Citrus Sinensis ID: 032840

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
MVLSKRYLFFSVLHLLLLTDTALCIRFPDRVSTSINDELGRPLKAAVFALGSFWRSEAVFGCLNGVVRTTVGYAGGSKTNPEFRNLGDHAESVQVEYDPRVINFRQLLEVFWTSHDCRQVFGQGPDVGNQYR
ccccHHHHHHHHHHHHHccccccccccccccccccccccccccEEEEEccccHHHHHHHHcccccEEEEccccccccccccccccccccEEEEEEEEccccccHHHHHHHHHcccccccccccccccccccc
ccHHHHHHHcccccccccHHHHccccccccccccccccccccHHHEEEEEccHHHHHHHHcccccEEEEEEEEEcccccccccccccccEEEEEEEEccccccHHHHHHHHHHHcccccccEEccEEcHHHc
mvlskrylFFSVLHLLLLTDtalcirfpdrvstsindelGRPLKAAVFALGSFWRSEAVFGCLNGVVRTtvgyaggsktnpefrnlgdhaesvqveydprvINFRQLLEVFWTshdcrqvfgqgpdvgnqyr
MVLSKRYLFFSVLHLLLLTDTALCIRFPDRVSTSINDELGRPLKAAVFALGSFWRSEAVFGCLNGVVRTTVGYAGGSKTNPEFRNLGDHAESVQVEYDPRVINFRQLLEVFWTSHDcrqvfgqgpdvgnqyr
MVLSKRYlffsvlhlllltdtalCIRFPDRVSTSINDELGRPLKAAVFALGSFWRSEAVFGCLNGVVRTTVGYAGGSKTNPEFRNLGDHAESVQVEYDPRVINFRQLLEVFWTSHDCRQVFGQGPDVGNQYR
****KRYLFFSVLHLLLLTDTALCIRFPDRVSTSINDELGRPLKAAVFALGSFWRSEAVFGCLNGVVRTTVGYAGGSKTNPEFRNLGDHAESVQVEYDPRVINFRQLLEVFWTSHDCRQVFG**********
**********S**HLL**************************LKAAVFALGSFWRSEAVFGCLNGVVRTTVGYAGGSKTNPEFRNLGDHAESVQVEYDPRVINFRQLLEVFWTSHDCRQVFGQGP*****Y*
MVLSKRYLFFSVLHLLLLTDTALCIRFPDRVSTSINDELGRPLKAAVFALGSFWRSEAVFGCLNGVVRTTVGYAGGSKTNPEFRNLGDHAESVQVEYDPRVINFRQLLEVFWTSHDCRQVFGQGPDVGNQYR
*V*SKRY**********LTD*ALCIRFPDRVSTSINDELGRPLKAAVFALGSFWRSEAVFGCLNGVVRTTVGYAGGSKTNPEFRNLGDHAESVQVEYDPRVINFRQLLEVFWTSHDCRQVFGQGPDVGN*YR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLSKRYLFFSVLHLLLLTDTALCIRFPDRVSTSINDELGRPLKAAVFALGSFWRSEAVFGCLNGVVRTTVGYAGGSKTNPEFRNLGDHAESVQVEYDPRVINFRQLLEVFWTSHDCRQVFGQGPDVGNQYR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query132 2.2.26 [Sep-21-2011]
Q9SL43 254 Peptide methionine sulfox no no 0.931 0.484 0.698 3e-49
Q5VPG8 254 Peptide methionine sulfox yes no 0.643 0.334 0.8 3e-38
P08761 246 Peptide methionine sulfox yes no 0.621 0.333 0.453 2e-19
A7MM56212 Peptide methionine sulfox yes no 0.681 0.424 0.489 2e-19
B2TZL3212 Peptide methionine sulfox yes no 0.681 0.424 0.489 3e-19
B7UQN3212 Peptide methionine sulfox yes no 0.681 0.424 0.489 5e-19
B5Z3H5212 Peptide methionine sulfox yes no 0.681 0.424 0.489 5e-19
Q8XCG3212 Peptide methionine sulfox N/A no 0.681 0.424 0.489 5e-19
B6I2D2212 Peptide methionine sulfox yes no 0.681 0.424 0.489 7e-19
Q31TF9212 Peptide methionine sulfox yes no 0.681 0.424 0.489 9e-19
>sp|Q9SL43|MSRA5_ARATH Peptide methionine sulfoxide reductase A5 OS=Arabidopsis thaliana GN=MSRA5 PE=2 SV=1 Back     alignment and function desciption
 Score =  193 bits (491), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 88/126 (69%), Positives = 105/126 (83%), Gaps = 3/126 (2%)

Query: 7   YLFFSVLHLLLLTDTALCIRFPDRVSTSINDELGRPLKAAVFALGSFWRSEAVFGCLNGV 66
           + FF  + LL   D  + IR  +++S ++ D   RPLK+AVFALGSFWRSEA FGC+NGV
Sbjct: 19  FFFFLCVSLL---DKTVSIRISNQISDTVVDSPDRPLKSAVFALGSFWRSEAAFGCINGV 75

Query: 67  VRTTVGYAGGSKTNPEFRNLGDHAESVQVEYDPRVINFRQLLEVFWTSHDCRQVFGQGPD 126
           VRT+ GYAGG+KTNPE+RNLGDHAESVQVEYDPR+I +RQLL+VFW+SHD RQVFGQGPD
Sbjct: 76  VRTSAGYAGGTKTNPEYRNLGDHAESVQVEYDPRIIGYRQLLDVFWSSHDSRQVFGQGPD 135

