Length = 97 Back     alignment and structure
>3nx6_A 10KDA chaperonin; bacterial blight, XOO4289, groes, xanthomonas oryzae PV. ORY KACC10331, chaperone; 1.97A {Xanthomonas oryzae PV} Length = 95 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query136
3nx6_A95 10KDA chaperonin; bacterial blight, XOO4289, groes 100.0
1p3h_A99 10 kDa chaperonin; beta barrel, acidic cluster, fl 100.0
1we3_O100 CPN10(groes); chaperonin, chaperone, groel, HSP60, 100.0
1pcq_O97 Groes protein; chaperone; HET: ADP; 2.81A {Escheri 100.0
1g31_A111 GP31; chaperone, CO-chaperonin, groes, in VIVO pro 99.92
3goh_A 315 Alcohol dehydrogenase, zinc-containing; NP_718042. 92.87
1gu7_A 364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 92.63
3qwb_A 334 Probable quinone oxidoreductase; rossmann fold, qu 92.42
1wly_A 333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 92.31
4a0s_A 447 Octenoyl-COA reductase/carboxylase; oxidoreductase 92.11
3jyn_A 325 Quinone oxidoreductase; rossmann fold, protein-NAD 92.01
3m6i_A 363 L-arabinitol 4-dehydrogenase; medium chain dehydro 91.92
2c0c_A 362 Zinc binding alcohol dehydrogenase, domain contain 91.62
3uko_A 378 Alcohol dehydrogenase class-3; alcohol dehydrogena 91.62
2vn8_A 375 Reticulon-4-interacting protein 1; mitochondrion, 91.08
2eih_A 343 Alcohol dehydrogenase; zinc ION binding protein, s 91.0
1qor_A 327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 90.79
2j8z_A 354 Quinone oxidoreductase; medium-chain dehydrogenase 90.78
1yb5_A 351 Quinone oxidoreductase; medium-chain dehydrogenase 90.62
3fbg_A 346 Putative arginate lyase; structural genomics, unkn 90.54
4ej6_A 370 Putative zinc-binding dehydrogenase; structural ge 90.02
1zsy_A 357 Mitochondrial 2-enoyl thioester reductase; medium- 89.92
4dup_A 353 Quinone oxidoreductase; PSI-biology, structural ge 89.86
3gms_A 340 Putative NADPH:quinone reductase; structural genom 89.64
2h6e_A 344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 89.01
3pi7_A 349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 88.86
3iup_A 379 Putative NADPH:quinone oxidoreductase; YP_296108.1 88.85
3gaz_A 343 Alcohol dehydrogenase superfamily protein; oxidore 88.28
4a27_A 349 Synaptic vesicle membrane protein VAT-1 homolog-L; 88.28
2dq4_A 343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 88.15
3two_A 348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 88.13
4eez_A 348 Alcohol dehydrogenase 1; site-saturation mutagenes 88.12
4eye_A 342 Probable oxidoreductase; structural genomics, niai 87.82
2d8a_A 348 PH0655, probable L-threonine 3-dehydrogenase; pyro 87.75
1f8f_A 371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 87.65
3jv7_A 345 ADH-A; dehydrogenase, nucleotide binding, rossmann 87.57
1cdo_A 374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 87.52
2cf5_A 357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 87.46
1yqd_A 366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 87.42
2fzw_A 373 Alcohol dehydrogenase class III CHI chain; S-nitro 87.41
1pl8_A 356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 87.28
2jhf_A 374 Alcohol dehydrogenase E chain; oxidoreductase, met 87.22
1p0f_A 373 NADP-dependent alcohol dehydrogenase; ADH topology 87.17
1e3i_A 376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 87.08
3fpc_A 352 NADP-dependent alcohol dehydrogenase; oxydoreducta 87.06
2hcy_A 347 Alcohol dehydrogenase 1; tetramer of asymmetric di 87.04
3s2e_A 340 Zinc-containing alcohol dehydrogenase superfamily; 86.96
3uog_A 363 Alcohol dehydrogenase; structural genomics, protei 86.9
4dvj_A 363 Putative zinc-dependent alcohol dehydrogenase Pro; 86.82
1e3j_A 352 NADP(H)-dependent ketose reductase; oxidoreductase 86.82
3tqh_A 321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 86.69
1rjw_A 339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 86.59
1uuf_A 369 YAHK, zinc-type alcohol dehydrogenase-like protein 86.52
1kol_A 398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 86.48
1piw_A 360 Hypothetical zinc-type alcohol dehydrogenase- like 86.43
2dph_A 398 Formaldehyde dismutase; dismutation of aldehydes, 86.28
1jvb_A 347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 86.25
3krt_A 456 Crotonyl COA reductase; structural genomics, prote 85.95
1h2b_A 359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 85.31
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 84.97
3ip1_A 404 Alcohol dehydrogenase, zinc-containing; structural 84.42
3gqv_A 371 Enoyl reductase; medium-chain reductase (MDR super 82.53
4a2c_A 346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 81.7
2b5w_A 357 Glucose dehydrogenase; nucleotide binding motif, o 80.59
>3nx6_A 10KDA chaperonin; bacterial blight, XOO4289, groes, xanthomonas oryzae PV. ORY KACC10331, chaperone; 1.97A {Xanthomonas oryzae PV} SCOP: b.35.1.0 Back     alignment and structure
Probab=100.00  E-value=5.1e-35  Score=209.18  Aligned_cols=86  Identities=33%  Similarity=0.534  Sum_probs=62.9

