Citrus Sinensis ID: 032854

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
MARSISYISGSQLLSLKRRPNIAVIDVRDDERSYDGHITGSLHYPSDSFTDKIFDLIQEVRGKDTLVFHCALSQVRGPTCAKRLANYLDEVKEDTGINSIFVLERGFKGWEASGKPVCRCTDVPCKEENQQY
cccccccccHHHHHHHHcccccEEEEcccccccccccccccccccccccccHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHHcccccEEEccccHHHHHHcccccccccccccccccccc
ccccEEEccHHHHHHHHccccEEEEEEccccccccccEccccccccHHHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHHHHHHHHcccccccEEEEEcccHHHHHHccccEEEEcccccccHHccc
marsisyisgsqllslkrrpniavidvrddersydghitgslhypsdsftDKIFDLIQEVRGKDTLVFHCALSQVRGPTCAKRLANYLDevkedtginsIFVLERgfkgweasgkpvcrctdvpckeenqqy
marsisyisgsqllslkrrpniavidvrddersyDGHITgslhypsdsfTDKIFDLIQEVRGKDTLVFHCalsqvrgptCAKRLANYLdevkedtgiNSIFVLERGFkgweasgkpvcrctdvpckeenqqy
MARSISYISGSQLLSLKRRPNIAVIDVRDDERSYDGHITGSLHYPSDSFTDKIFDLIQEVRGKDTLVFHCALSQVRGPTCAKRLANYLDEVKEDTGINSIFVLERGFKGWEASGKPVCRCTDVPCKEENQQY
************LLSLKRRPNIAVIDVRDDERSYDGHITGSLHYPSDSFTDKIFDLIQEVRGKDTLVFHCALSQVRGPTCAKRLANYLDEVKEDTGINSIFVLERGFKGWEASGKPVCRCTDVP********
**RSISYISGSQLLSLKRRPNIAVIDVRDDERSYDGHITGSLHYPSDSFTDKIFDLIQEVRGKDTLVFHCALSQVRGPTCAKRLANYLDEVKEDTGINSIFVLERGFKGWEASGKPVCRCTDVPC*******
MARSISYISGSQLLSLKRRPNIAVIDVRDDERSYDGHITGSLHYPSDSFTDKIFDLIQEVRGKDTLVFHCALSQVRGPTCAKRLANYLDEVKEDTGINSIFVLERGFKGWEASGKPVCRCTDVPCKEENQQY
***SISYISGSQLLSLKRRPNIAVIDVRDDERSYDGHITGSLHYPSDSFTDKIFDLIQEVRGKDTLVFHCALSQVRGPTCAKRLANYLDEVKEDTGINSIFVLERGFKGWEASGKPVCRCTDVPCKE*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARSISYISGSQLLSLKRRPNIAVIDVRDDERSYDGHITGSLHYPSDSFTDKIFDLIQEVRGKDTLVFHCALSQVRGPTCAKRLANYLDEVKEDTGINSIFVLERGFKGWEASGKPVCRCTDVPCKEENQQY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query132 2.2.26 [Sep-21-2011]
Q8GY31146 Dual specificity phosphat yes no 0.954 0.863 0.777 2e-55
Q10SX6130 Arsenate reductase 2.2 OS yes no 0.954 0.969 0.603 2e-43
Q336V5160 Arsenate reductase 2.1 OS no no 0.954 0.787 0.590 5e-42
Q8WZK3138 Dual specificity phosphat yes no 0.803 0.768 0.336 7e-10
Q06597130 Arsenical-resistance prot yes no 0.765 0.776 0.349 2e-06
P42937148 CDC25-like phosphatase YC no no 0.689 0.614 0.288 0.0003
C4L7X3106 Thiosulfate sulfurtransfe yes no 0.681 0.849 0.233 0.0009
>sp|Q8GY31|CDC25_ARATH Dual specificity phosphatase Cdc25 OS=Arabidopsis thaliana GN=CDC25 PE=1 SV=1 Back     alignment and function desciption
 Score =  213 bits (542), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 98/126 (77%), Positives = 109/126 (86%)

Query: 1   MARSISYISGSQLLSLKRRPNIAVIDVRDDERSYDGHITGSLHYPSDSFTDKIFDLIQEV 60
           MARSISYI+ +QLL L RRPNIA+IDVRD+ER+YDGHI GSLHY S SF DKI  L+Q V
Sbjct: 17  MARSISYITSTQLLPLHRRPNIAIIDVRDEERNYDGHIAGSLHYASGSFDDKISHLVQNV 76

Query: 61  RGKDTLVFHCALSQVRGPTCAKRLANYLDEVKEDTGINSIFVLERGFKGWEASGKPVCRC 120
           + KDTLVFHCALSQVRGPTCA+RL NYLDE KEDTGI +I +LERGF GWEASGKPVCRC
Sbjct: 77  KDKDTLVFHCALSQVRGPTCARRLVNYLDEKKEDTGIKNIMILERGFNGWEASGKPVCRC 136

Query: 121 TDVPCK 126
            +VPCK
Sbjct: 137 AEVPCK 142
Arsenate reductase that plays a major role in the reduction of arsenate to arsenite and arsenic retention in roots.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 2EC: 0EC: .EC: 4EC: .EC: -
>sp|Q10SX6|ACR22_ORYSJ Arsenate reductase 2.2 OS=Oryza sativa subsp. japonica GN=ACR2.2 PE=1 SV=1 Back     alignment and function description
>sp|Q336V5|ACR21_ORYSJ Arsenate reductase 2.1 OS=Oryza sativa subsp. japonica GN=ACR2.1 PE=1 SV=1 Back     alignment and function description
>sp|Q8WZK3|IBP1_SCHPO Dual specificity phosphatase ibp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ibp1 PE=1 SV=1 Back     alignment and function description
>sp|Q06597|ARR2_YEAST Arsenical-resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARR2 PE=4 SV=1 Back     alignment and function description
>sp|P42937|YCH1_YEAST CDC25-like phosphatase YCH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCH1 PE=1 SV=1 Back     alignment and function description
>sp|C4L7X3|GLPE_TOLAT Thiosulfate sulfurtransferase GlpE OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=glpE PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query132
224068805130 predicted protein [Populus trichocarpa] 0.977 0.992 0.798 8e-58
255552529131 Dual specificity phosphatase Cdc25, puta 0.992 1.0 0.770 2e-56
351722004131 uncharacterized protein LOC100305790 [Gl 0.969 0.977 0.789 8e-56
449482402129 PREDICTED: dual specificity phosphatase 0.962 0.984 0.779 1e-55
225441181130 PREDICTED: dual specificity phosphatase 0.984 1.0 0.770 6e-55
147801852130 hypothetical protein VITISV_009836 [Viti 0.984 1.0 0.763 3e-54
388509908145 unknown [Medicago truncatula] 0.954 0.868 0.753 5e-54
297806301132 hypothetical protein ARALYDRAFT_487122 [ 0.954 0.954 0.785 9e-54
357510821168 Dual specificity phosphatase Cdc25 [Medi 0.954 0.75 0.746 2e-53
18414234146 dual specificity phosphatase Cdc25 [Arab 0.954 0.863 0.777 2e-53
>gi|224068805|ref|XP_002326204.1| predicted protein [Populus trichocarpa] gi|222833397|gb|EEE71874.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  228 bits (580), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 103/129 (79%), Positives = 119/129 (92%)

Query: 1   MARSISYISGSQLLSLKRRPNIAVIDVRDDERSYDGHITGSLHYPSDSFTDKIFDLIQEV 60
           M+R ISYI+GSQLLSL+R PNIA+IDVRDDERSYDGHI GSLHY SD+FTD+I +LIQEV
Sbjct: 1   MSRGISYITGSQLLSLRRLPNIAIIDVRDDERSYDGHIAGSLHYASDTFTDRISNLIQEV 60

Query: 61  RGKDTLVFHCALSQVRGPTCAKRLANYLDEVKEDTGINSIFVLERGFKGWEASGKPVCRC 120
           +GKDTLVFHCALSQVRGPTCA+RLANYL+EVKED GI +I VLERGF GWEA+G+PVCRC
Sbjct: 61  KGKDTLVFHCALSQVRGPTCARRLANYLEEVKEDGGIKNIMVLERGFNGWEAAGRPVCRC 120

Query: 121 TDVPCKEEN 129
           T +PCK+E+
Sbjct: 121 TGIPCKDES 129

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255552529|ref|XP_002517308.1| Dual specificity phosphatase Cdc25, putative [Ricinus communis] gi|223543571|gb|EEF45101.1| Dual specificity phosphatase Cdc25, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|351722004|ref|NP_001236717.1| uncharacterized protein LOC100305790 [Glycine max] gi|255626611|gb|ACU13650.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449482402|ref|XP_004156271.1| PREDICTED: dual specificity phosphatase Cdc25-like isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|225441181|ref|XP_002269130.1| PREDICTED: dual specificity phosphatase Cdc25 [Vitis vinifera] gi|297739969|emb|CBI30151.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147801852|emb|CAN65876.1| hypothetical protein VITISV_009836 [Vitis vinifera] Back     alignment and taxonomy information
>gi|388509908|gb|AFK43020.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|297806301|ref|XP_002871034.1| hypothetical protein ARALYDRAFT_487122 [Arabidopsis lyrata subsp. lyrata] gi|297316871|gb|EFH47293.1| hypothetical protein ARALYDRAFT_487122 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357510821|ref|XP_003625699.1| Dual specificity phosphatase Cdc25 [Medicago truncatula] gi|355500714|gb|AES81917.1| Dual specificity phosphatase Cdc25 [Medicago truncatula] gi|388498118|gb|AFK37125.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|18414234|ref|NP_568119.1| dual specificity phosphatase Cdc25 [Arabidopsis thaliana] gi|62286622|sp|Q8GY31.1|CDC25_ARATH RecName: Full=Dual specificity phosphatase Cdc25; AltName: Full=Arath;CDC25; AltName: Full=Arsenate reductase 2; AltName: Full=Sulfurtransferase 5; Short=AtStr5 gi|26450859|dbj|BAC42537.1| unknown protein [Arabidopsis thaliana] gi|28372808|gb|AAO39886.1| At5g03455 [Arabidopsis thaliana] gi|332003224|gb|AED90607.1| dual specificity phosphatase Cdc25 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query132
TAIR|locus:505006579146 CDC25 [Arabidopsis thaliana (t 0.954 0.863 0.777 1.9e-51
UNIPROTKB|Q10SX6130 ACR2.2 "Arsenate reductase 2.2 0.954 0.969 0.603 1.2e-40
UNIPROTKB|Q336V5160 ACR2.1 "Arsenate reductase 2.1 0.954 0.787 0.590 4.8e-39
ASPGD|ASPL0000000763141 AN6040 [Emericella nidulans (t 0.893 0.836 0.365 1.8e-14
POMBASE|SPBC839.07138 ibp1 "Cdc25 family phosphatase 0.803 0.768 0.336 2.8e-11
CGD|CAL0005856151 orf19.4185 [Candida albicans ( 0.651 0.569 0.367 9.4e-11
SGD|S000006404130 ARR2 "Arsenate reductase requi 0.757 0.769 0.352 5.3e-08
UNIPROTKB|G4MXF5156 MGG_15495 "Uncharacterized pro 0.651 0.551 0.347 4.8e-07
ASPGD|ASPL0000007667153 AN6362 [Emericella nidulans (t 0.681 0.588 0.315 1.6e-06
UNIPROTKB|Q48C88137 PSPPH_4915 "Rhodanese domain p 0.681 0.656 0.326 2.4e-05
TAIR|locus:505006579 CDC25 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 534 (193.0 bits), Expect = 1.9e-51, P = 1.9e-51
 Identities = 98/126 (77%), Positives = 109/126 (86%)

Query:     1 MARSISYISGSQLLSLKRRPNIAVIDVRDDERSYDGHITGSLHYPSDSFTDKIFDLIQEV 60
             MARSISYI+ +QLL L RRPNIA+IDVRD+ER+YDGHI GSLHY S SF DKI  L+Q V
Sbjct:    17 MARSISYITSTQLLPLHRRPNIAIIDVRDEERNYDGHIAGSLHYASGSFDDKISHLVQNV 76

Query:    61 RGKDTLVFHCALSQVRGPTCAKRLANYLDEVKEDTGINSIFVLERGFKGWEASGKPVCRC 120
             + KDTLVFHCALSQVRGPTCA+RL NYLDE KEDTGI +I +LERGF GWEASGKPVCRC
Sbjct:    77 KDKDTLVFHCALSQVRGPTCARRLVNYLDEKKEDTGIKNIMILERGFNGWEASGKPVCRC 136

Query:   121 TDVPCK 126
              +VPCK
Sbjct:   137 AEVPCK 142
GO:0005634 "nucleus" evidence=ISM
GO:0004725 "protein tyrosine phosphatase activity" evidence=IDA
GO:0006468 "protein phosphorylation" evidence=IDA
GO:0030611 "arsenate reductase activity" evidence=IGI
GO:0046685 "response to arsenic-containing substance" evidence=IMP
GO:0009507 "chloroplast" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0005739 "mitochondrion" evidence=IDA
UNIPROTKB|Q10SX6 ACR2.2 "Arsenate reductase 2.2" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q336V5 ACR2.1 "Arsenate reductase 2.1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
ASPGD|ASPL0000000763 AN6040 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
POMBASE|SPBC839.07 ibp1 "Cdc25 family phosphatase Ibp1" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
CGD|CAL0005856 orf19.4185 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
SGD|S000006404 ARR2 "Arsenate reductase required for arsenate resistance" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|G4MXF5 MGG_15495 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
ASPGD|ASPL0000007667 AN6362 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|Q48C88 PSPPH_4915 "Rhodanese domain protein" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8GY31CDC25_ARATH1, ., 2, 0, ., 4, ., -0.77770.95450.8630yesno
Q10SX6ACR22_ORYSJ1, ., 2, 0, ., 4, ., 10.60310.95450.9692yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.30.976
3rd Layer3.1.3.480.991

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.28.772.1
hypothetical protein (130 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_fgenesh4_pg.C_LG_V1631
hypothetical protein (799 aa)
    •   0.407

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query132
cd01531113 cd01531, Acr2p, Eukaryotic arsenate resistance pro 2e-42
cd01443113 cd01443, Cdc25_Acr2p, Cdc25 enzymes are members of 6e-22
pfam00581106 pfam00581, Rhodanese, Rhodanese-like domain 3e-14
smart00450100 smart00450, RHOD, Rhodanese Homology Domain 2e-10
cd0015889 cd00158, RHOD, Rhodanese Homology Domain (RHOD); a 9e-10
cd01530121 cd01530, Cdc25, Cdc25 phosphatases are members of 5e-09
COG0607110 COG0607, PspE, Rhodanese-related sulfurtransferase 1e-07
cd01447103 cd01447, Polysulfide_ST, Polysulfide-sulfurtransfe 5e-07
cd01521110 cd01521, RHOD_PspE2, Member of the Rhodanese Homol 3e-04
PRK08762 376 PRK08762, PRK08762, molybdopterin biosynthesis pro 0.001
cd0152799 cd01527, RHOD_YgaP, Member of the Rhodanese Homolo 0.002
>gnl|CDD|238789 cd01531, Acr2p, Eukaryotic arsenate resistance proteins are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information 
 Score =  135 bits (342), Expect = 2e-42
 Identities = 55/115 (47%), Positives = 71/115 (61%), Gaps = 7/115 (6%)

Query: 5   ISYISGSQLLSLKR--RPNIAVIDVRDDERSYDG-HITGSLHYPSDSFTDKIFDLIQEV- 60
           +SYIS +QL    R  RP   V+DVRD+   Y G HI GS HYPS  F  ++  L+Q + 
Sbjct: 1   VSYISPAQLKGWIRNGRPPFQVVDVRDE--DYAGGHIKGSWHYPSTRFKAQLNQLVQLLS 58

Query: 61  -RGKDTLVFHCALSQVRGPTCAKRLANYLDEVKEDTGINSIFVLERGFKGWEASG 114
              KDT+VFHCALSQVRGP+ A++   YLDE   +T    ++VL  GF  WE+S 
Sbjct: 59  GSKKDTVVFHCALSQVRGPSAARKFLRYLDEEDLETSKFEVYVLHGGFNAWESSY 113

Included in this CD is the Saccharomyces cerevisiae arsenate reductase protein, Acr2p, and other yeast and plant homologs. Length = 113
>gnl|CDD|238720 cd01443, Cdc25_Acr2p, Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily Back     alignment and domain information
>gnl|CDD|216005 pfam00581, Rhodanese, Rhodanese-like domain Back     alignment and domain information
>gnl|CDD|197731 smart00450, RHOD, Rhodanese Homology Domain Back     alignment and domain information
>gnl|CDD|238089 cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>gnl|CDD|238788 cd01530, Cdc25, Cdc25 phosphatases are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|223680 COG0607, PspE, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|238724 cd01447, Polysulfide_ST, Polysulfide-sulfurtransferase - Rhodanese Homology Domain Back     alignment and domain information
>gnl|CDD|238779 cd01521, RHOD_PspE2, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>gnl|CDD|238785 cd01527, RHOD_YgaP, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 132
cd01518101 RHOD_YceA Member of the Rhodanese Homology Domain 99.92
PRK00162108 glpE thiosulfate sulfurtransferase; Validated 99.91
cd01533109 4RHOD_Repeat_2 Member of the Rhodanese Homology Do 99.91
PLN02160136 thiosulfate sulfurtransferase 99.91
cd0152799 RHOD_YgaP Member of the Rhodanese Homology Domain 99.9
cd01531113 Acr2p Eukaryotic arsenate resistance proteins are 99.9
cd01523100 RHOD_Lact_B Member of the Rhodanese Homology Domai 99.9
cd01443113 Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda 99.89
PF00581113 Rhodanese: Rhodanese-like domain This Prosite entr 99.89
TIGR03865162 PQQ_CXXCW PQQ-dependent catabolism-associated CXXC 99.89
cd0153495 4RHOD_Repeat_3 Member of the Rhodanese Homology Do 99.89
cd01526122 RHOD_ThiF Member of the Rhodanese Homology Domain 99.89
cd01528101 RHOD_2 Member of the Rhodanese Homology Domain sup 99.88
cd01521110 RHOD_PspE2 Member of the Rhodanese Homology Domain 99.88
cd01520128 RHOD_YbbB Member of the Rhodanese Homology Domain 99.87
cd0152490 RHOD_Pyr_redox Member of the Rhodanese Homology Do 99.87
cd0144496 GlpE_ST GlpE sulfurtransferase (ST) and homologs a 99.87
cd01447103 Polysulfide_ST Polysulfide-sulfurtransferase - Rho 99.87
cd01448122 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), 99.87
cd01535145 4RHOD_Repeat_4 Member of the Rhodanese Homology Do 99.87
cd01530121 Cdc25 Cdc25 phosphatases are members of the Rhodan 99.87
cd01519106 RHOD_HSP67B2 Member of the Rhodanese Homology Doma 99.86
cd01525105 RHOD_Kc Member of the Rhodanese Homology Domain su 99.86
KOG1530136 consensus Rhodanese-related sulfurtransferase [Ino 99.86
cd01522117 RHOD_1 Member of the Rhodanese Homology Domain sup 99.85
PRK11493 281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 99.85
PRK01415247 hypothetical protein; Validated 99.84
cd01449118 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), 99.84
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 99.84
cd0152996 4RHOD_Repeats Member of the Rhodanese Homology Dom 99.83
PRK09629 610 bifunctional thiosulfate sulfurtransferase/phospha 99.83
smart00450100 RHOD Rhodanese Homology Domain. An alpha beta fold 99.83
PLN02723 320 3-mercaptopyruvate sulfurtransferase 99.83
cd0153292 4RHOD_Repeat_1 Member of the Rhodanese Homology Do 99.82
PRK00142314 putative rhodanese-related sulfurtransferase; Prov 99.82
PRK05320257 rhodanese superfamily protein; Provisional 99.82
cd0015889 RHOD Rhodanese Homology Domain (RHOD); an alpha be 99.81
COG0607110 PspE Rhodanese-related sulfurtransferase [Inorgani 99.8
cd01445138 TST_Repeats Thiosulfate sulfurtransferases (TST) c 99.79
TIGR02981101 phageshock_pspE phage shock operon rhodanese PspE. 99.78
PRK11493281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 99.78
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 99.77
PLN02723320 3-mercaptopyruvate sulfurtransferase 99.77
PRK10287104 thiosulfate:cyanide sulfurtransferase; Provisional 99.76
cd01446132 DSP_MapKP N-terminal regulatory rhodanese domain o 99.76
PRK09629 610 bifunctional thiosulfate sulfurtransferase/phospha 99.75
COG2897 285 SseA Rhodanese-related sulfurtransferase [Inorgani 99.75
TIGR03167 311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The 99.74
PRK07411390 hypothetical protein; Validated 99.73
PRK11784 345 tRNA 2-selenouridine synthase; Provisional 99.73
COG2897285 SseA Rhodanese-related sulfurtransferase [Inorgani 99.72
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 99.69
PRK05600370 thiamine biosynthesis protein ThiF; Validated 99.65
COG1054308 Predicted sulfurtransferase [General function pred 99.59
KOG3772325 consensus M-phase inducer phosphatase [Cell cycle 99.57
KOG1529 286 consensus Mercaptopyruvate sulfurtransferase/thios 99.39
PRK01269482 tRNA s(4)U8 sulfurtransferase; Provisional 99.37
KOG2017427 consensus Molybdopterin synthase sulfurylase [Coen 99.3
COG5105427 MIH1 Mitotic inducer, protein phosphatase [Cell di 99.07
KOG1529286 consensus Mercaptopyruvate sulfurtransferase/thios 98.94
KOG1717 343 consensus Dual specificity phosphatase [Defense me 98.04
COG2603 334 Predicted ATPase [General function prediction only 97.61
KOG3636 669 consensus Uncharacterized conserved protein, conta 97.02
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 96.98
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 96.86
KOG1093725 consensus Predicted protein kinase (contains TBC a 96.54
PRK00142 314 putative rhodanese-related sulfurtransferase; Prov 96.42
TIGR03167311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The 96.35
PLN02727 986 NAD kinase 94.38
COG3453130 Uncharacterized protein conserved in bacteria [Fun 93.47
PF13350164 Y_phosphatase3: Tyrosine phosphatase family; PDB: 92.53
PF14606178 Lipase_GDSL_3: GDSL-like Lipase/Acylhydrolase fami 92.07
KOG1352 618 consensus Vacuolar H+-ATPase V1 sector, subunit A 91.18
cd00127139 DSPc Dual specificity phosphatases (DSP); Ser/Thr 90.9
PF07755 301 DUF1611: Protein of unknown function (DUF1611); In 90.32
smart00195138 DSPc Dual specificity phosphatase, catalytic domai 88.75
PRK11784345 tRNA 2-selenouridine synthase; Provisional 83.42
PF01451138 LMWPc: Low molecular weight phosphotyrosine protei 83.05
PF0230290 PTS_IIB: PTS system, Lactose/Cellobiose specific I 80.01
>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information 
Probab=99.92  E-value=1.5e-24  Score=135.76  Aligned_cols=97  Identities=24%  Similarity=0.439  Sum_probs=77.7

Q ss_pred             ccccHHHHHhhhCCCCeEEEeeCCCCCcCCCccCCccccCccchhHHHHHHHH--HhcCCCEEEEEcCCCCCCcHHHHHH
Q 032854            6 SYISGSQLLSLKRRPNIAVIDVRDDERSYDGHITGSLHYPSDSFTDKIFDLIQ--EVRGKDTLVFHCALSQVRGPTCAKR   83 (132)
Q Consensus         6 ~~is~~~~~~~~~~~~~~liD~R~~~e~~~~hI~gai~ip~~~~~~~~~~~~~--~~~~~~~ivv~c~~g~~~~~~~a~~   83 (132)
                      ..|+++++.+++.+++.+|||+|++.||..||||||+|+|...+......+..  ..+++++||+||.+|. ++..++  
T Consensus         2 ~~is~~~l~~~~~~~~~~iiDvR~~~e~~~ghi~gA~~ip~~~~~~~~~~~~~~~~~~~~~~ivvyC~~G~-rs~~a~--   78 (101)
T cd01518           2 TYLSPAEWNELLEDPEVVLLDVRNDYEYDIGHFKGAVNPDVDTFREFPFWLDENLDLLKGKKVLMYCTGGI-RCEKAS--   78 (101)
T ss_pred             CcCCHHHHHHHHcCCCEEEEEcCChhhhhcCEeccccCCCcccHhHhHHHHHhhhhhcCCCEEEEECCCch-hHHHHH--
Confidence            46899999999887789999999999999999999999998876543222211  1267889999999886 555554  


Q ss_pred             HHHHHHHHhhhcCCccEEEeccchhhhh
Q 032854           84 LANYLDEVKEDTGINSIFVLERGFKGWE  111 (132)
Q Consensus        84 l~~~L~~~~~~~G~~~v~~l~gG~~~w~  111 (132)
                        ..|..    .||++|++|+||+.+|.
T Consensus        79 --~~L~~----~G~~~v~~l~GG~~~W~  100 (101)
T cd01518          79 --AYLKE----RGFKNVYQLKGGILKYL  100 (101)
T ss_pred             --HHHHH----hCCcceeeechhHHHHh
Confidence              34544    89999999999999996

This CD includes Escherichia coli YceA, Bacillus subtilis YbfQ, and similar uncharacterized proteins.
>PRK00162 glpE thiosulfate sulfurtransferase; Validated Back     alignment and domain information
>cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 Back     alignment and domain information
>PLN02160 thiosulfate sulfurtransferase Back     alignment and domain information
>cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01531 Acr2p Eukaryotic arsenate resistance proteins are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily Back     alignment and domain information
>PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family Back     alignment and domain information
>TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein Back     alignment and domain information
>cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 Back     alignment and domain information
>cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 Back     alignment and domain information
>cd01521 RHOD_PspE2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain Back     alignment and domain information
>cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain Back     alignment and domain information
>cd01535 4RHOD_Repeat_4 Member of the Rhodanese Homology Domain superfamily, repeat 4 Back     alignment and domain information
>cd01530 Cdc25 Cdc25 phosphatases are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01525 RHOD_Kc Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>KOG1530 consensus Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>PRK01415 hypothetical protein; Validated Back     alignment and domain information
>cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>smart00450 RHOD Rhodanese Homology Domain Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1 Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>PRK05320 rhodanese superfamily protein; Provisional Back     alignment and domain information
>cd00158 RHOD Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01445 TST_Repeats Thiosulfate sulfurtransferases (TST) contain 2 copies of the Rhodanese Homology Domain Back     alignment and domain information
>TIGR02981 phageshock_pspE phage shock operon rhodanese PspE Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional Back     alignment and domain information
>cd01446 DSP_MapKP N-terminal regulatory rhodanese domain of dual specificity phosphatases (DSP), such as Mapk Phosphatase Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK11784 tRNA 2-selenouridine synthase; Provisional Back     alignment and domain information
>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>COG1054 Predicted sulfurtransferase [General function prediction only] Back     alignment and domain information
>KOG3772 consensus M-phase inducer phosphatase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] Back     alignment and domain information
>PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional Back     alignment and domain information
>KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] Back     alignment and domain information
>COG5105 MIH1 Mitotic inducer, protein phosphatase [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] Back     alignment and domain information
>KOG1717 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>COG2603 Predicted ATPase [General function prediction only] Back     alignment and domain information
>KOG3636 consensus Uncharacterized conserved protein, contains TBC and Rhodanese domains [General function prediction only] Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>KOG1093 consensus Predicted protein kinase (contains TBC and RHOD domains) [General function prediction only] Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase Back     alignment and domain information
>PLN02727 NAD kinase Back     alignment and domain information
>COG3453 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B Back     alignment and domain information
>PF14606 Lipase_GDSL_3: GDSL-like Lipase/Acylhydrolase family; PDB: 3SKV_B Back     alignment and domain information
>KOG1352 consensus Vacuolar H+-ATPase V1 sector, subunit A [Energy production and conversion] Back     alignment and domain information
>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>PF07755 DUF1611: Protein of unknown function (DUF1611); InterPro: IPR011669 This entry contains a number of hypothetical bacterial and archaeal proteins Back     alignment and domain information
>smart00195 DSPc Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>PRK11784 tRNA 2-selenouridine synthase; Provisional Back     alignment and domain information
>PF01451 LMWPc: Low molecular weight phosphotyrosine protein phosphatase; InterPro: IPR023485 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>PF02302 PTS_IIB: PTS system, Lactose/Cellobiose specific IIB subunit; InterPro: IPR003501 The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query132
1t3k_A152 Nmr Structure Of A Cdc25-Like Dual-Specificity Tyro 3e-55
2j6p_A152 Structure Of As-Sb Reductase From Leishmania Major 2e-08
3f4a_A169 Structure Of Ygr203w, A Yeast Protein Tyrosine Phos 3e-05
3fs5_A152 Crystal Structure Of Saccharomyces Cerevisiae Ygr20 4e-04
>pdb|1T3K|A Chain A, Nmr Structure Of A Cdc25-Like Dual-Specificity Tyrosine Phosphatase Of Arabidopsis Thaliana Length = 152 Back     alignment and structure 
Iteration: 1

 Score =  209 bits (532), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 97/126 (76%), Positives = 108/126 (85%)
Query: 1   MARSISYISGSQLLSLKRRPNIAVIDVRDDERSYDGHITGSLHYPSDSFTDKIFDLIQEV 60
           MARSISYI+ +QLL L RRPNIA+IDVRD+ER+YDGHI GSLHY S SF DKI  L+Q V
Sbjct: 23  MARSISYITSTQLLPLHRRPNIAIIDVRDEERNYDGHIAGSLHYASGSFDDKISHLVQNV 82
Query: 61  RGKDTLVFHCALSQVRGPTCAKRLANYLDEVKEDTGINSIFVLERGFKGWEASGKPVCRC 120
           + KDTLVFH ALSQVRGPTCA+RL NYLDE KEDTGI +I +LERGF GWEASGKPVCRC
Sbjct: 83  KDKDTLVFHSALSQVRGPTCARRLVNYLDEKKEDTGIKNIMILERGFNGWEASGKPVCRC 142
Query: 121 TDVPCK 126
            +VPCK
Sbjct: 143 AEVPCK 148
>pdb|2J6P|A Chain A, Structure Of As-Sb Reductase From Leishmania Major Length = 152 Back     alignment and structure
>pdb|3F4A|A Chain A, Structure Of Ygr203w, A Yeast Protein Tyrosine Phosphatase Of The Rhodanese Family Length = 169 Back     alignment and structure
>pdb|3FS5|A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Ygr203w, A Homolog Of Single-Domain Rhodanese And Cdc25 Phosphatase Catalytic Domain Length = 152 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query132
1t3k_A152 Arath CDC25, dual-specificity tyrosine phosphatase 6e-50
3f4a_A169 Uncharacterized protein YGR203W; protein phosphata 3e-26
2j6p_A152 SB(V)-AS(V) reductase; arsenate reductase, antimon 3e-26
1c25_A161 CDC25A; hydrolase, cell cycle phosphatase,dual spe 3e-22
2a2k_A175 M-phase inducer phosphatase 2; dual specificity, s 3e-22
3op3_A216 M-phase inducer phosphatase 3; structural genomics 1e-21
1qb0_A211 Protein (M-phase inducer phosphatase 2 (CDC25B)); 5e-21
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 1e-13
1yt8_A539 Thiosulfate sulfurtransferase; rhodanase domains, 5e-12
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 1e-07
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 2e-11
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 5e-11
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 2e-10
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 7e-10
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 9e-10
1tq1_A129 AT5G66040, senescence-associated family protein; C 3e-09
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 5e-09
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 6e-09
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 8e-09
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 1e-08
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 3e-08
3r2u_A466 Metallo-beta-lactamase family protein; structural 2e-07
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 2e-07
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 7e-07
1vee_A134 Proline-rich protein family; hypothetical protein, 2e-06
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 3e-06
3foj_A100 Uncharacterized protein; protein SSP1007, structur 3e-06
2gwf_A157 Ubiquitin carboxyl-terminal hydrolase 8; protein-p 4e-06
1whb_A157 KIAA0055; deubiqutinating enzyme, UBPY, structural 3e-05
3aay_A 277 Putative thiosulfate sulfurtransferase; sulfurtran 3e-05
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 1e-04
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 1e-04
3hzu_A 318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 3e-04
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 3e-04
2vsw_A153 Dual specificity protein phosphatase 16; hydrolase 4e-04
>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Length = 152 Back     alignment and structure
 Score =  155 bits (393), Expect = 6e-50
 Identities = 97/129 (75%), Positives = 109/129 (84%)

Query: 1   MARSISYISGSQLLSLKRRPNIAVIDVRDDERSYDGHITGSLHYPSDSFTDKIFDLIQEV 60
           MARSISYI+ +QLL L RRPNIA+IDVRD+ER+YDGHI GSLHY S SF DKI  L+Q V
Sbjct: 23  MARSISYITSTQLLPLHRRPNIAIIDVRDEERNYDGHIAGSLHYASGSFDDKISHLVQNV 82

Query: 61  RGKDTLVFHCALSQVRGPTCAKRLANYLDEVKEDTGINSIFVLERGFKGWEASGKPVCRC 120
           + KDTLVFH ALSQVRGPTCA+RL NYLDE KEDTGI +I +LERGF GWEASGKPVCRC
Sbjct: 83  KDKDTLVFHSALSQVRGPTCARRLVNYLDEKKEDTGIKNIMILERGFNGWEASGKPVCRC 142

Query: 121 TDVPCKEEN 129
            +VPCK + 
Sbjct: 143 AEVPCKGDC 151
>3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* Length = 169 Back     alignment and structure
>2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} Length = 152 Back     alignment and structure
>1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 Length = 161 Back     alignment and structure
>2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A Length = 175 Back     alignment and structure
>3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} Length = 216 Back     alignment and structure
>1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A Length = 211 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Length = 139 Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Length = 144 Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Length = 106 Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Length = 474 Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Length = 141 Back     alignment and structure
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Length = 129 Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Length = 108 Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Length = 124 Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Length = 137 Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Length = 139 Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Length = 466 Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Length = 108 Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Length = 110 Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Length = 134 Back     alignment and structure
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Length = 94 Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Length = 100 Back     alignment and structure
>2gwf_A Ubiquitin carboxyl-terminal hydrolase 8; protein-protein complex, E3 ligase, protein ubiquitination, hydrolase, protease, UBL conjugation pathway; 2.30A {Homo sapiens} SCOP: c.46.1.4 Length = 157 Back     alignment and structure
>1whb_A KIAA0055; deubiqutinating enzyme, UBPY, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; NMR {Homo sapiens} SCOP: c.46.1.4 Length = 157 Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Length = 277 Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Length = 148 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Length = 318 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 Back     alignment and structure
>2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A Length = 153 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query132
1t3k_A152 Arath CDC25, dual-specificity tyrosine phosphatase 99.97
3iwh_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 99.95
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 99.95
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 99.95
3foj_A100 Uncharacterized protein; protein SSP1007, structur 99.95
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 99.94
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 99.93
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 99.93
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 99.93
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 99.93
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 99.92
1tq1_A129 AT5G66040, senescence-associated family protein; C 99.92
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 99.92
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 99.92
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 99.91
2j6p_A152 SB(V)-AS(V) reductase; arsenate reductase, antimon 99.91
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 99.91
3f4a_A169 Uncharacterized protein YGR203W; protein phosphata 99.91
3hzu_A 318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 99.9
3i2v_A127 Adenylyltransferase and sulfurtransferase MOCS3; r 99.9
1e0c_A 271 Rhodanese, sulfurtransferase; sulfur metabolism, t 99.9
1urh_A 280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 99.9
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 99.9
2vsw_A153 Dual specificity protein phosphatase 16; hydrolase 99.89
1c25_A161 CDC25A; hydrolase, cell cycle phosphatase,dual spe 99.89
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 99.89
3aay_A 277 Putative thiosulfate sulfurtransferase; sulfurtran 99.89
1uar_A 285 Rhodanese; sulfurtransferase, riken structural gen 99.88
1vee_A134 Proline-rich protein family; hypothetical protein, 99.88
1qb0_A211 Protein (M-phase inducer phosphatase 2 (CDC25B)); 99.88
2ouc_A142 Dual specificity protein phosphatase 10; rhodanese 99.88
2a2k_A175 M-phase inducer phosphatase 2; dual specificity, s 99.88
4f67_A265 UPF0176 protein LPG2838; structural genomics, PSI- 99.87
1e0c_A271 Rhodanese, sulfurtransferase; sulfur metabolism, t 99.87
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 99.87
1rhs_A 296 Sulfur-substituted rhodanese; transferase, sulfurt 99.87
2jtq_A85 Phage shock protein E; solution structure rhodanes 99.87
3olh_A 302 MST, 3-mercaptopyruvate sulfurtransferase; structu 99.87
1urh_A280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 99.86
3op3_A216 M-phase inducer phosphatase 3; structural genomics 99.86
1rhs_A296 Sulfur-substituted rhodanese; transferase, sulfurt 99.86
1yt8_A539 Thiosulfate sulfurtransferase; rhodanase domains, 99.86
1hzm_A154 Dual specificity protein phosphatase 6; hydrolase; 99.85
1uar_A285 Rhodanese; sulfurtransferase, riken structural gen 99.84
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 99.84
2wlr_A423 Putative thiosulfate sulfurtransferase YNJE; rhoda 99.83
3hzu_A318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 99.83
3olh_A302 MST, 3-mercaptopyruvate sulfurtransferase; structu 99.83
1okg_A 373 Possible 3-mercaptopyruvate sulfurtransferase; rho 99.82
3aay_A277 Putative thiosulfate sulfurtransferase; sulfurtran 99.82
2eg4_A230 Probable thiosulfate sulfurtransferase; structural 99.82
1whb_A157 KIAA0055; deubiqutinating enzyme, UBPY, structural 99.81
2gwf_A157 Ubiquitin carboxyl-terminal hydrolase 8; protein-p 99.81
2wlr_A 423 Putative thiosulfate sulfurtransferase YNJE; rhoda 99.8
3tg1_B158 Dual specificity protein phosphatase 10; kinase/rh 99.8
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 99.78
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 99.75
1okg_A373 Possible 3-mercaptopyruvate sulfurtransferase; rho 99.74
2eg4_A 230 Probable thiosulfate sulfurtransferase; structural 99.74
3r2u_A466 Metallo-beta-lactamase family protein; structural 99.72
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 99.7
3utn_X 327 Thiosulfate sulfurtransferase TUM1; rhodanese-like 99.7
3utn_X327 Thiosulfate sulfurtransferase TUM1; rhodanese-like 99.6
3r2u_A466 Metallo-beta-lactamase family protein; structural 99.27
2f46_A156 Hypothetical protein; structural genomics, joint c 97.93
4erc_A150 Dual specificity protein phosphatase 23; alpha bet 94.33
1v8c_A168 MOAD related protein; riken structural genomics/pr 93.82
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 93.5
1xri_A151 AT1G05000; structural genomics, protein structure 88.62
2hcm_A164 Dual specificity protein phosphatase; structural g 88.08
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 87.28
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 86.48
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 85.55
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 85.14
1ywf_A 296 Phosphotyrosine protein phosphatase PTPB; four str 84.9
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 84.77
3rof_A158 Low molecular weight protein-tyrosine-phosphatase; 83.86
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 83.42
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 83.28
2cwd_A161 Low molecular weight phosphotyrosine protein PHOS; 81.52
2q05_A195 Late protein H1, dual specificity protein phosphat 81.28
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 81.23
>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Back     alignment and structure
Probab=99.97  E-value=5.1e-31  Score=175.41  Aligned_cols=126  Identities=72%  Similarity=1.240  Sum_probs=107.9

Q ss_pred             CCcccccHHHHHhhhCCCCeEEEeeCCCCCcCCCccCCccccCccchhHHHHHHHHHhcCCCEEEEEcC-CCCCCcHHHH
Q 032854            3 RSISYISGSQLLSLKRRPNIAVIDVRDDERSYDGHITGSLHYPSDSFTDKIFDLIQEVRGKDTLVFHCA-LSQVRGPTCA   81 (132)
Q Consensus         3 ~~~~~is~~~~~~~~~~~~~~liD~R~~~e~~~~hI~gai~ip~~~~~~~~~~~~~~~~~~~~ivv~c~-~g~~~~~~~a   81 (132)
                      +.+..|+++++.+++++++.+|||+|++.+|..||||||+|+|...+...+.++...++++++||+||. +|. ++..++
T Consensus        25 ~~~~~Is~~el~~~l~~~~~~lIDvR~~~ey~~ghIpgAinip~~~l~~~~~~l~~~~~~~~~iVvyC~~~G~-rs~~aa  103 (152)
T 1t3k_A           25 RSISYITSTQLLPLHRRPNIAIIDVRDEERNYDGHIAGSLHYASGSFDDKISHLVQNVKDKDTLVFHSALSQV-RGPTCA  103 (152)
T ss_dssp             SSSEEECTTTTTTCCCCTTEEEEEESCSHHHHSSCCCSSEEECCSSSSTTHHHHHHTCCSCCEEEESSSCCSS-SHHHHH
T ss_pred             CCCceECHHHHHHHhcCCCEEEEECCChhhccCccCCCCEECCHHHHHHHHHHHHHhcCCCCEEEEEcCCCCc-chHHHH
Confidence            467889999999988877899999999999999999999999999988877777666678899999999 765 777777


Q ss_pred             HHHHHHHHHHhhhcCCccEEEeccchhhhhhcCCCccccCCCcccccc
Q 032854           82 KRLANYLDEVKEDTGINSIFVLERGFKGWEASGKPVCRCTDVPCKEEN  129 (132)
Q Consensus        82 ~~l~~~L~~~~~~~G~~~v~~l~gG~~~w~~~g~p~~~~~~~~~~~~~  129 (132)
                      ..|...|...|+..||++|++|+||+.+|.++|+|+++....+|++.|
T Consensus       104 ~~L~~~l~~~L~~~G~~~V~~L~GG~~~W~~~g~p~~~~~~~~c~~~~  151 (152)
T 1t3k_A          104 RRLVNYLDEKKEDTGIKNIMILERGFNGWEASGKPVCRCAEVPCKGDC  151 (152)
T ss_dssp             HHHHHHHHHSSSCCCSSEEEEESSTTHHHHHHSCSSCCCSCSSCSSCC
T ss_pred             HHHHHHHHHHHHhcCCCcEEEEcCCHHHHHHcCCccccCCCCCCCCCC
Confidence            655443433335589999999999999999999999999999999877
>3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Back     alignment and structure
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Back     alignment and structure
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Back     alignment and structure
>2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Back     alignment and structure
>3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A Back     alignment and structure
>1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Back     alignment and structure
>1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A Back     alignment and structure
>2ouc_A Dual specificity protein phosphatase 10; rhodanese fold, hydrolase; 2.20A {Homo sapiens} Back     alignment and structure
>2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A Back     alignment and structure
>4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>1hzm_A Dual specificity protein phosphatase 6; hydrolase; NMR {Homo sapiens} SCOP: c.46.1.1 Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>1whb_A KIAA0055; deubiqutinating enzyme, UBPY, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; NMR {Homo sapiens} SCOP: c.46.1.4 Back     alignment and structure
>2gwf_A Ubiquitin carboxyl-terminal hydrolase 8; protein-protein complex, E3 ligase, protein ubiquitination, hydrolase, protease, UBL conjugation pathway; 2.30A {Homo sapiens} SCOP: c.46.1.4 Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>3tg1_B Dual specificity protein phosphatase 10; kinase/rhodanese-like domain, docking interaction, transfera hydrolase complex; 2.71A {Homo sapiens} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A Back     alignment and structure
>1v8c_A MOAD related protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, protein binding; 1.60A {Thermus thermophilus} SCOP: d.15.3.1 d.129.5.1 Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Back     alignment and structure
>1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* Back     alignment and structure
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Back     alignment and structure
>3rof_A Low molecular weight protein-tyrosine-phosphatase; phosphatase, hydrolase; 1.03A {Staphylococcus aureus} Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Back     alignment and structure
>2cwd_A Low molecular weight phosphotyrosine protein PHOS; tyrosine phosphatase, structural genomics; 1.90A {Thermus thermophilus} Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 132
d1t3ka_132 c.46.1.1 (A:) Dual specificity phosphatase Cdc25 { 2e-25
d1c25a_161 c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 4e-17
d2gwfa1135 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal h 1e-14
d1ymka1174 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) 3e-14
d1yt8a1136 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase 2e-09
d1tq1a_119 c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senesc 1e-08
d1uara1143 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus ther 1e-08
d1yt8a2101 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase P 1e-07
d1gmxa_108 c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia 6e-07
d1e0ca1135 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter 7e-07
d1hzma_154 c.46.1.1 (A:) Erk2 binding domain of Mapk phosphat 1e-06
d1qxna_137 c.46.1.3 (A:) Polysulfide-sulfur transferase (sulf 3e-06
d1yt8a3157 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase 5e-06
d1rhsa1149 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [Ta 9e-05
d1yt8a4130 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase 2e-04
d1urha1147 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransf 3e-04
d1okga1156 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransf 0.004
>d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 132 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Rhodanese/Cell cycle control phosphatase
superfamily: Rhodanese/Cell cycle control phosphatase
family: Cell cycle control phosphatase, catalytic domain
domain: Dual specificity phosphatase Cdc25
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 91.7 bits (226), Expect = 2e-25
 Identities = 97/128 (75%), Positives = 109/128 (85%)

Query: 1   MARSISYISGSQLLSLKRRPNIAVIDVRDDERSYDGHITGSLHYPSDSFTDKIFDLIQEV 60
           MARSISYI+ +QLL L RRPNIA+IDVRD+ER+YDGHI GSLHY S SF DKI  L+Q V
Sbjct: 3   MARSISYITSTQLLPLHRRPNIAIIDVRDEERNYDGHIAGSLHYASGSFDDKISHLVQNV 62

Query: 61  RGKDTLVFHCALSQVRGPTCAKRLANYLDEVKEDTGINSIFVLERGFKGWEASGKPVCRC 120
           + KDTLVFH ALSQVRGPTCA+RL NYLDE KEDTGI +I +LERGF GWEASGKPVCRC
Sbjct: 63  KDKDTLVFHSALSQVRGPTCARRLVNYLDEKKEDTGIKNIMILERGFNGWEASGKPVCRC 122

Query: 121 TDVPCKEE 128
            +VPCK +
Sbjct: 123 AEVPCKGD 130
>d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Length = 135 Back     information, alignment and structure
>d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 136 Back     information, alignment and structure
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 119 Back     information, alignment and structure
>d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Length = 143 Back     information, alignment and structure
>d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 101 Back     information, alignment and structure
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Length = 108 Back     information, alignment and structure
>d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Length = 135 Back     information, alignment and structure
>d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Length = 137 Back     information, alignment and structure
>d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 157 Back     information, alignment and structure
>d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Length = 149 Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 130 Back     information, alignment and structure
>d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Length = 147 Back     information, alignment and structure
>d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query132
d1t3ka_132 Dual specificity phosphatase Cdc25 {Thale cress (A 100.0
d1yt8a1136 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.94
d1yt8a3157 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.94
d1gmxa_108 Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 99.94
d1e0ca1135 Sulfurtransferase {Azotobacter vinelandii [TaxId: 99.92
d1yt8a2101 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.92
d1uara1143 Sulfurtransferase {Thermus thermophilus [TaxId: 27 99.92
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 99.92
d1urha1147 3-mercaptopyruvate sulfurtransferase {Escherichia 99.92
d1qxna_137 Polysulfide-sulfur transferase (sulfide dehydrogen 99.91
d1e0ca2136 Sulfurtransferase {Azotobacter vinelandii [TaxId: 99.91
d1rhsa1149 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 99.9
d1yt8a4130 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.89
d1rhsa2144 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 99.87
d1okga1156 3-mercaptopyruvate sulfurtransferase {Leishmania m 99.86
d1uara2141 Sulfurtransferase {Thermus thermophilus [TaxId: 27 99.86
d1c25a_161 CDC25a {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1ymka1174 CDC25b {Human (Homo sapiens) [TaxId: 9606]} 99.85
d2gwfa1135 Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Hum 99.83
d1urha2120 3-mercaptopyruvate sulfurtransferase {Escherichia 99.8
d1okga2139 3-mercaptopyruvate sulfurtransferase {Leishmania m 99.79
d1hzma_154 Erk2 binding domain of Mapk phosphatase mkp-3 {Hum 99.75
d1xria_151 Putative phosphatase At1g05000 {Thale cress (Arabi 91.3
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 90.14
d1ywfa1 272 Phosphotyrosine protein phosphatase PtpB {Mycobact 88.84
d1vkra_97 PTS system mannitol-specific EIICBA component {Esc 85.93
d1m3ga_145 Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax 80.13
>d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Rhodanese/Cell cycle control phosphatase
superfamily: Rhodanese/Cell cycle control phosphatase
family: Cell cycle control phosphatase, catalytic domain
domain: Dual specificity phosphatase Cdc25
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=100.00  E-value=2.6e-34  Score=185.65  Aligned_cols=129  Identities=75%  Similarity=1.269  Sum_probs=117.9

Q ss_pred             CCCCcccccHHHHHhhhCCCCeEEEeeCCCCCcCCCccCCccccCccchhHHHHHHHHHhcCCCEEEEEcCCCCCCcHHH
Q 032854            1 MARSISYISGSQLLSLKRRPNIAVIDVRDDERSYDGHITGSLHYPSDSFTDKIFDLIQEVRGKDTLVFHCALSQVRGPTC   80 (132)
Q Consensus         1 ~a~~~~~is~~~~~~~~~~~~~~liD~R~~~e~~~~hI~gai~ip~~~~~~~~~~~~~~~~~~~~ivv~c~~g~~~~~~~   80 (132)
                      |+++++.|+++|+.+++++++.+|||+|++.+|..||||||+|+|...|...+..+.+...+++++|+||..|..++..+
T Consensus         3 ~~~~v~~I~~~el~~~~~~~~v~iIDvR~~~e~~~ghIpgAinip~~~~~~~~~~~~~~~~~~~~iv~~c~~~~~~~~~a   82 (132)
T d1t3ka_           3 MARSISYITSTQLLPLHRRPNIAIIDVRDEERNYDGHIAGSLHYASGSFDDKISHLVQNVKDKDTLVFHSALSQVRGPTC   82 (132)
T ss_dssp             CCSSSEEECTTTTTTCCCCTTEEEEEESCSHHHHSSCCCSSEEECCSSSSTTHHHHHHTCCSCCEEEESSSCCSSSHHHH
T ss_pred             cccCCCEECHHHHHHHHhCCCeEEEEccCHHHHHhccCcccceeeeecccccccccccccccccceEEEeccccccchHH
Confidence            44589999999999999988899999999999999999999999999998888888888788899999999888788888


Q ss_pred             HHHHHHHHHHHhhhcCCccEEEeccchhhhhhcCCCccccCCCcccccc
Q 032854           81 AKRLANYLDEVKEDTGINSIFVLERGFKGWEASGKPVCRCTDVPCKEEN  129 (132)
Q Consensus        81 a~~l~~~L~~~~~~~G~~~v~~l~gG~~~w~~~g~p~~~~~~~~~~~~~  129 (132)
                      +..+...+...+...||++|++|+||+.+|.++|+|++++...|++++|
T Consensus        83 a~~l~~~~~~~l~~~G~~~v~~l~GG~~~W~~~g~pv~~~~~~p~~~~~  131 (132)
T d1t3ka_          83 ARRLVNYLDEKKEDTGIKNIMILERGFNGWEASGKPVCRCAEVPCKGDC  131 (132)
T ss_dssp             HHHHHHHHHHSSSCCCSSEEEEESSTTHHHHHHSCSSCCCSCSSCSSCC
T ss_pred             HHHHHHHHHHHHHhcCCCEEEEeCChHHHHHHcCCCcccCCCCCCCCCC
Confidence            8777777766677789999999999999999999999999999999988
>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vkra_ c.44.2.1 (A:) PTS system mannitol-specific EIICBA component {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Back     information, alignment and structure