Query: 127 VGNQYR 132
           VGNQYR
Sbjct: 136 VGNQYR 141
Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins. Plays a protective role against oxidative stress by restoring activity to proteins that have been inactivated by methionine oxidation. MSRA family specifically reduces the MetSO S-enantiomer.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 8EC: .EC: 4EC: .EC: 1EC: 1
>sp|Q5VPG8|MSRA5_ORYSJ Peptide methionine sulfoxide reductase A5 OS=Oryza sativa subsp. japonica GN=MSRA5 PE=2 SV=1 Back     alignment and function description
>sp|P08761|MSRA_DROME Peptide methionine sulfoxide reductase OS=Drosophila melanogaster GN=Eip71CD PE=2 SV=2 Back     alignment and function description
>sp|A7MM56|MSRA_CROS8 Peptide methionine sulfoxide reductase MsrA OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=msrA PE=3 SV=1 Back     alignment and function description
>sp|B2TZL3|MSRA_SHIB3 Peptide methionine sulfoxide reductase MsrA OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=msrA PE=3 SV=1 Back     alignment and function description
>sp|B7UQN3|MSRA_ECO27 Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=msrA PE=3 SV=1 Back     alignment and function description
>sp|B5Z3H5|MSRA_ECO5E Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=msrA PE=3 SV=1 Back     alignment and function description
>sp|Q8XCG3|MSRA_ECO57 Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli O157:H7 GN=msrA PE=3 SV=3 Back     alignment and function description
>sp|B6I2D2|MSRA_ECOSE Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli (strain SE11) GN=msrA PE=3 SV=1 Back     alignment and function description
>sp|Q31TF9|MSRA_SHIBS Peptide methionine sulfoxide reductase MsrA OS=Shigella boydii serotype 4 (strain Sb227) GN=msrA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query132
297832444 254 peptide methionine sulfoxide reductase f 0.931 0.484 0.730 6e-50
225431171 252 PREDICTED: peptide methionine sulfoxide 0.946 0.496 0.72 1e-49
344227187 252 methionine sulfoxide reductase A5 [Solan 1.0 0.523 0.690 2e-49
356502124 250 PREDICTED: peptide methionine sulfoxide 0.954 0.504 0.732 4e-48
42570819192 peptide methionine sulfoxide reductase A 0.931 0.640 0.698 2e-47
15227955 254 peptide methionine sulfoxide reductase A 0.931 0.484 0.698 2e-47
356559314 250 PREDICTED: peptide methionine sulfoxide 0.931 0.492 0.722 5e-46
449434176 252 PREDICTED: peptide methionine sulfoxide 0.924 0.484 0.706 1e-45
255579821 253 methionine sulfoxide reductase, putative 0.856 0.446 0.756 4e-45
118489617 252 unknown [Populus trichocarpa x Populus d 0.871 0.456 0.767 1e-44
>gi|297832444|ref|XP_002884104.1| peptide methionine sulfoxide reductase family protein [Arabidopsis lyrata subsp. lyrata] gi|297329944|gb|EFH60363.1| peptide methionine sulfoxide reductase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
 Score =  201 bits (512), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 107/126 (84%), Gaps = 3/126 (2%)

Query: 7   YLFFSVLHLLLLTDTALCIRFPDRVSTSINDELGRPLKAAVFALGSFWRSEAVFGCLNGV 66
           + FF  + LL   D A+CIR  +++S +I D   RPLK+AVFALGSFWRSEA FGC+NGV
Sbjct: 19  FFFFLCISLL---DKAVCIRISNQISDTIVDSPDRPLKSAVFALGSFWRSEAAFGCINGV 75

Query: 67  VRTTVGYAGGSKTNPEFRNLGDHAESVQVEYDPRVINFRQLLEVFWTSHDCRQVFGQGPD 126
           VRTT GYAGG+KTNPE+RNLGDHAESVQVEYDPR+I +RQLL+VFW+SHD RQVFGQGPD
Sbjct: 76  VRTTAGYAGGTKTNPEYRNLGDHAESVQVEYDPRIIGYRQLLDVFWSSHDSRQVFGQGPD 135