Q ss_pred             ceeeccCCeEEEEEecCCCcccceEEeccCccccccceeeEEEEEcCCC----C-----cccCCCEEEecCCCceEEEeC
Q 032685           48 TKVVPQADRVLVRLEQLPEKSAGGILLPKAAVKFERYLMGEILTVGADV----G-----QVNAGKKVLFSDISAYEVDLG  118 (136)
Q Consensus        48 ~~l~PLgDRVLVk~~e~e~~T~gGIiLP~sa~~~ek~~~G~VVAVG~g~----g-----~VkvGD~Vlf~~y~G~ev~~~  118 (136)
                      |+|+||+|||||++.++|++|+|||+||++++  +|+++|+|+|||||.    |     +||+||+|+|++|+|++|+++
T Consensus         1 m~i~PL~DRVlVk~~e~e~kT~gGI~LP~~a~--eK~~~G~VvAVG~G~~~~~G~~~p~~VkvGD~Vl~~ky~Gtevk~d   78 (95)
T 3nx6_A            1 MSIKPLHDRVVVKPIEADEVSAGGIVIPDSAK--EKSTKGEVVAIGAGKPLDNGSLHAPVVKVGDKVIYGQYAGSSYKSE   78 (95)
T ss_dssp             -CCCCCTTEEEEEEC---------------------CEEEEEEEECSCEECTTSCEECCSCCTTCEEEECTTCSEEEEET
T ss_pred             CCeEEcCCEEEEEEccccccccceEEeCcccc--CCccccEEEEECCCeECCCCCEEccccCCCCEEEECCcCCeEEEEC
Confidence            68999999999999999999999999999997  789999999999973    3     699999999999999999998


Q ss_pred             CCeeEEEEecCcEEEEeC
Q 032685          119 ADERHCFVKESDLLAVVE  136 (136)
Q Consensus       119 ~ge~y~ivre~DILAvle  136 (136)
                       |++|+++|++||||++|
T Consensus        79 -g~ey~i~re~DILavie   95 (95)
T 3nx6_A           79 -GVEYKVLREDDILAVIG   95 (95)
T ss_dssp             -TEEEEEEEGGGEEEECC
T ss_pred             -CEEEEEEEHHHEEEEeC
Confidence             89999999999999987
>1p3h_A 10 kDa chaperonin; beta barrel, acidic cluster, flexible loop, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: b.35.1.1 PDB: 1hx5_A 1lep_A 1p82_A 1p83_A Back     alignment and structure
>1we3_O CPN10(groes); chaperonin, chaperone, groel, HSP60, HSP10, folding, ADP, ATP; HET: ADP; 2.80A {Thermus thermophilus} SCOP: b.35.1.1 PDB: 1wf4_o* 1wnr_A Back     alignment and structure
>1pcq_O Groes protein; chaperone; HET: ADP; 2.81A {Escherichia coli} SCOP: b.35.1.1 PDB: 1gru_O 1aon_O* 1pf9_O* 1svt_O* 1sx4_O* 2c7c_O 2c7d_O Back     alignment and structure
>1g31_A GP31; chaperone, CO-chaperonin, groes, in VIVO protein folding, bacteriophage T4; 2.30A {Enterobacteria phage T4} SCOP: b.35.1.1 PDB: 2cgt_O Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 136
d1aono_97 b.35.1.1 (O:) Chaperonin-10 (GroES) {Escherichia c 2e-17
d1we3o_96 b.35.1.1 (O:) Chaperonin-10 (GroES) {Thermus therm 3e-14
d1p3ha_99 b.35.1.1 (A:) Chaperonin-10 (GroES) {Mycobacterium 8e-14
>d1aono_ b.35.1.1 (O:) Chaperonin-10 (GroES) {Escherichia coli [TaxId: 562]} Length = 97 Back     information, alignment and structure

class: All beta proteins
fold: GroES-like
superfamily: GroES-like
family: GroES
domain: Chaperonin-10 (GroES)
species: Escherichia coli [TaxId: 562]

 Score = 70.2 bits (172), Expect = 2e-17
 Identities = 31/97 (31%), Positives = 48/97 (49%), Gaps = 11/97 (11%)

Query: 49  KVVPQADRVLVRLEQLPEKSAGGILLPKAAVKFERYLMGEILTVGADV---------GQV 99
            + P  DRV+V+ +++  KSAGGI+L  +A        GE+L VG              V
Sbjct: 2   NIRPLHDRVIVKRKEVETKSAGGIVLTGSAAAKSTR--GEVLAVGNGRILENGEVKPLDV 59

