Citrus Sinensis ID: 032961

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
MFDVMYKTDGIGLSAPQVGINVQLMVFNPVGERGEGEEIVLVNPRVNKYSNKMIPYEEGCLSFPGIHADVERPESVKIDARDINGARFSVSLSDLPARVFQHEFDHLQGILFFERMTDDVLDSIREQLEI
cHHHHcccccEEEEcccccccEEEEEEEccccccccccEEEEccEEEEEccccccccccccccccccEEEcccccEEEEEEcccccEEEEEEcccEEEEEEHHHHcccccEEEEcccHHHHHHHHHHHcc
ccHHHHcccccccEEEHHHHcccEcEEEEEcccccccEEEEEEEEEEEccccEEEEEEEEccEEEEEEEccEccEEEEEEEcccccEEEEEEEHHHHHHHHHHHHHcccccHHHHccHHHHHHHHHHHHc
mfdvmyktdgiglsapqvginVQLMvfnpvgergegeeivlvnprvnkysnkmipyeegclsfpgihadverpesvkidardingarfsvslsdlparVFQHEFDHLQGILFFERMTDDVLDSIREQLEI
mfdvmyktdgiglsapqvgiNVQLMVFNPVGERGEGEEIVLVNPRVNKYSNKMIPYEEGCLSFPGIHADVERPESVKIDARDINGARFSVSLSDLPARVFQHEFDHLQGILFFERMTDDVLDSIREQLEI
MFDVMYKTDGIGLSAPQVGINVQLMVFNPVGERGEGEEIVLVNPRVNKYSNKMIPYEEGCLSFPGIHADVERPESVKIDARDINGARFSVSLSDLPARVFQHEFDHLQGILFFERMTDDVLDSIREQLEI
***VMYKTDGIGLSAPQVGINVQLMVFNPVGERGEGEEIVLVNPRVNKYSNKMIPYEEGCLSFPGIHADVERPESVKIDARDINGARFSVSLSDLPARVFQHEFDHLQGILFFERMTDDVL*********
MFDVMYKTDGIGLSAPQVGINVQLMVFNPVGERGEGEEIVLVNPRVNKYSNKMIPYEEGCLSFPGIHADVERPESVKIDARDINGARFSVSLSDLPARVFQHEFDHLQGILFFERMTDDVLDSIREQLE*
MFDVMYKTDGIGLSAPQVGINVQLMVFNPVGERGEGEEIVLVNPRVNKYSNKMIPYEEGCLSFPGIHADVERPESVKIDARDINGARFSVSLSDLPARVFQHEFDHLQGILFFERMTDDVLDSIREQLEI
*FDVMYKTDGIGLSAPQVGINVQLMVFNPVGERGEGEEIVLVNPRVNKYSNKMIPYEEGCLSFPGIHADVERPESVKIDARDINGARFSVSLSDLPARVFQHEFDHLQGILFFERMTDDVLDSIREQLEI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFDVMYKTDGIGLSAPQVGINVQLMVFNPVGERGEGEEIVLVNPRVNKYSNKMIPYEEGCLSFPGIHADVERPESVKIDARDINGARFSVSLSDLPARVFQHEFDHLQGILFFERMTDDVLDSIREQLEI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query130 2.2.26 [Sep-21-2011]
Q9FV54279 Peptide deformylase 1B, c N/A no 0.984 0.458 0.812 3e-60
Q9FUZ2273 Peptide deformylase 1B, c yes no 0.992 0.472 0.790 2e-59
Q5VNN5269 Peptide deformylase 1B, c yes no 0.992 0.479 0.744 4e-52
B1XJP0187 Peptide deformylase OS=Sy yes no 0.923 0.641 0.425 8e-27
Q8YSK6187 Peptide deformylase 1 OS= yes no 0.923 0.641 0.416 4e-25
Q7NIF5187 Peptide deformylase 2 OS= yes no 0.923 0.641 0.433 6e-25
Q31DB4201 Peptide deformylase OS=Pr yes no 0.969 0.626 0.421 7e-25
Q7UHZ5201 Peptide deformylase OS=Rh yes no 0.984 0.636 0.410 2e-24
P94601187 Peptide deformylase OS=Fr N/A no 0.923 0.641 0.425 3e-24
A2BNK7201 Peptide deformylase OS=Pr yes no 0.9 0.582 0.435 4e-24
>sp|Q9FV54|DEF1B_SOLLC Peptide deformylase 1B, chloroplastic OS=Solanum lycopersicum GN=PDF1B PE=2 SV=1 Back     alignment and function desciption
 Score =  229 bits (585), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 120/128 (93%)

Query: 1   MFDVMYKTDGIGLSAPQVGINVQLMVFNPVGERGEGEEIVLVNPRVNKYSNKMIPYEEGC 60
           MFD+MYKTDGIGLSAPQVG+NVQLMVFN  GERGEGEEIVLVNPRV++YS ++IPYEEGC
Sbjct: 118 MFDIMYKTDGIGLSAPQVGMNVQLMVFNAAGERGEGEEIVLVNPRVSRYSRRIIPYEEGC 177

Query: 61  LSFPGIHADVERPESVKIDARDINGARFSVSLSDLPARVFQHEFDHLQGILFFERMTDDV 120
           LSFP IH DV+RPESVK+DA+DING RF +SLS LPARVFQHEFDHLQG+LFF++MTD+V
Sbjct: 178 LSFPMIHGDVKRPESVKVDAQDINGTRFEISLSALPARVFQHEFDHLQGVLFFDKMTDEV 237

Query: 121 LDSIREQL 128
           LD+IRE+L
Sbjct: 238 LDTIREKL 245
Removes the formyl group from the N-terminal Met of newly synthesized proteins.
Solanum lycopersicum (taxid: 4081)
EC: 3EC: .EC: 5EC: .EC: 1EC: .EC: 8EC: 8
>sp|Q9FUZ2|DEF1B_ARATH Peptide deformylase 1B, chloroplastic OS=Arabidopsis thaliana GN=PDF1B PE=1 SV=2 Back     alignment and function description
>sp|Q5VNN5|DEF1B_ORYSJ Peptide deformylase 1B, chloroplastic OS=Oryza sativa subsp. japonica GN=PDF1B PE=2 SV=1 Back     alignment and function description
>sp|B1XJP0|DEF_SYNP2 Peptide deformylase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=def PE=3 SV=1 Back     alignment and function description
>sp|Q8YSK6|DEF1_NOSS1 Peptide deformylase 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=def1 PE=3 SV=1 Back     alignment and function description
>sp|Q7NIF5|DEF2_GLOVI Peptide deformylase 2 OS=Gloeobacter violaceus (strain PCC 7421) GN=def2 PE=3 SV=1 Back     alignment and function description
>sp|Q31DB4|DEF_PROM9 Peptide deformylase OS=Prochlorococcus marinus (strain MIT 9312) GN=def PE=3 SV=1 Back     alignment and function description
>sp|Q7UHZ5|DEF_RHOBA Peptide deformylase OS=Rhodopirellula baltica (strain SH1) GN=def PE=3 SV=1 Back     alignment and function description
>sp|P94601|DEF_FREDI Peptide deformylase OS=Fremyella diplosiphon GN=def PE=3 SV=1 Back     alignment and function description
>sp|A2BNK7|DEF_PROMS Peptide deformylase OS=Prochlorococcus marinus (strain AS9601) GN=def PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
255560876 282 polypeptide deformylase, putative [Ricin 0.992 0.457 0.860 4e-61
225452422 275 PREDICTED: peptide deformylase 1B, chlor 0.992 0.469 0.844 1e-58
350535262 279 peptide deformylase 1B, chloroplastic [S 0.984 0.458 0.812 2e-58
11320966 273 peptide deformylase [Arabidopsis thalian 0.992 0.472 0.790 8e-58
15241461 273 peptide deformylase 1B [Arabidopsis thal 0.992 0.472 0.790 1e-57
21553551 273 Formylmethionine deformylase [Arabidopsi 0.992 0.472 0.790 2e-57
224060121 258 peptide deformylase [Populus trichocarpa 0.992 0.5 0.837 2e-57
194368702193 Chain A, Plant Peptide Deformylase Pdf1b 0.992 0.668 0.790 5e-57
297811599 273 predicted protein [Arabidopsis lyrata su 0.992 0.472 0.798 5e-57
327200558193 Chain A, Crystal Structure Of Arabidopsi 0.992 0.668 0.790 8e-57
>gi|255560876|ref|XP_002521451.1| polypeptide deformylase, putative [Ricinus communis] gi|223539350|gb|EEF40941.1| polypeptide deformylase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  239 bits (609), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 124/129 (96%)

Query: 1   MFDVMYKTDGIGLSAPQVGINVQLMVFNPVGERGEGEEIVLVNPRVNKYSNKMIPYEEGC 60
           MFDVMYKTDGIGLSAPQVGINVQLMVFNPVGERGEGEEIVL+NPR+NKYS K++P+ EGC
Sbjct: 121 MFDVMYKTDGIGLSAPQVGINVQLMVFNPVGERGEGEEIVLINPRLNKYSKKIVPFNEGC 180

Query: 61  LSFPGIHADVERPESVKIDARDINGARFSVSLSDLPARVFQHEFDHLQGILFFERMTDDV 120
           LSFPGI+ADV RPESVKIDARDINGARF+V+LS LPARVFQHE+DHL+GILFF+RMTD+V
Sbjct: 181 LSFPGIYADVLRPESVKIDARDINGARFTVNLSGLPARVFQHEYDHLEGILFFDRMTDEV 240

Query: 121 LDSIREQLE 129
           LDSIR QL+
Sbjct: 241 LDSIRAQLQ 249

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225452422|ref|XP_002276964.1| PREDICTED: peptide deformylase 1B, chloroplastic [Vitis vinifera] gi|296087647|emb|CBI34903.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|350535262|ref|NP_001234441.1| peptide deformylase 1B, chloroplastic [Solanum lycopersicum] gi|17433052|sp|Q9FV54.1|DEF1B_SOLLC RecName: Full=Peptide deformylase 1B, chloroplastic; Short=PDF 1B; AltName: Full=Polypeptide deformylase; Flags: Precursor gi|11320950|gb|AAG33972.1| peptide deformylase-like protein [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|11320966|gb|AAG33980.1|AF269165_1 peptide deformylase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15241461|ref|NP_196970.1| peptide deformylase 1B [Arabidopsis thaliana] gi|30684999|ref|NP_850821.1| peptide deformylase 1B [Arabidopsis thaliana] gi|39932734|sp|Q9FUZ2.2|DEF1B_ARATH RecName: Full=Peptide deformylase 1B, chloroplastic; Short=AtDEF2; Short=AtPDF1B; Short=PDF 1B; AltName: Full=Polypeptide deformylase; Flags: Precursor gi|7573315|emb|CAB87633.1| putative protein [Arabidopsis thaliana] gi|15292891|gb|AAK92816.1| unknown protein [Arabidopsis thaliana] gi|20465677|gb|AAM20307.1| unknown protein [Arabidopsis thaliana] gi|332004676|gb|AED92059.1| peptide deformylase 1B [Arabidopsis thaliana] gi|332004677|gb|AED92060.1| peptide deformylase 1B [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|21553551|gb|AAM62644.1| Formylmethionine deformylase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224060121|ref|XP_002300047.1| peptide deformylase [Populus trichocarpa] gi|222847305|gb|EEE84852.1| peptide deformylase [Populus trichocarpa] Back     alignment and taxonomy information
>gi|194368702|pdb|3CPM|A Chain A, Plant Peptide Deformylase Pdf1b Crystal Structure Back     alignment and taxonomy information
>gi|297811599|ref|XP_002873683.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297319520|gb|EFH49942.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|327200558|pdb|3M6O|A Chain A, Crystal Structure Of Arabidopsis Thaliana Peptide Deformylase 1b (Atpdf1b) gi|327200559|pdb|3M6O|B Chain B, Crystal Structure Of Arabidopsis Thaliana Peptide Deformylase 1b (Atpdf1b) gi|327200560|pdb|3M6P|A Chain A, Crystal Structure Of Arabidopsis Thaliana Peptide Deformylase 1b (Atpdf1b) In Complex With Actinonin gi|327200561|pdb|3M6P|B Chain B, Crystal Structure Of Arabidopsis Thaliana Peptide Deformylase 1b (Atpdf1b) In Complex With Actinonin gi|335892336|pdb|3O3J|A Chain A, Crystal Structure Of Arabidopsis Thaliana Peptide Deformylase 1b (Atpdf1b) In Complex With Inhibitor 6b gi|335892375|pdb|3PN2|A Chain A, Crystal Structure Of Arabidopsis Thaliana Petide Deformylase 1b (Atpdf1b) (Crystallized In Peg-550-Mme) gi|335892376|pdb|3PN3|A Chain A, Crystal Structure Of Arabidopsis Thaliana Petide Deformylase 1b (Atpdf1b) In Complex With Inhibitor 21 gi|335892377|pdb|3PN3|B Chain B, Crystal Structure Of Arabidopsis Thaliana Petide Deformylase 1b (Atpdf1b) In Complex With Inhibitor 21 gi|335892378|pdb|3PN4|A Chain A, Crystal Structure Of Arabidopsis Thaliana Petide Deformylase 1b (Atpdf1b) In Complex With Actinonin (Crystallized In Peg-550-Mme) Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
TAIR|locus:2222667273 PDF1B "peptide deformylase 1B" 0.992 0.472 0.790 1.3e-54
GENEDB_PFALCIPARUM|PFI0380c241 PFI0380c "formylmethionine def 0.984 0.531 0.465 1.8e-25
UNIPROTKB|Q8I372241 PFI0380c "Formylmethionine def 0.984 0.531 0.465 1.8e-25
TIGR_CMR|BA_4005156 BA_4005 "polypeptide deformyla 0.861 0.717 0.406 4e-19
UNIPROTKB|Q9KN16168 def2 "Peptide deformylase 2" [ 0.923 0.714 0.426 1.1e-18
TIGR_CMR|VC_A0150168 VC_A0150 "polypeptide deformyl 0.923 0.714 0.426 1.1e-18
TIGR_CMR|CPS_0020171 CPS_0020 "polypeptide deformyl 0.976 0.742 0.356 3.6e-18
TIGR_CMR|SO_0032168 SO_0032 "polypeptide deformyla 0.969 0.75 0.410 5.8e-18
UNIPROTKB|P0A6K3169 def [Escherichia coli K-12 (ta 0.969 0.745 0.410 3.2e-17
TIGR_CMR|SPO_3219172 SPO_3219 "peptide deformylase" 0.876 0.662 0.417 4.1e-17
TAIR|locus:2222667 PDF1B "peptide deformylase 1B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 564 (203.6 bits), Expect = 1.3e-54, P = 1.3e-54
 Identities = 102/129 (79%), Positives = 121/129 (93%)