Query: 127 VGNQYR 132
           VGNQYR
Sbjct: 136 VGNQYR 141

Source: Arabidopsis lyrata subsp. lyrata

Species: Arabidopsis lyrata

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225431171|ref|XP_002269473.1| PREDICTED: peptide methionine sulfoxide reductase A5 [Vitis vinifera] gi|297735029|emb|CBI17391.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|344227187|gb|AEN03273.1| methionine sulfoxide reductase A5 [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|356502124|ref|XP_003519871.1| PREDICTED: peptide methionine sulfoxide reductase A5-like [Glycine max] Back     alignment and taxonomy information
>gi|42570819|ref|NP_973483.1| peptide methionine sulfoxide reductase A5 [Arabidopsis thaliana] gi|330251623|gb|AEC06717.1| peptide methionine sulfoxide reductase A5 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15227955|ref|NP_179394.1| peptide methionine sulfoxide reductase A5 [Arabidopsis thaliana] gi|75266015|sp|Q9SL43.1|MSRA5_ARATH RecName: Full=Peptide methionine sulfoxide reductase A5; Short=AtMSRA5; AltName: Full=Peptide-methionine (S)-S-oxide reductase; Short=Peptide Met(O) reductase; AltName: Full=Protein-methionine-S-oxide reductase; Flags: Precursor gi|4406815|gb|AAD20123.1| putative peptide methionine sulfoxide reductase [Arabidopsis thaliana] gi|27765030|gb|AAO23636.1| At2g18030 [Arabidopsis thaliana] gi|110742978|dbj|BAE99383.1| putative peptide methionine sulfoxide reductase [Arabidopsis thaliana] gi|330251624|gb|AEC06718.1| peptide methionine sulfoxide reductase A5 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356559314|ref|XP_003547945.1| PREDICTED: peptide methionine sulfoxide reductase A5-like [Glycine max] Back     alignment and taxonomy information
>gi|449434176|ref|XP_004134872.1| PREDICTED: peptide methionine sulfoxide reductase A5-like [Cucumis sativus] gi|449491371|ref|XP_004158875.1| PREDICTED: peptide methionine sulfoxide reductase A5-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255579821|ref|XP_002530748.1| methionine sulfoxide reductase, putative [Ricinus communis] gi|223529712|gb|EEF31654.1| methionine sulfoxide reductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|118489617|gb|ABK96610.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query132
TAIR|locus:2060907 254 MSRA5 "AT2G18030" [Arabidopsis 0.818 0.425 0.768 3.1e-44
FB|FBgn0000565 246 Eip71CD "Ecdysone-induced prot 0.621 0.333 0.453 1.9e-19
UNIPROTKB|P0A744212 msrA "methionine sulfoxide red 0.681 0.424 0.489 5.1e-19
TIGR_CMR|CBU_1306284 CBU_1306 "peptide methionine s 0.734 0.341 0.435 5.8e-18
UNIPROTKB|E2QV17233 MSRA "Uncharacterized protein" 0.659 0.373 0.483 5.3e-17
TIGR_CMR|DET_1241176 DET_1241 "peptide methionine s 0.674 0.505 0.451 1.4e-16
MGI|MGI:106916233 Msra "methionine sulfoxide red 0.659 0.373 0.472 1.4e-16
UNIPROTKB|E5RIA9213 MSRA "Mitochondrial peptide me 0.659 0.408 0.461 2.3e-16
UNIPROTKB|Q9UJ68235 MSRA "Mitochondrial peptide me 0.659 0.370 0.461 2.3e-16
TIGR_CMR|SPO_3740170 SPO_3740 "methionine-S-sulfoxi 0.681 0.529 0.466 2.3e-16
TAIR|locus:2060907 MSRA5 "AT2G18030" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 466 (169.1 bits), Expect = 3.1e-44, P = 3.1e-44
 Identities = 83/108 (76%), Positives = 97/108 (89%)

Query:    25 IRFPDRVSTSINDELGRPLKAAVFALGSFWRSEAVFGCLNGVVRTTVGYAGGSKTNPEFR 84
             IR  +++S ++ D   RPLK+AVFALGSFWRSEA FGC+NGVVRT+ GYAGG+KTNPE+R
Sbjct:    34 IRISNQISDTVVDSPDRPLKSAVFALGSFWRSEAAFGCINGVVRTSAGYAGGTKTNPEYR 93

Query:    85 NLGDHAESVQVEYDPRVINFRQLLEVFWTSHDCRQVFGQGPDVGNQYR 132
             NLGDHAESVQVEYDPR+I +RQLL+VFW+SHD RQVFGQGPDVGNQYR
Sbjct:    94 NLGDHAESVQVEYDPRIIGYRQLLDVFWSSHDSRQVFGQGPDVGNQYR 141
GO:0006464 "cellular protein modification process" evidence=ISS
GO:0008113 "peptide-methionine (S)-S-oxide reductase activity" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0016671 "oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor" evidence=IEA
GO:0019538 "protein metabolic process" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
FB|FBgn0000565 Eip71CD "Ecdysone-induced protein 28/29kD" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P0A744 msrA "methionine sulfoxide reductase A" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_1306 CBU_1306 "peptide methionine sulfoxide reductase" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
UNIPROTKB|E2QV17 MSRA "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
TIGR_CMR|DET_1241 DET_1241 "peptide methionine sulfoxide reductase MsrA" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
MGI|MGI:106916 Msra "methionine sulfoxide reductase A" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E5RIA9 MSRA "Mitochondrial peptide methionine sulfoxide reductase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UJ68 MSRA "Mitochondrial peptide methionine sulfoxide reductase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_3740 SPO_3740 "methionine-S-sulfoxide reductase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5VPG8MSRA5_ORYSJ1, ., 8, ., 4, ., 1, 10.80.64390.3346yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.8.4LOW CONFIDENCE prediction!
4th Layer1.8.4.110.824

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00036803001
SubName- Full=Chromosome chr4 scaffold_83, whole genome shotgun sequence; (252 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00027935001
SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (141 aa)
• •   • 0.620
GSVIVG00005758001
SubName- Full=Putative uncharacterized protein (Chromosome chr3 scaffold_157, whole genome shot [...] (138 aa)
•••   • 0.592
GSVIVG00019868001
SubName- Full=Chromosome chr5 scaffold_2, whole genome shotgun sequence; (138 aa)
•••   • 0.550

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query132
pfam01625147 pfam01625, PMSR, Peptide methionine sulfoxide redu 3e-37
PRK14054172 PRK14054, PRK14054, methionine sulfoxide reductase 4e-36
COG0225174 COG0225, MsrA, Peptide methionine sulfoxide reduct 2e-35
PRK05550283 PRK05550, PRK05550, bifunctional methionine sulfox 4e-34
PRK13014186 PRK13014, PRK13014, methionine sulfoxide reductase 4e-33
TIGR00401149 TIGR00401, msrA, methionine-S-sulfoxide reductase 1e-30
PRK00058213 PRK00058, PRK00058, methionine sulfoxide reductase 2e-30
PRK14018 521 PRK14018, PRK14018, trifunctional thioredoxin/meth 7e-13
PRK05528156 PRK05528, PRK05528, methionine sulfoxide reductase 3e-09
>gnl|CDD|216614 pfam01625, PMSR, Peptide methionine sulfoxide reductase Back     alignment and domain information 
 Score =  123 bits (311), Expect = 3e-37
 Identities = 45/91 (49%), Positives = 54/91 (59%), Gaps = 4/91 (4%)

Query: 46  AVFALGSFWRSEAVFGCLNGVVRTTVGYAGGSKTNPEFRN----LGDHAESVQVEYDPRV 101
           A FA G FW  EAVF  L GV+ T VGYAGG   NP +         HAE+V+V YDP  
Sbjct: 3   ATFAGGCFWGVEAVFEKLPGVISTEVGYAGGDTENPTYEEVCSGTTGHAEAVRVTYDPSK 62

Query: 102 INFRQLLEVFWTSHDCRQVFGQGPDVGNQYR 132
           I++ +LLEVF+  HD   +  QG D G QYR
Sbjct: 63  ISYEELLEVFFEIHDPTDLNRQGNDRGTQYR 93

This enzyme repairs damaged proteins. Methionine sulfoxide in proteins is reduced to methionine. Length = 147
>gnl|CDD|237597 PRK14054, PRK14054, methionine sulfoxide reductase A; Provisional Back     alignment and domain information
>gnl|CDD|223303 COG0225, MsrA, Peptide methionine sulfoxide reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|235499 PRK05550, PRK05550, bifunctional methionine sulfoxide reductase B/A protein; Provisional Back     alignment and domain information
>gnl|CDD|237269 PRK13014, PRK13014, methionine sulfoxide reductase A; Provisional Back     alignment and domain information
>gnl|CDD|129496 TIGR00401, msrA, methionine-S-sulfoxide reductase Back     alignment and domain information
>gnl|CDD|234604 PRK00058, PRK00058, methionine sulfoxide reductase A; Provisional Back     alignment and domain information
>gnl|CDD|184456 PRK14018, PRK14018, trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional Back     alignment and domain information
>gnl|CDD|235497 PRK05528, PRK05528, methionine sulfoxide reductase A; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 132
COG0225174 MsrA Peptide methionine sulfoxide reductase [Postt 100.0
TIGR00401149 msrA methionine-S-sulfoxide reductase. This model 100.0
PRK13014186 methionine sulfoxide reductase A; Provisional 100.0
PRK14054172 methionine sulfoxide reductase A; Provisional 100.0
PRK00058213 methionine sulfoxide reductase A; Provisional 100.0
KOG1635191 consensus Peptide methionine sulfoxide reductase [ 100.0
PF01625155 PMSR: Peptide methionine sulfoxide reductase; Inte 100.0
PRK05528156 methionine sulfoxide reductase A; Provisional 100.0
PRK05550283 bifunctional methionine sulfoxide reductase B/A pr 100.0
PRK14018 521 trifunctional thioredoxin/methionine sulfoxide red 100.0
PF0040362 HMA: Heavy-metal-associated domain; InterPro: IPR0 95.91
COG260871 CopZ Copper chaperone [Inorganic ion transport and 90.16
PF0717295 GRP: Glycine rich protein family; InterPro: IPR010 87.85
PF02682 202 AHS1: Allophanate hydrolase subunit 1; InterPro: I 85.18
COG2049 223 DUR1 Allophanate hydrolase subunit 1 [Amino acid t 82.55
>COG0225 MsrA Peptide methionine sulfoxide reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=3.1e-48  Score=302.54  Aligned_cols=93  Identities=46%  Similarity=0.808  Sum_probs=90.7

Q ss_pred             CCCccEEEEcCCCcchhhhhhccCCCeEEEEeeecCCCCCCCCccccC----CceeEEEEEecCCCCCHHHHHHHHHhcC
Q 032840           40 GRPLKAAVFALGSFWRSEAVFGCLNGVVRTTVGYAGGSKTNPEFRNLG----DHAESVQVEYDPRVINFRQLLEVFWTSH  115 (132)
Q Consensus        40 ~~~~~~a~fagGCFWg~E~~F~~l~GV~~t~vGYagG~~~~PtY~~v~----gh~E~V~V~yDp~~is~~~Ll~~f~~~h  115 (132)
                      ..++++|+||||||||+|+.|+++|||++|++||+||.++||||++||    ||+|+|+|+|||++|||++||++||++|
T Consensus         3 ~~~~~~a~fagGCFWg~E~~f~~i~GV~~t~~GYagG~~~nptY~~Vcsg~TgHaE~V~V~yDp~~isy~~LL~~ff~ih   82 (174)
T COG0225           3 PAGMEKAYFAGGCFWGVEAYFEQIPGVLSTVSGYAGGHTPNPTYEEVCSGTTGHAEAVEVTYDPKVISYEELLEVFFEIH   82 (174)
T ss_pred             cCCcEEEEEeccCccchHHHHhhCCCeEEEeeeEcCCCCCCCChhhccCCCCCceEEEEEEeCCccccHHHHHHHHheec
Confidence            356899999999999999999999999999999999999999999996    9999999999999999999999999999


Q ss_pred             CCCCCCCCCCCCCCCCC
Q 032840          116 DCRQVFGQGPDVGNQYR  132 (132)
Q Consensus       116 dPt~~~~Qg~D~G~qYR  132 (132)
                      |||+.||||||+|+|||
T Consensus        83 DPT~~nrQGnD~GtqYR   99 (174)
T COG0225          83 DPTSLNRQGNDRGTQYR   99 (174)
T ss_pred             CCCCCCccCCcccccce
Confidence            99999999999999999

>TIGR00401 msrA methionine-S-sulfoxide reductase Back     alignment and domain information
>PRK13014 methionine sulfoxide reductase A; Provisional Back     alignment and domain information
>PRK14054 methionine sulfoxide reductase A; Provisional Back     alignment and domain information
>PRK00058 methionine sulfoxide reductase A; Provisional Back     alignment and domain information
>KOG1635 consensus Peptide methionine sulfoxide reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01625 PMSR: Peptide methionine sulfoxide reductase; InterPro: IPR002569 Peptide methionine sulphoxide reductase (Msr) reverses the inactivation of many proteins due to the oxidation of critical methionine residues by reducing methionine sulphoxide, Met(O), to methionine [] Back     alignment and domain information
>PRK05528 methionine sulfoxide reductase A; Provisional Back     alignment and domain information
>PRK05550 bifunctional methionine sulfoxide reductase B/A protein; Provisional Back     alignment and domain information
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional Back     alignment and domain information
>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures Back     alignment and domain information
>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF07172 GRP: Glycine rich protein family; InterPro: IPR010800 This family consists of glycine rich proteins Back     alignment and domain information
>PF02682 AHS1: Allophanate hydrolase subunit 1; InterPro: IPR003833 Allophanate hydrolase catalyses the second reaction in an ATP-dependent, two-step degradation of urea to ammonia and C02 Back     alignment and domain information
>COG2049 DUR1 Allophanate hydrolase subunit 1 [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query132
1ff3_A211 Structure Of The Peptide Methionine Sulfoxide Reduc 8e-20
2iem_A211 Solution Structure Of An Oxidized Form (Cys51-Cys19 9e-20
2gt3_A212 Solution Structure And Dynamics Of The Reduced Form 1e-19
2l90_A212 Solution Structure Of Murine Myristoylated Msra Len 4e-17
1fva_A217 Crystal Structure Of Bovine Methionine Sulfoxide Re 1e-16
1fvg_A199 Crystal Structure Of Bovine Peptide Methionine Sulf 6e-16
4gwb_A168 Crystal Structure Of Putative Peptide Methionine Su 1e-15
1nwa_A203 Structure Of Mycobacterium Tuberculosis Methionine 3e-14
2j89_A261 Functional And Structural Aspects Of Poplar Cytosol 6e-14
3bqf_A194 Structure Of The Central Domain (Msra) Of Neisseria 3e-11
3e0m_A 313 Crystal Structure Of Fusion Protein Of Msra And Msr 4e-11
3bqg_A194 Structure Of The Central Domain (msra) Of Neisseria 1e-10
3pin_B183 Crystal Structure Of Mxr1 From Saccharomyces Cerevi 1e-10
3bqh_A193 Structure Of The Central Domain (Msra) Of Neisseria 2e-10
3bqe_A194 Structure Of The Central Domain (Msra) Of Neisseria 2e-10
3pil_A184 Crystal Structure Of Mxr1 From Saccharomyces Cerevi 2e-09
3pim_A187 Crystal Structure Of Mxr1 From Saccharomyces Cerevi 2e-09
>pdb|1FF3|A Chain A, Structure Of The Peptide Methionine Sulfoxide Reductase From Escherichia Coli Length = 211 Back     alignment and structure 
Iteration: 1

 Score = 92.0 bits (227), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 46/94 (48%), Positives = 60/94 (63%), Gaps = 4/94 (4%)
Query: 43  LKAAVFALGSFWRSEAVFGCLNGVVRTTVGYAGGSKTNPEFRNL--GD--HAESVQVEYD 98
           ++ A+FA+G FW  E +F  L GV  T  GY GG   NP +R +  GD  HAE+V++ YD
Sbjct: 42  MEIAIFAMGXFWGVERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYD 101
Query: 99  PRVINFRQLLEVFWTSHDCRQVFGQGPDVGNQYR 132
           P VI++ QLL+VFW +HD  Q   QG D G QYR
Sbjct: 102 PSVISYEQLLQVFWENHDPAQGMRQGNDHGTQYR 135
>pdb|2IEM|A Chain A, Solution Structure Of An Oxidized Form (Cys51-Cys198) Of E. Coli Methionine Sulfoxide Reductase A (Msra) Length = 211 Back     alignment and structure
>pdb|2GT3|A Chain A, Solution Structure And Dynamics Of The Reduced Form Of Methionine Sulfoxide Reductase A From Escherichia Coli, A 23 Kda Protein Length = 212 Back     alignment and structure
>pdb|2L90|A Chain A, Solution Structure Of Murine Myristoylated Msra Length = 212 Back     alignment and structure
>pdb|1FVA|A Chain A, Crystal Structure Of Bovine Methionine Sulfoxide Reductase Length = 217 Back     alignment and structure
>pdb|1FVG|A Chain A, Crystal Structure Of Bovine Peptide Methionine Sulfoxide Reductase Length = 199 Back     alignment and structure
>pdb|4GWB|A Chain A, Crystal Structure Of Putative Peptide Methionine Sulfoxide Reductase From Sinorhizobium Meliloti 1021 Length = 168 Back     alignment and structure
>pdb|1NWA|A Chain A, Structure Of Mycobacterium Tuberculosis Methionine Sulfoxide Reductase A In Complex With Protein-Bound Methionine Length = 203 Back     alignment and structure
>pdb|2J89|A Chain A, Functional And Structural Aspects Of Poplar Cytosolic And Plastidial Type A Methionine Sulfoxide Reductases Length = 261 Back     alignment and structure
>pdb|3BQF|A Chain A, Structure Of The Central Domain (Msra) Of Neisseria Meningitidis Pilb (Complex With A Substrate) Length = 194 Back     alignment and structure
>pdb|3E0M|A Chain A, Crystal Structure Of Fusion Protein Of Msra And Msrb Length = 313 Back     alignment and structure
>pdb|3BQG|A Chain A, Structure Of The Central Domain (msra) Of Neisseria Meningitidis Pilb (sulfenic Acid Form) Length = 194 Back     alignment and structure
>pdb|3PIN|B Chain B, Crystal Structure Of Mxr1 From Saccharomyces Cerevisiae In Complex With Trx2 Length = 183 Back     alignment and structure
>pdb|3BQH|A Chain A, Structure Of The Central Domain (Msra) Of Neisseria Meningitidis Pilb (Oxidized Form) Length = 193 Back     alignment and structure
>pdb|3BQE|A Chain A, Structure Of The Central Domain (Msra) Of Neisseria Meningitidis Pilb (Reduced Form) Length = 194 Back     alignment and structure
>pdb|3PIL|A Chain A, Crystal Structure Of Mxr1 From Saccharomyces Cerevisiae In Reduced Form Length = 184 Back     alignment and structure
>pdb|3PIM|A Chain A, Crystal Structure Of Mxr1 From Saccharomyces Cerevisiae In Unusual Oxidized Form Length = 187 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query132
1nwa_A203 Peptide methionine sulfoxide reductase MSRA; oxido 7e-41
1ff3_A211 Peptide methionine sulfoxide reductase; alpha beta 2e-37
1fvg_A199 Peptide methionine sulfoxide reductase; oxidoreduc 4e-37
3bqh_A193 PILB, peptide methionine sulfoxide reductase MSRA/ 6e-37
2j89_A261 Methionine sulfoxide reductase A; MSRA, poplar, ox 8e-37
3e0m_A 313 Peptide methionine sulfoxide reductase MSRA/MSRB 1 1e-35
3pim_A187 Peptide methionine sulfoxide reductase; methionine 1e-34
>1nwa_A Peptide methionine sulfoxide reductase MSRA; oxidoreductase, product complex, structural genomics, PSI, protein structure initiative; 1.50A {Mycobacterium tuberculosis} SCOP: d.58.28.1 Length = 203 Back     alignment and structure
 Score =  133 bits (338), Expect = 7e-41
 Identities = 38/102 (37%), Positives = 53/102 (51%), Gaps = 8/102 (7%)

Query: 39  LGRPLKA--------AVFALGSFWRSEAVFGCLNGVVRTTVGYAGGSKTNPEFRNLGDHA 90
               ++         A+ A G FW  + +     GVV T VGY+GG+  N  +RN G HA
Sbjct: 13  SSGHIEGRHMTSNQKAILAGGCFWGLQDLIRNQPGVVSTRVGYSGGNIPNATYRNHGTHA 72

Query: 91  ESVQVEYDPRVINFRQLLEVFWTSHDCRQVFGQGPDVGNQYR 132
           E+V++ +DP V ++R LLE F+  HD      QG D G  YR
Sbjct: 73  EAVEIIFDPTVTDYRTLLEFFFQIHDPTTKDRQGNDRGTSYR 114
>1ff3_A Peptide methionine sulfoxide reductase; alpha beta roll, PMSR, MSRA, oxidoreductase; 1.90A {Escherichia coli} SCOP: d.58.28.1 PDB: 2gt3_A 2iem_A Length = 211 Back     alignment and structure
>1fvg_A Peptide methionine sulfoxide reductase; oxidoreductase; 1.60A {Bos taurus} SCOP: d.58.28.1 PDB: 1fva_A 2l90_A* Length = 199 Back     alignment and structure
>3bqh_A PILB, peptide methionine sulfoxide reductase MSRA/MSRB; methionine sulfoxide reductase A, oxidized form, elect transport; 1.95A {Neisseria meningitidis} PDB: 3bqe_A 3bqf_A* 3bqg_A Length = 193 Back     alignment and structure
>2j89_A Methionine sulfoxide reductase A; MSRA, poplar, oxidoreductase; 1.7A {Populus trichocarpa} Length = 261 Back     alignment and structure
>3e0m_A Peptide methionine sulfoxide reductase MSRA/MSRB 1; fusion, msrab, linker, hinge, cell membrane, membrane, multifunctional enzyme, oxidoreductase; 2.40A {Streptococcus pneumoniae} Length = 313 Back     alignment and structure
>3pim_A Peptide methionine sulfoxide reductase; methionine-S-sulfoxide reductase, oxidoreductase; 1.90A {Saccharomyces cerevisiae} PDB: 3pil_A 3pin_B Length = 187 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query132
4gwb_A168 Peptide methionine sulfoxide reductase MSRA 3; str 100.0
1fvg_A199 Peptide methionine sulfoxide reductase; oxidoreduc 100.0
3bqh_A193 PILB, peptide methionine sulfoxide reductase MSRA/ 100.0
1ff3_A211 Peptide methionine sulfoxide reductase; alpha beta 100.0
2j89_A261 Methionine sulfoxide reductase A; MSRA, poplar, ox 100.0
3pim_A187 Peptide methionine sulfoxide reductase; methionine 100.0
1nwa_A203 Peptide methionine sulfoxide reductase MSRA; oxido 100.0
3e0m_A 313 Peptide methionine sulfoxide reductase MSRA/MSRB 1 100.0
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 96.67
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 96.33
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 96.24
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 96.15
2l3m_A71 Copper-ION-binding protein; structural genomics, c 96.04
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 95.97
1opz_A76 Potential copper-transporting ATPase; mutation, fo 95.86
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 95.75
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 95.75
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 95.73
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 95.72
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 95.64
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 95.58
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 95.57
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 95.45
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 95.39
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 95.32
4a4j_A69 Pacszia, cation-transporting ATPase PACS; hydrolas 95.15
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 95.13
1yg0_A66 COP associated protein; open-faced beta-sandwich, 94.95
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 94.88
1jww_A80 Potential copper-transporting ATPase; beta-alpha-b 94.27
2kkh_A95 Putative heavy metal transporter; zinc transport, 93.8
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 93.77
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 93.17
1mwy_A73 ZNTA; open-faced beta-sandwich fold, beta-alpha-be 93.14
2rop_A 202 Copper-transporting ATPase 2; wilson protein, mobi 92.56
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 90.98
3j09_A 723 COPA, copper-exporting P-type ATPase A; copper tra 90.33
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 88.21
1cc8_A73 Protein (metallochaperone ATX1); copper transport, 86.12
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 85.73
2kwa_A101 Kinase A inhibitor; bacterial signal transduction, 85.52
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 82.64
2phc_B 225 Uncharacterized protein PH0987; structural genomic 80.07
>4gwb_A Peptide methionine sulfoxide reductase MSRA 3; structural genomics, protein structure initiative, nysgrc, R PSI-biology; 1.20A {Sinorhizobium meliloti} Back     alignment and structure
Probab=100.00  E-value=3.5e-48  Score=299.87  Aligned_cols=90  Identities=42%  Similarity=0.783  Sum_probs=89.0

Q ss_pred             ccEEEEcCCCcchhhhhhccCCCeEEEEeeecCCCCCCCCccccCCceeEEEEEecCCCCCHHHHHHHHHhcCCCCCCCC
Q 032840           43 LKAAVFALGSFWRSEAVFGCLNGVVRTTVGYAGGSKTNPEFRNLGDHAESVQVEYDPRVINFRQLLEVFWTSHDCRQVFG  122 (132)
Q Consensus        43 ~~~a~fagGCFWg~E~~F~~l~GV~~t~vGYagG~~~~PtY~~v~gh~E~V~V~yDp~~is~~~Ll~~f~~~hdPt~~~~  122 (132)
                      .++|+||||||||+|+.|+++|||++|+|||+||..+||||++||+|+|+|+|+|||++|||++||++||++||||+.||
T Consensus         2 te~A~fagGCFWg~E~~f~~l~GV~~t~~GYagG~~~nPtY~~v~~HaE~V~V~yDp~~isy~~LL~~F~~~hDPT~~nr   81 (168)
T 4gwb_A            2 TKRAVLAGGCFWGMQDLIRKLPGVIETRVGYTGGDVPNATYRNHGTHAEGIEIIFDPERISYRRILELFFQIHDPTTKDR   81 (168)
T ss_dssp             CEEEEEEESCHHHHHHHHTTSTTEEEEEEEEESSSCTTCBTTBCTTCEEEEEEEECTTTCCHHHHHHHHHHHSCTTSTTE
T ss_pred             ceEEEEEccCccchHHHHhcCCCeEEEEEEcCCCcCCCCcccccCceEEEEEEEECCCCCCHHHHHHHHHhhcCCcCcCC
Confidence            57899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCC
Q 032840          123 QGPDVGNQYR  132 (132)
Q Consensus       123 Qg~D~G~qYR  132 (132)
                      ||+|+|+|||
T Consensus        82 Qg~D~G~QYR   91 (168)
T 4gwb_A           82 QGNDIGTSYR   91 (168)
T ss_dssp             ETTEESGGGC
T ss_pred             CCCCCCcCce
Confidence            9999999999
>1fvg_A Peptide methionine sulfoxide reductase; oxidoreductase; 1.60A {Bos taurus} SCOP: d.58.28.1 PDB: 1fva_A 2l90_A* Back     alignment and structure
>3bqh_A PILB, peptide methionine sulfoxide reductase MSRA/MSRB; methionine sulfoxide reductase A, oxidized form, elect transport; 1.95A {Neisseria meningitidis} PDB: 3bqe_A 3bqf_A* 3bqg_A Back     alignment and structure
>1ff3_A Peptide methionine sulfoxide reductase; alpha beta roll, PMSR, MSRA, oxidoreductase; 1.90A {Escherichia coli} SCOP: d.58.28.1 PDB: 2gt3_A 2iem_A Back     alignment and structure
>2j89_A Methionine sulfoxide reductase A; MSRA, poplar, oxidoreductase; 1.7A {Populus trichocarpa} Back     alignment and structure
>3pim_A Peptide methionine sulfoxide reductase; methionine-S-sulfoxide reductase, oxidoreductase; 1.90A {Saccharomyces cerevisiae} PDB: 3pil_A 3pin_B Back     alignment and structure
>1nwa_A Peptide methionine sulfoxide reductase MSRA; oxidoreductase, product complex, structural genomics, PSI, protein structure initiative; 1.50A {Mycobacterium tuberculosis} SCOP: d.58.28.1 Back     alignment and structure
>3e0m_A Peptide methionine sulfoxide reductase MSRA/MSRB 1; fusion, msrab, linker, hinge, cell membrane, membrane, multifunctional enzyme, oxidoreductase; 2.40A {Streptococcus pneumoniae} Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Back     alignment and structure
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Back     alignment and structure
>4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Back     alignment and structure
>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Back     alignment and structure
>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Back     alignment and structure
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Back     alignment and structure
>2kwa_A Kinase A inhibitor; bacterial signal transduction, KIPI, histidine kinase inhibi bacillus subtilis, transferase inhibitor; NMR {Bacillus subtilis} Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>2phc_B Uncharacterized protein PH0987; structural genomics, southeas collaboratory for structural genomics, secsg, PSI, protein initiative; 2.29A {Pyrococcus horikoshii} SCOP: b.62.1.4 d.74.5.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 132
d1ff3a_211 d.58.28.1 (A:) Peptide methionine sulfoxide reduct 3e-22
d1nwaa_168 d.58.28.1 (A:) Peptide methionine sulfoxide reduct 1e-19
d1fvga_192 d.58.28.1 (A:) Peptide methionine sulfoxide reduct 8e-17
d2phcb284 d.74.5.1 (B:2-85) Uncharacterized protein PH0987 { 4e-04
>d1ff3a_ d.58.28.1 (A:) Peptide methionine sulfoxide reductase {Escherichia coli [TaxId: 562]} Length = 211 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Peptide methionine sulfoxide reductase
family: Peptide methionine sulfoxide reductase
domain: Peptide methionine sulfoxide reductase
species: Escherichia coli [TaxId: 562]

 Score = 85.1 bits (210), Expect = 3e-22
 Identities = 45/105 (42%), Positives = 58/105 (55%), Gaps = 11/105 (10%)