Query: 100 NAGKKVLFSDISAYEVDLGADERHCFVKESDLLAVVE 136
             G  V+F+D    + +   +E    + ESD+LA+VE
Sbjct: 60  KVGDIVIFNDGYGVKSEKIDNEEVLIMSESDILAIVE 96
>d1we3o_ b.35.1.1 (O:) Chaperonin-10 (GroES) {Thermus thermophilus [TaxId: 274]} Length = 96 Back     information, alignment and structure
>d1p3ha_ b.35.1.1 (A:) Chaperonin-10 (GroES) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 99 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query136
d1p3ha_99 Chaperonin-10 (GroES) {Mycobacterium tuberculosis 99.97
d1aono_97 Chaperonin-10 (GroES) {Escherichia coli [TaxId: 56 99.96
d1we3o_96 Chaperonin-10 (GroES) {Thermus thermophilus [TaxId 99.96
d1g31a_107 GP31 co-chaperonin {Bacteriophage T4 [TaxId: 10665 97.96
d1yb5a1150 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 94.76
d1qora1147 Quinone oxidoreductase {Escherichia coli [TaxId: 5 94.07
d1e3ja1178 Ketose reductase (sorbitol dehydrogenase) {Silverl 92.45
d1f8fa1194 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 92.36
d1jqba1177 Bacterial secondary alcohol dehydrogenase {Clostri 92.21
d1kola1201 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 91.56
d1llua1175 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 90.92
d1pl8a1185 Ketose reductase (sorbitol dehydrogenase) {Human ( 90.38
d1uufa1179 Hypothetical protein YahK {Escherichia coli [TaxId 89.95
d2jhfa1198 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 89.79
d1p0fa1198 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 89.76
d1h2ba1171 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 89.43
d1rjwa1171 Alcohol dehydrogenase {Bacillus stearothermophilus 89.21
d1cdoa1199 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 87.75
d1e3ia1202 Alcohol dehydrogenase {Mouse (Mus musculus), class 87.03
d1jvba1177 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 86.73
d1piwa1192 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 82.81
d2fzwa1197 Alcohol dehydrogenase {Human (Homo sapiens), diffe 80.2
>d1p3ha_ b.35.1.1 (A:) Chaperonin-10 (GroES) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: All beta proteins
fold: GroES-like
superfamily: GroES-like
family: GroES
domain: Chaperonin-10 (GroES)
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=99.97  E-value=3.6e-31  Score=186.82  Aligned_cols=86  Identities=28%  Similarity=0.527  Sum_probs=81.1

Q ss_pred             ceeeccCCeEEEEEecCCCcccceEEeccCccccccceeeEEEEEcCCC----C------cccCCCEEEecCCCceEEEe
Q 032685           48 TKVVPQADRVLVRLEQLPEKSAGGILLPKAAVKFERYLMGEILTVGADV----G------QVNAGKKVLFSDISAYEVDL  117 (136)
Q Consensus        48 ~~l~PLgDRVLVk~~e~e~~T~gGIiLP~sa~~~ek~~~G~VVAVG~g~----g------~VkvGD~Vlf~~y~G~ev~~  117 (136)
                      |+|+||+|||||++.+.+++|+|||+||++++  +++..|+|+|||+|.    +      .||+||+|+|++|+|++|++
T Consensus         3 m~ikPlgdrVLVk~~~~~~kT~gGIiLp~~~~--~~~~~G~VvavG~g~~~~~~~~~~~~~vk~GD~Vl~~~~~g~~v~~   80 (99)
T d1p3ha_           3 VNIKPLEDKILVQANEAETTTASGLVIPDTAK--EKPQEGTVVAVGPGRWDEDGEKRIPLDVAEGDTVIYSKYGGTEIKY   80 (99)
T ss_dssp             CEEEECTTEEEEEECCCCCBCTTSCBCCCSSC--CSEEEEEEEEECCCEECSSSSCEECCSCCTTCEEEEECTTCEEEEE
T ss_pred             ccceEcCCEEEEEEcchhcccccceEeccccc--cCceEEEEEEECCceEcCCCCEecCCeeecCCEEEEcccCceEEEE
Confidence            79999999999999999999999999999987  789999999999983    1      59999999999999999999


Q ss_pred             CCCeeEEEEecCcEEEEeC
Q 032685          118 GADERHCFVKESDLLAVVE  136 (136)
Q Consensus       118 ~~ge~y~ivre~DILAvle  136 (136)
                      + |++|++++++||+|++|
T Consensus        81 d-g~~y~ii~e~dIlavi~   98 (99)
T d1p3ha_          81 N-GEEYLILSARDVLAVVS   98 (99)
T ss_dssp             T-TEEEEEEEGGGEEEEEE
T ss_pred             C-CEEEEEEEHHHEEEEEe
Confidence            8 89999999999999985
>d1aono_ b.35.1.1 (O:) Chaperonin-10 (GroES) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1we3o_ b.35.1.1 (O:) Chaperonin-10 (GroES) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g31a_ b.35.1.1 (A:) GP31 co-chaperonin {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1yb5a1 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qora1 b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1jqba1 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1llua1 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uufa1 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jhfa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1p0fa1 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1h2ba1 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1rjwa1 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1e3ia1 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1jvba1 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1piwa1 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fzwa1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure