Citrus Sinensis ID: 032895
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 131 | ||||||
| 224143487 | 138 | predicted protein [Populus trichocarpa] | 0.946 | 0.898 | 0.801 | 4e-51 | |
| 255549056 | 136 | chloroplast-targeted copper chaperone, p | 0.938 | 0.904 | 0.793 | 7e-49 | |
| 225445302 | 134 | PREDICTED: uncharacterized protein LOC10 | 0.961 | 0.940 | 0.742 | 2e-48 | |
| 357500407 | 135 | hypothetical protein MTR_6g086020 [Medic | 0.900 | 0.874 | 0.714 | 1e-41 | |
| 357521067 | 132 | hypothetical protein MTR_8g103820 [Medic | 0.900 | 0.893 | 0.741 | 2e-41 | |
| 356520571 | 135 | PREDICTED: uncharacterized protein LOC10 | 0.900 | 0.874 | 0.697 | 6e-41 | |
| 217070984 | 135 | unknown [Medicago truncatula] | 0.900 | 0.874 | 0.705 | 7e-41 | |
| 356513125 | 132 | PREDICTED: uncharacterized protein LOC10 | 0.923 | 0.916 | 0.701 | 5e-40 | |
| 356531236 | 135 | PREDICTED: uncharacterized protein LOC10 | 0.931 | 0.903 | 0.658 | 9e-40 | |
| 388495864 | 135 | unknown [Lotus japonicus] | 0.900 | 0.874 | 0.672 | 3e-39 |
| >gi|224143487|ref|XP_002324972.1| predicted protein [Populus trichocarpa] gi|222866406|gb|EEF03537.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 206 bits (523), Expect = 4e-51, Method: Compositional matrix adjust.
Identities = 101/126 (80%), Positives = 116/126 (92%), Gaps = 2/126 (1%)
Query: 1 MGNLSLGKILDCLCISSPGS-CSCFCLNTFEGQDE-FEKKPLMKSDGGQLLRLKDVVSGN 58
MG LSLGK+LDCLC ++PGS CSCFC+N+ + QD+ FEKKPL+ SD G+L+RLKDVV+ N
Sbjct: 1 MGKLSLGKVLDCLCFTTPGSSCSCFCINSLDSQDDGFEKKPLIPSDKGRLVRLKDVVADN 60
Query: 59 QTLAFQLKPKMVVLRVSMHCNGCARKVEKHVSKLEGVTSYKVDLASKMVVVIGDIIPFEV 118
QTLAFQLKPKMVVLRVSMHCNGCARKV+KHVSK+EGV+SYKVDL SKMVVVIGDIIPFEV
Sbjct: 61 QTLAFQLKPKMVVLRVSMHCNGCARKVKKHVSKMEGVSSYKVDLESKMVVVIGDIIPFEV 120
Query: 119 LESVSK 124
LESVS+
Sbjct: 121 LESVSR 126
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255549056|ref|XP_002515584.1| chloroplast-targeted copper chaperone, putative [Ricinus communis] gi|223545528|gb|EEF47033.1| chloroplast-targeted copper chaperone, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|225445302|ref|XP_002284677.1| PREDICTED: uncharacterized protein LOC100244080 [Vitis vinifera] gi|297738856|emb|CBI28101.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357500407|ref|XP_003620492.1| hypothetical protein MTR_6g086020 [Medicago truncatula] gi|355495507|gb|AES76710.1| hypothetical protein MTR_6g086020 [Medicago truncatula] gi|388493690|gb|AFK34911.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357521067|ref|XP_003630822.1| hypothetical protein MTR_8g103820 [Medicago truncatula] gi|355524844|gb|AET05298.1| hypothetical protein MTR_8g103820 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356520571|ref|XP_003528935.1| PREDICTED: uncharacterized protein LOC100795735 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|217070984|gb|ACJ83852.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356513125|ref|XP_003525264.1| PREDICTED: uncharacterized protein LOC100816650 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356531236|ref|XP_003534184.1| PREDICTED: uncharacterized protein LOC100788037 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|388495864|gb|AFK35998.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 131 | ||||||
| TAIR|locus:2094864 | 140 | AT3G24450 "AT3G24450" [Arabido | 0.938 | 0.878 | 0.580 | 4.6e-34 | |
| TAIR|locus:2049731 | 259 | NAKR2 "AT2G37390" [Arabidopsis | 0.435 | 0.220 | 0.543 | 1.2e-16 | |
| TAIR|locus:2181718 | 319 | NAKR1 "SODIUM POTASSIUM ROOT D | 0.435 | 0.178 | 0.631 | 2.6e-15 | |
| TAIR|locus:2065526 | 265 | AT2G28660 "AT2G28660" [Arabido | 0.435 | 0.215 | 0.614 | 4.2e-15 | |
| TAIR|locus:2083966 | 248 | NAKR3 "SODIUM POTASSIUM ROOT D | 0.435 | 0.229 | 0.583 | 1.2e-12 | |
| TAIR|locus:2180265 | 352 | AT5G27690 [Arabidopsis thalian | 0.419 | 0.156 | 0.436 | 2.4e-08 | |
| TAIR|locus:2205288 | 106 | ATX1 "homolog of anti-oxidant | 0.419 | 0.518 | 0.454 | 4.2e-08 | |
| TAIR|locus:2078461 | 121 | CCH "copper chaperone" [Arabid | 0.419 | 0.454 | 0.418 | 1.8e-07 | |
| TAIR|locus:2089870 | 136 | AT3G21490 "AT3G21490" [Arabido | 0.419 | 0.404 | 0.418 | 2.3e-07 | |
| TAIR|locus:2096204 | 577 | AT3G05220 [Arabidopsis thalian | 0.465 | 0.105 | 0.409 | 2.4e-07 |
| TAIR|locus:2094864 AT3G24450 "AT3G24450" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 370 (135.3 bits), Expect = 4.6e-34, P = 4.6e-34
Identities = 76/131 (58%), Positives = 101/131 (77%)
Query: 1 MGNLS-LGKILDCLCISSPGSCSCFCLNTF-EGQDEFEKKPLMKSD---GGQLLRLKDVV 55
MG L +G++ DCL + + CSCFCLNT + ++EFEK+PL+ S G+++RLKDVV
Sbjct: 1 MGKLQKIGRVWDCLFLPT-NQCSCFCLNTLGDEEEEFEKEPLIDSSTEKSGKVMRLKDVV 59
Query: 56 SGN--QTLAFQLKPKMVVLRVSMHCNGCARKVEKHVSKLEGVTSYKVDLASKMVVVIGDI 113
+ + QTLAF LKPK+V L+VSMHC GCA+KVEKH+SKL+GVT YKV+L SK VVV G+I
Sbjct: 60 AADHRQTLAFHLKPKIVELKVSMHCYGCAKKVEKHISKLDGVTWYKVELESKKVVVKGNI 119
Query: 114 IPFEVLESVSK 124
+P +VLES+ K
Sbjct: 120 LPVDVLESICK 130
|
|
| TAIR|locus:2049731 NAKR2 "AT2G37390" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2181718 NAKR1 "SODIUM POTASSIUM ROOT DEFECTIVE 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2065526 AT2G28660 "AT2G28660" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2083966 NAKR3 "SODIUM POTASSIUM ROOT DEFECTIVE 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2180265 AT5G27690 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2205288 ATX1 "homolog of anti-oxidant 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2078461 CCH "copper chaperone" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2089870 AT3G21490 "AT3G21490" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2096204 AT3G05220 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 131 | |||
| cd00371 | 63 | cd00371, HMA, Heavy-metal-associated domain (HMA) | 3e-12 | |
| pfam00403 | 62 | pfam00403, HMA, Heavy-metal-associated domain | 4e-12 | |
| COG2608 | 71 | COG2608, CopZ, Copper chaperone [Inorganic ion tra | 7e-08 | |
| PRK11033 | 741 | PRK11033, zntA, zinc/cadmium/mercury/lead-transpor | 6e-06 | |
| COG2217 | 713 | COG2217, ZntA, Cation transport ATPase [Inorganic | 8e-06 | |
| PRK10671 | 834 | PRK10671, copA, copper exporting ATPase; Provision | 5e-05 | |
| PLN02957 | 238 | PLN02957, PLN02957, copper, zinc superoxide dismut | 8e-05 | |
| TIGR00003 | 66 | TIGR00003, TIGR00003, copper ion binding protein | 9e-05 | |
| TIGR02052 | 92 | TIGR02052, MerP, mercuric transport protein peripl | 0.001 |
| >gnl|CDD|238219 cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones | Back alignment and domain information |
|---|
Score = 57.2 bits (139), Expect = 3e-12
Identities = 24/59 (40%), Positives = 32/59 (54%), Gaps = 3/59 (5%)
Query: 71 VLRVS-MHCNGCARKVEKHVSKLEGVTSYKVDLASKMVVVIGD--IIPFEVLESVSKAH 126
L V M C GC K+EK + KL GV S +VDL + V D + P E+LE++ A
Sbjct: 1 ELSVEGMTCAGCVSKIEKALEKLPGVESVEVDLETGKATVEYDPEVSPEELLEAIEDAG 59
|
HMA domain contains two cysteine residues that are important in binding and transfer of metal ions, such as copper, cadmium, cobalt and zinc. In the case of copper, stoichiometry of binding is one Cu+ ion per binding domain. Repeats of the HMA domain in copper chaperone has been associated with Menkes/Wilson disease due to binding of multiple copper ions. Length = 63 |
| >gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain | Back alignment and domain information |
|---|
| >gnl|CDD|225328 COG2608, CopZ, Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|236827 PRK11033, zntA, zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225127 COG2217, ZntA, Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|182635 PRK10671, copA, copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215516 PLN02957, PLN02957, copper, zinc superoxide dismutase | Back alignment and domain information |
|---|