Query: 39  LGRPLKA-------AVFALGSFWRSEAVFGCLNGVVRTTVGYAGGSKTNPEFRNLG---- 87
            G  +         A+FA+G FW  E +F  L GV  T  GY GG   NP +R +     
Sbjct: 31  NGHSMTNVPDGMEIAIFAMGCFWGVERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDT 90

Query: 88  DHAESVQVEYDPRVINFRQLLEVFWTSHDCRQVFGQGPDVGNQYR 132
            HAE+V++ YDP VI++ QLL+VFW +HD  Q   QG D G QYR
Sbjct: 91  GHAEAVRIVYDPSVISYEQLLQVFWENHDPAQGMRQGNDHGTQYR 135
>d1nwaa_ d.58.28.1 (A:) Peptide methionine sulfoxide reductase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 168 Back     information, alignment and structure
>d1fvga_ d.58.28.1 (A:) Peptide methionine sulfoxide reductase {Cow (Bos taurus) [TaxId: 9913]} Length = 192 Back     information, alignment and structure
>d2phcb2 d.74.5.1 (B:2-85) Uncharacterized protein PH0987 {Pyrococcus horikoshii [TaxId: 53953]} Length = 84 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query132
d1fvga_192 Peptide methionine sulfoxide reductase {Cow (Bos t 100.0
d1nwaa_168 Peptide methionine sulfoxide reductase {Mycobacter 100.0
d1ff3a_211 Peptide methionine sulfoxide reductase {Escherichi 100.0
d1osda_72 Mercuric ion binding protein MerP {Ralstonia metal 97.66
d1cpza_68 Copper chaperone {Enterococcus hirae [TaxId: 1354] 97.58
d1q8la_84 Menkes copper-transporting ATPase {Human (Homo sap 97.52
d2aw0a_72 Menkes copper-transporting ATPase {Human (Homo sap 97.41
d1p6ta172 Potential copper-translocating P-type ATPase CopA 97.35
d2qifa169 Copper chaperone {Bacillus subtilis, CopZ [TaxId: 97.34
d1p6ta279 Potential copper-translocating P-type ATPase CopA 97.3
d1kvja_79 Menkes copper-transporting ATPase {Human (Homo sap 97.28
d2ggpb172 Copper transporter domain ccc2a {Baker's yeast (Sa 96.83
d2phcb284 Uncharacterized protein PH0987 {Pyrococcus horikos 94.47
d1mwza_73 Metal ion-transporting ATPase ZntA, N-terminal dom 92.92
d1qupa272 Copper chaperone for superoxide dismutase, N-termi 92.15
d1sb6a_64 Copper chaperone {Synechocystis sp. pcc 6803, Scat 90.41
d1fe0a_66 ATX1 metallochaperone protein (ATOX1) {Human (Homo 81.24
>d1fvga_ d.58.28.1 (A:) Peptide methionine sulfoxide reductase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Peptide methionine sulfoxide reductase
family: Peptide methionine sulfoxide reductase
domain: Peptide methionine sulfoxide reductase
species: Cow (Bos taurus) [TaxId: 9913]

Probab=100.00  E-value=1.1e-46  Score=294.55  Aligned_cols=94  Identities=45%  Similarity=0.818  Sum_probs=91.5

Q ss_pred             CCCCccEEEEcCCCcchhhhhhccCCCeEEEEeeecCCCCCCCCccccC----CceeEEEEEecCCCCCHHHHHHHHHhc
Q 032840           39 LGRPLKAAVFALGSFWRSEAVFGCLNGVVRTTVGYAGGSKTNPEFRNLG----DHAESVQVEYDPRVINFRQLLEVFWTS  114 (132)
Q Consensus        39 ~~~~~~~a~fagGCFWg~E~~F~~l~GV~~t~vGYagG~~~~PtY~~v~----gh~E~V~V~yDp~~is~~~Ll~~f~~~  114 (132)
                      .++++++|+||||||||+|+.|++++||++|+|||+||..+||||++||    ||+|+|+|+|||++|||++||++||++
T Consensus        33 ~p~~~~~a~fagGCFWg~E~~f~~~~GV~~t~vGY~GG~~~nPtY~~Vc~g~TgH~E~V~V~yDp~~isy~~LL~~F~~~  112 (192)
T d1fvga_          33 FPEGTQMAVFGMGCFWGAERKFWTLKGVYSTQVGFAGGYTPNPTYKEVCSGKTGHAEVVRVVFQPEHISFEELLKVFWEN  112 (192)
T ss_dssp             CCTTCEEEEEEESSHHHHHHHHHTSTTEEEEEEEEESSSCSSCCHHHHHHTCSCCEEEEEEEECTTTSCHHHHHHHHHHT
T ss_pred             CCCCceEEEEEecccccceeeeeecCCeEEEEeeeccCCCCCCCcceeecCCCCCeeEEEEEEecccCCHHHHHHHHHhh
Confidence            3568999999999999999999999999999999999999999999995    899999999999999999999999999


Q ss_pred             CCCCCCCCCCCCCCCCCC
Q 032840          115 HDCRQVFGQGPDVGNQYR  132 (132)
Q Consensus       115 hdPt~~~~Qg~D~G~qYR  132 (132)
                      ||||+.||||+|+|+|||
T Consensus       113 hDPT~~n~Qg~D~G~QYR  130 (192)
T d1fvga_         113 HDPTQGMRQGNDHGSQYR  130 (192)
T ss_dssp             SCTTCSSEETTEESGGGC
T ss_pred             cccccccceecccCcccc
Confidence            999999999999999998
>d1nwaa_ d.58.28.1 (A:) Peptide methionine sulfoxide reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ff3a_ d.58.28.1 (A:) Peptide methionine sulfoxide reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2phcb2 d.74.5.1 (B:2-85) Uncharacterized protein PH0987 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Back     information, alignment and structure
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Back     information, alignment and structure