| >gnl|CDD|188014 TIGR00003, TIGR00003, copper ion binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|131107 TIGR02052, MerP, mercuric transport protein periplasmic component | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 131 | |||
| PF00403 | 62 | HMA: Heavy-metal-associated domain; InterPro: IPR0 | 99.54 | |
| COG2608 | 71 | CopZ Copper chaperone [Inorganic ion transport and | 99.44 | |
| KOG1603 | 73 | consensus Copper chaperone [Inorganic ion transpor | 98.72 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 98.58 | |
| KOG4656 | 247 | consensus Copper chaperone for superoxide dismutas | 98.57 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 98.48 | |
| PLN02957 | 238 | copper, zinc superoxide dismutase | 98.44 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 98.29 | |
| TIGR00003 | 68 | copper ion binding protein. This model describes a | 98.26 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 98.24 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 98.16 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 97.62 | |
| TIGR02052 | 92 | MerP mercuric transport protein periplasmic compon | 94.76 | |
| cd00371 | 63 | HMA Heavy-metal-associated domain (HMA) is a conse | 91.95 | |
| PRK13748 | 561 | putative mercuric reductase; Provisional | 90.72 | |
| PF01206 | 70 | TusA: Sulfurtransferase TusA; InterPro: IPR001455 | 90.1 | |
| PRK14054 | 172 | methionine sulfoxide reductase A; Provisional | 88.61 | |
| PRK11018 | 78 | hypothetical protein; Provisional | 85.1 | |
| PRK05528 | 156 | methionine sulfoxide reductase A; Provisional | 83.72 | |
| PRK13014 | 186 | methionine sulfoxide reductase A; Provisional | 83.7 |
| >PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures | Back alignment and domain information |
|---|
Probab=99.54 E-value=5.6e-14 Score=85.72 Aligned_cols=58 Identities=47% Similarity=0.652 Sum_probs=54.4
Q ss_pred EEEE-cCcChhHHHHHHHHHhCCCCeeEEEEecCCCEEEEEecC---CHHHHHHHHHhCCCC
Q 032895 71 VLRV-SMHCNGCARKVEKHVSKLEGVTSYKVDLASKMVVVIGDI---IPFEVLESVSKAHLF 128 (131)
Q Consensus 71 ~l~V-Gm~C~~C~~~Ie~~L~~l~GV~~v~vnl~~~~~~V~~~~---~~~~I~~~I~~~Gy~ 128 (131)
+|.| ||+|++|+.+|+++|.+++||.++.+|+.+++++|.++. ++++|.++|+++||+
T Consensus 1 t~~v~~m~C~~C~~~v~~~l~~~~GV~~v~vd~~~~~v~v~~~~~~~~~~~i~~~i~~~Gy~ 62 (62)
T PF00403_consen 1 TFKVPGMTCEGCAKKVEKALSKLPGVKSVKVDLETKTVTVTYDPDKTSIEKIIEAIEKAGYE 62 (62)
T ss_dssp EEEEESTTSHHHHHHHHHHHHTSTTEEEEEEETTTTEEEEEESTTTSCHHHHHHHHHHTTSE
T ss_pred CEEECCcccHHHHHHHHHHHhcCCCCcEEEEECCCCEEEEEEecCCCCHHHHHHHHHHhCcC
Confidence 5889 999999999999999999999999999999999999984 459999999999994
|
These proteins provide an important focus for research, some being involved in bacterial resistance to toxic metals, such as lead and cadmium, while others are involved in inherited human syndromes, such as Wilson's and Menke's diseases []. A conserved domain has been found in a number of these heavy metal transport or detoxification proteins []. The domain, which has been termed Heavy-Metal-Associated (HMA), contains two conserved cysteines that are probably involved in metal binding. Structure solution of the fourth HMA domain of the Menke's copper transporting ATPase shows a well-defined structure comprising a four-stranded antiparallel beta-sheet and two alpha helices packed in an alpha-beta sandwich fold []. This fold is common to other domains and is classified as "ferredoxin-like".; GO: 0046872 metal ion binding, 0030001 metal ion transport; PDB: 2VOY_A 1P6T_A 1KQK_A 2RML_A 1JWW_A 3K7R_F 1FES_A 1CC8_A 1FD8_A 2GGP_A .... |
| >COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >PLN02957 copper, zinc superoxide dismutase | Back alignment and domain information |
|---|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00003 copper ion binding protein | Back alignment and domain information |
|---|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR02052 MerP mercuric transport protein periplasmic component | Back alignment and domain information |
|---|
| >cd00371 HMA Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones | Back alignment and domain information |
|---|
| >PRK13748 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PF01206 TusA: Sulfurtransferase TusA; InterPro: IPR001455 SirA functions as a response regulator as part of a two-component system, where BarA is the sensor kinase | Back alignment and domain information |
|---|
| >PRK14054 methionine sulfoxide reductase A; Provisional | Back alignment and domain information |
|---|
| >PRK11018 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05528 methionine sulfoxide reductase A; Provisional | Back alignment and domain information |
|---|
| >PRK13014 methionine sulfoxide reductase A; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 131 | |||
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 6e-17 | |
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 6e-14 | |
| 1qup_A | 222 | Superoxide dismutase 1 copper chaperone; two domai | 6e-14 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 2e-13 | |
| 1jk9_B | 249 | CCS, copper chaperone for superoxide dismutase; pr | 6e-13 | |
| 2roe_A | 66 | Heavy metal binding protein; NMR {Thermus thermoph | 6e-12 | |
| 2k2p_A | 85 | Uncharacterized protein ATU1203; putative metal-bi | 4e-11 | |
| 2aj0_A | 71 | Probable cadmium-transporting ATPase; ferrodoxin-l | 1e-10 | |
| 2kkh_A | 95 | Putative heavy metal transporter; zinc transport, | 5e-10 | |
| 2g9o_A | 90 | Copper-transporting ATPase 1; menkes disease, solu | 7e-10 | |
| 1mwy_A | 73 | ZNTA; open-faced beta-sandwich fold, beta-alpha-be | 1e-09 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 1e-09 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 2e-08 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 2e-09 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 1e-08 | |
| 1yg0_A | 66 | COP associated protein; open-faced beta-sandwich, | 2e-09 | |
| 2kt2_A | 69 | Mercuric reductase; nmera, MERA, HMA domain, mercu | 2e-09 | |
| 2l3m_A | 71 | Copper-ION-binding protein; structural genomics, c | 4e-09 | |
| 2qif_A | 69 | Copper chaperone COPZ; tetranuclear Cu(I) cluster; | 5e-09 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 5e-09 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 4e-08 | |
| 3cjk_B | 75 | Copper-transporting ATPase 1; HAH1, ATP7B, menkes | 6e-09 | |
| 1kvi_A | 79 | Copper-transporting ATPase 1; menkes, Cu-protein, | 7e-09 | |
| 1aw0_A | 72 | Menkes copper-transporting ATPase; copper-binding | 1e-08 | |
| 1q8l_A | 84 | Copper-transporting ATPase 1; metal binding protei | 1e-08 | |
| 1osd_A | 72 | MERP, hypothetical protein MERP; mercury resistanc | 1e-08 | |
| 1cpz_A | 68 | Protein (COPZ); copper chaperone, metal transport, | 2e-08 | |
| 1fvq_A | 72 | Copper-transporting ATPase; APO-CCC2A, hydrolase; | 2e-08 | |
| 2xmm_A | 64 | SSR2857 protein, ATX1; metal transport, copper hom | 2e-08 | |
| 3dxs_X | 74 | Copper-transporting ATPase RAN1; CXXC motif, ferre | 3e-08 | |
| 1y3j_A | 77 | Copper-transporting ATPase 1; ferrodoxin-like fold | 5e-08 | |
| 2ldi_A | 71 | Zinc-transporting ATPase; metal homeostasis, metal | 5e-08 | |
| 2xmw_A | 71 | PACS-N, cation-transporting ATPase PACS; hydrolase | 1e-07 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 2e-07 | |
| 1jww_A | 80 | Potential copper-transporting ATPase; beta-alpha-b | 3e-07 | |
| 1opz_A | 76 | Potential copper-transporting ATPase; mutation, fo | 3e-07 | |
| 2ofg_X | 111 | Zinc-transporting ATPase; ferredoxin-like fold, be | 3e-07 | |
| 1yjr_A | 75 | Copper-transporting ATPase 1; metallochaperone, pr | 6e-07 | |
| 2kyz_A | 67 | Heavy metal binding protein; structural genomics, | 1e-05 | |
| 3fry_A | 73 | Probable copper-exporting P-type ATPase A; transpo | 2e-05 |
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
Score = 69.5 bits (170), Expect = 6e-17
Identities = 15/56 (26%), Positives = 23/56 (41%)
Query: 70 VVLRVSMHCNGCARKVEKHVSKLEGVTSYKVDLASKMVVVIGDIIPFEVLESVSKA 125
+ V M C C V K + + GV +V L +MV+V + EV +
Sbjct: 21 LEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGT 76
|
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Length = 68 | Back alignment and structure |
|---|
| >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 222 | Back alignment and structure |
|---|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Length = 73 | Back alignment and structure |
|---|
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 249 | Back alignment and structure |
|---|
| >2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Length = 66 | Back alignment and structure |
|---|
| >2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Length = 85 | Back alignment and structure |
|---|
| >2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Length = 71 | Back alignment and structure |
|---|
| >2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Length = 95 | Back alignment and structure |
|---|
| >2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Length = 90 | Back alignment and structure |
|---|
| >1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Length = 73 | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Length = 151 | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Length = 151 | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202 | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202 | Back alignment and structure |
|---|
| >1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Length = 66 | Back alignment and structure |
|---|
| >2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Length = 69 | Back alignment and structure |
|---|
| >2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Length = 71 | Back alignment and structure |
|---|
| >2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Length = 69 | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Length = 75 | Back alignment and structure |
|---|
| >1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Length = 79 | Back alignment and structure |
|---|
| >1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Length = 72 | Back alignment and structure |
|---|
| >1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Length = 84 | Back alignment and structure |
|---|
| >1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Length = 72 | Back alignment and structure |
|---|
| >1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Length = 68 | Back alignment and structure |
|---|
| >1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Length = 72 | Back alignment and structure |
|---|
| >2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Length = 64 | Back alignment and structure |
|---|
| >3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} Length = 74 | Back alignment and structure |
|---|
| >1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Length = 77 | Back alignment and structure |
|---|
| >2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Length = 71 | Back alignment and structure |
|---|
| >2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Length = 71 | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Length = 723 | Back alignment and structure |
|---|
| >1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Length = 80 | Back alignment and structure |
|---|
| >1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Length = 76 | Back alignment and structure |
|---|
| >1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Length = 75 | Back alignment and structure |
|---|
| >2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Length = 67 | Back alignment and structure |
|---|
| >3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Length = 73 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 131 | |||
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 99.54 | |
| 3dxs_X | 74 | Copper-transporting ATPase RAN1; CXXC motif, ferre | 99.53 | |
| 4a4j_A | 69 | Pacszia, cation-transporting ATPase PACS; hydrolas | 99.52 | |
| 3fry_A | 73 | Probable copper-exporting P-type ATPase A; transpo | 99.48 | |
| 2qif_A | 69 | Copper chaperone COPZ; tetranuclear Cu(I) cluster; | 99.43 | |
| 2l3m_A | 71 | Copper-ION-binding protein; structural genomics, c | 99.41 | |
| 2xmm_A | 64 | SSR2857 protein, ATX1; metal transport, copper hom | 99.41 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 99.4 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 99.38 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 99.37 | |
| 1mwy_A | 73 | ZNTA; open-faced beta-sandwich fold, beta-alpha-be | 99.37 | |
| 2k2p_A | 85 | Uncharacterized protein ATU1203; putative metal-bi | 99.37 | |
| 1osd_A | 72 | MERP, hypothetical protein MERP; mercury resistanc | 99.37 | |
| 2xmw_A | 71 | PACS-N, cation-transporting ATPase PACS; hydrolase | 99.36 | |
| 1yg0_A | 66 | COP associated protein; open-faced beta-sandwich, | 99.35 | |
| 3cjk_B | 75 | Copper-transporting ATPase 1; HAH1, ATP7B, menkes | 99.34 | |
| 2ldi_A | 71 | Zinc-transporting ATPase; metal homeostasis, metal | 99.33 | |
| 1q8l_A | 84 | Copper-transporting ATPase 1; metal binding protei | 99.33 | |
| 1aw0_A | 72 | Menkes copper-transporting ATPase; copper-binding | 99.32 | |
| 1cpz_A | 68 | Protein (COPZ); copper chaperone, metal transport, | 99.32 | |
| 2roe_A | 66 | Heavy metal binding protein; NMR {Thermus thermoph | 99.32 | |
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 99.31 | |
| 1y3j_A | 77 | Copper-transporting ATPase 1; ferrodoxin-like fold | 99.3 | |
| 2kyz_A | 67 | Heavy metal binding protein; structural genomics, | 99.3 | |
| 2g9o_A | 90 | Copper-transporting ATPase 1; menkes disease, solu | 99.3 | |
| 2kt2_A | 69 | Mercuric reductase; nmera, MERA, HMA domain, mercu | 99.29 | |
| 1kvi_A | 79 | Copper-transporting ATPase 1; menkes, Cu-protein, | 99.28 | |
| 1fvq_A | 72 | Copper-transporting ATPase; APO-CCC2A, hydrolase; | 99.27 | |
| 1opz_A | 76 | Potential copper-transporting ATPase; mutation, fo | 99.27 | |
| 1yjr_A | 75 | Copper-transporting ATPase 1; metallochaperone, pr | 99.26 | |
| 2ofg_X | 111 | Zinc-transporting ATPase; ferredoxin-like fold, be | 99.25 | |
| 1jww_A | 80 | Potential copper-transporting ATPase; beta-alpha-b | 99.23 | |
| 2kkh_A | 95 | Putative heavy metal transporter; zinc transport, | 99.15 | |
| 2aj0_A | 71 | Probable cadmium-transporting ATPase; ferrodoxin-l | 99.12 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 99.09 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 99.04 | |
| 1qup_A | 222 | Superoxide dismutase 1 copper chaperone; two domai | 99.0 | |
| 1jk9_B | 249 | CCS, copper chaperone for superoxide dismutase; pr | 98.91 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 98.87 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 98.85 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 98.82 | |
| 4gwb_A | 168 | Peptide methionine sulfoxide reductase MSRA 3; str | 86.79 | |
| 1fvg_A | 199 | Peptide methionine sulfoxide reductase; oxidoreduc | 86.07 | |
| 3lvj_C | 82 | Sulfurtransferase TUSA; protein-protein complex, s | 84.07 | |
| 1jdq_A | 98 | TM006 protein, hypothetical protein TM0983; struct | 83.27 | |
| 3bqh_A | 193 | PILB, peptide methionine sulfoxide reductase MSRA/ | 82.12 | |
| 2j89_A | 261 | Methionine sulfoxide reductase A; MSRA, poplar, ox | 81.49 |
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A | Back alignment and structure |
|---|
Probab=99.54 E-value=2.7e-14 Score=87.18 Aligned_cols=62 Identities=29% Similarity=0.458 Sum_probs=57.7
Q ss_pred eEEEEEEcCcChhHHHHHHHHHhCCCCeeEEEEecCCCEEEEEecCCHHHHHHHHHhCCCCcC
Q 032895 68 KMVVLRVSMHCNGCARKVEKHVSKLEGVTSYKVDLASKMVVVIGDIIPFEVLESVSKAHLFYK 130 (131)
Q Consensus 68 ~~~~l~VGm~C~~C~~~Ie~~L~~l~GV~~v~vnl~~~~~~V~~~~~~~~I~~~I~~~Gy~~~ 130 (131)
.++.|.|||+|++|+++|+++|++++|| ++.+|+.+++++|.++.++++|.++|+++||.+.
T Consensus 2 ~~~~~~vgm~C~~C~~~i~~~l~~~~gV-~v~v~~~~~~~~v~~~~~~~~i~~~i~~~Gy~~~ 63 (68)
T 3iwl_A 2 PKHEFSVDMTCGGCAEAVSRVLNKLGGV-KYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVS 63 (68)
T ss_dssp CEEEEEECCCSHHHHHHHHHHHHHHCSE-EEEEETTTTEEEEEESSCHHHHHHHHHTTCSCEE
T ss_pred ceEEEEECcCcHHHHHHHHHHHHcCCCe-EEEEEcCCCEEEEEecCCHHHHHHHHHHcCCceE
Confidence 3567888999999999999999999999 9999999999999998899999999999999863
|
| >3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 | Back alignment and structure |
|---|
| >4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A | Back alignment and structure |
|---|
| >3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A | Back alignment and structure |
|---|
| >2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} | Back alignment and structure |
|---|
| >2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A | Back alignment and structure |
|---|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A | Back alignment and structure |
|---|
| >1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A | Back alignment and structure |
|---|
| >2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A | Back alignment and structure |
|---|
| >2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A | Back alignment and structure |
|---|
| >1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A | Back alignment and structure |
|---|
| >2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} | Back alignment and structure |
|---|
| >1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A | Back alignment and structure |
|---|
| >1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A | Back alignment and structure |
|---|
| >1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 | Back alignment and structure |
|---|
| >2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A | Back alignment and structure |
|---|
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A | Back alignment and structure |
|---|
| >2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} | Back alignment and structure |
|---|
| >2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A | Back alignment and structure |
|---|
| >2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A | Back alignment and structure |
|---|
| >1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A | Back alignment and structure |
|---|
| >1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B | Back alignment and structure |
|---|
| >1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A | Back alignment and structure |
|---|
| >1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A | Back alignment and structure |
|---|
| >1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A | Back alignment and structure |
|---|
| >2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4gwb_A Peptide methionine sulfoxide reductase MSRA 3; structural genomics, protein structure initiative, nysgrc, R PSI-biology; 1.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1fvg_A Peptide methionine sulfoxide reductase; oxidoreductase; 1.60A {Bos taurus} SCOP: d.58.28.1 PDB: 1fva_A 2l90_A* | Back alignment and structure |
|---|
| >3lvj_C Sulfurtransferase TUSA; protein-protein complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PLP; 2.44A {Escherichia coli} SCOP: d.68.3.3 PDB: 3lvk_B* 1dcj_A | Back alignment and structure |
|---|
| >1jdq_A TM006 protein, hypothetical protein TM0983; structural genomics; NMR {Thermotoga maritima} SCOP: d.68.3.3 | Back alignment and structure |
|---|
| >3bqh_A PILB, peptide methionine sulfoxide reductase MSRA/MSRB; methionine sulfoxide reductase A, oxidized form, elect transport; 1.95A {Neisseria meningitidis} PDB: 3bqe_A 3bqf_A* 3bqg_A | Back alignment and structure |
|---|
| >2j89_A Methionine sulfoxide reductase A; MSRA, poplar, oxidoreductase; 1.7A {Populus trichocarpa} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 131 | ||||
| d1qupa2 | 72 | d.58.17.1 (A:2-73) Copper chaperone for superoxide | 4e-15 | |
| d1cc8a_ | 72 | d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX | 2e-13 | |
| d2ggpb1 | 72 | d.58.17.1 (B:1-72) Copper transporter domain ccc2a | 2e-12 | |
| d1osda_ | 72 | d.58.17.1 (A:) Mercuric ion binding protein MerP { | 2e-12 | |
| d1p6ta1 | 72 | d.58.17.1 (A:1-72) Potential copper-translocating | 4e-12 | |
| d1fe0a_ | 66 | d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX | 6e-12 | |
| d1kvja_ | 79 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 3e-11 | |
| d1mwza_ | 73 | d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, | 3e-11 | |
| d2qifa1 | 69 | d.58.17.1 (A:1-69) Copper chaperone {Bacillus subt | 9e-11 | |
| d2aw0a_ | 72 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 1e-10 | |
| d1cpza_ | 68 | d.58.17.1 (A:) Copper chaperone {Enterococcus hira | 2e-10 | |
| d1q8la_ | 84 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 2e-10 | |
| d1p6ta2 | 79 | d.58.17.1 (A:73-151) Potential copper-translocatin | 7e-10 | |
| d1sb6a_ | 64 | d.58.17.1 (A:) Copper chaperone {Synechocystis sp. | 1e-09 |
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: HMA, heavy metal-associated domain family: HMA, heavy metal-associated domain domain: Copper chaperone for superoxide dismutase, N-terminal domain species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 62.9 bits (153), Expect = 4e-15
Identities = 9/60 (15%), Positives = 24/60 (40%)
Query: 66 KPKMVVLRVSMHCNGCARKVEKHVSKLEGVTSYKVDLASKMVVVIGDIIPFEVLESVSKA 125
+ MHC C ++ + + G+ S D+ +++ V + P ++ ++
Sbjct: 4 DTYEATYAIPMHCENCVNDIKACLKNVPGINSLNFDIEQQIMSVESSVAPSTIINTLRNC 63
|
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Length = 72 | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 72 | Back information, alignment and structure |
|---|
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Length = 66 | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 73 | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Length = 69 | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Length = 68 | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 79 | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Length = 64 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 131 | |||
| d2qifa1 | 69 | Copper chaperone {Bacillus subtilis, CopZ [TaxId: | 99.68 | |
| d2ggpb1 | 72 | Copper transporter domain ccc2a {Baker's yeast (Sa | 99.67 | |
| d1qupa2 | 72 | Copper chaperone for superoxide dismutase, N-termi | 99.65 | |
| d1osda_ | 72 | Mercuric ion binding protein MerP {Ralstonia metal | 99.65 | |
| d1cpza_ | 68 | Copper chaperone {Enterococcus hirae [TaxId: 1354] | 99.65 | |
| d2aw0a_ | 72 | Menkes copper-transporting ATPase {Human (Homo sap | 99.65 | |
| d1sb6a_ | 64 | Copper chaperone {Synechocystis sp. pcc 6803, Scat | 99.64 | |
| d1fe0a_ | 66 | ATX1 metallochaperone protein (ATOX1) {Human (Homo | 99.64 | |
| d1cc8a_ | 72 | ATX1 metallochaperone protein (ATOX1) {Baker's yea | 99.64 | |
| d1p6ta1 | 72 | Potential copper-translocating P-type ATPase CopA | 99.63 | |
| d1q8la_ | 84 | Menkes copper-transporting ATPase {Human (Homo sap | 99.61 | |
| d1kvja_ | 79 | Menkes copper-transporting ATPase {Human (Homo sap | 99.61 | |
| d1mwza_ | 73 | Metal ion-transporting ATPase ZntA, N-terminal dom | 99.6 | |
| d1p6ta2 | 79 | Potential copper-translocating P-type ATPase CopA | 99.58 | |
| d1jdqa_ | 98 | Hypothetical protein TM0983 {Thermotoga maritima [ | 88.91 | |
| d1dcja_ | 81 | SirA {Escherichia coli [TaxId: 562]} | 86.43 | |
| d1je3a_ | 97 | hypothetical protein YedF (EC005) {Escherichia col | 83.94 | |
| d1ff3a_ | 211 | Peptide methionine sulfoxide reductase {Escherichi | 82.25 | |
| d1nwaa_ | 168 | Peptide methionine sulfoxide reductase {Mycobacter | 81.11 | |
| d1fvga_ | 192 | Peptide methionine sulfoxide reductase {Cow (Bos t | 80.62 |
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: HMA, heavy metal-associated domain family: HMA, heavy metal-associated domain domain: Copper chaperone species: Bacillus subtilis, CopZ [TaxId: 1423]
Probab=99.68 E-value=1.8e-16 Score=96.93 Aligned_cols=64 Identities=25% Similarity=0.421 Sum_probs=59.9
Q ss_pred eEEEEEE-cCcChhHHHHHHHHHhCCCCeeEEEEecCCCEEEEEec---CCHHHHHHHHHhCCCCcCC
Q 032895 68 KMVVLRV-SMHCNGCARKVEKHVSKLEGVTSYKVDLASKMVVVIGD---IIPFEVLESVSKAHLFYKR 131 (131)
Q Consensus 68 ~~~~l~V-Gm~C~~C~~~Ie~~L~~l~GV~~v~vnl~~~~~~V~~~---~~~~~I~~~I~~~Gy~~~~ 131 (131)
++.+|.| ||+|++|++.|+++|+++|||.++.+|+.+++++|.|+ .+.++|.+.|+++||++.|
T Consensus 2 ~~~tl~V~Gm~C~~C~~~Ie~~l~~~~GV~~v~v~~~~~~v~v~~d~~~~~~~~i~~~i~~~Gy~~~~ 69 (69)
T d2qifa1 2 EQKTLQVEGMSCQHCVKAVETSVGELDGVSAVHVNLEAGKVDVSFDADKVSVKDIADAIEDQGYDVAK 69 (69)
T ss_dssp EEEEEEEECCCSHHHHHHHHHHHHTSTTEEEEEEETTTTEEEEEECTTTCCHHHHHHHHHHTTCEECC
T ss_pred cEEEEEECCccCHHHHHHHHHHHhcCCCceEEEEECCCCEEEEEECCCCCCHHHHHHHHHHhCCcccC
Confidence 5788999 99999999999999999999999999999999999997 4788999999999998765
|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} | Back information, alignment and structure |
|---|
| >d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1jdqa_ d.68.3.3 (A:) Hypothetical protein TM0983 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1dcja_ d.68.3.3 (A:) SirA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1je3a_ d.68.3.3 (A:) hypothetical protein YedF (EC005) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ff3a_ d.58.28.1 (A:) Peptide methionine sulfoxide reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nwaa_ d.58.28.1 (A:) Peptide methionine sulfoxide reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1fvga_ d.58.28.1 (A:) Peptide methionine sulfoxide reductase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|