Query:     1 MFDVMYKTDGIGLSAPQVGINVQLMVFNPVGERGEGEEIVLVNPRVNKYSNKMIPYEEGC 60
             MFDVMYKTDGIGLSAPQVG+NVQLMVFNP GE GEG+EIVLVNP++ KYS+K++P++EGC
Sbjct:   112 MFDVMYKTDGIGLSAPQVGLNVQLMVFNPAGEPGEGKEIVLVNPKIKKYSDKLVPFDEGC 171

Query:    61 LSFPGIHADVERPESVKIDARDINGARFSVSLSDLPARVFQHEFDHLQGILFFERMTDDV 120
             LSFPGI+A+V RP+SVKIDARDI G RFS+SLS LPAR+FQHE+DHL+G+LFF+RMTD V
Sbjct:   172 LSFPGIYAEVVRPQSVKIDARDITGERFSISLSRLPARIFQHEYDHLEGVLFFDRMTDQV 231

Query:   121 LDSIREQLE 129
             LDSIRE+LE
Sbjct:   232 LDSIREELE 240
GO:0005506 "iron ion binding" evidence=IEA
GO:0006412 "translation" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0042586 "peptide deformylase activity" evidence=IEA;ISS;IDA
GO:0010027 "thylakoid membrane organization" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
GENEDB_PFALCIPARUM|PFI0380c PFI0380c "formylmethionine deformylase, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8I372 PFI0380c "Formylmethionine deformylase, putative" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
TIGR_CMR|BA_4005 BA_4005 "polypeptide deformylase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KN16 def2 "Peptide deformylase 2" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_A0150 VC_A0150 "polypeptide deformylase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_0020 CPS_0020 "polypeptide deformylase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|SO_0032 SO_0032 "polypeptide deformylase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|P0A6K3 def [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_3219 SPO_3219 "peptide deformylase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FUZ2DEF1B_ARATH3, ., 5, ., 1, ., 8, 80.79060.99230.4725yesno
Q5VNN5DEF1B_ORYSJ3, ., 5, ., 1, ., 8, 80.74410.99230.4795yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.5.10.766
3rd Layer3.5.1.880.824

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
pfam01327155 pfam01327, Pep_deformylase, Polypeptide deformylas 2e-51
cd00487141 cd00487, Pep_deformylase, Polypeptide or peptide d 2e-49
PRK00150165 PRK00150, def, peptide deformylase; Reviewed 1e-45
COG0242168 COG0242, Def, N-formylmethionyl-tRNA deformylase [ 5e-45
PRK12846165 PRK12846, PRK12846, peptide deformylase; Reviewed 8e-39
PRK14597166 PRK14597, PRK14597, peptide deformylase; Provision 5e-34
PRK14598187 PRK14598, PRK14598, peptide deformylase; Provision 7e-31
PRK14596199 PRK14596, PRK14596, peptide deformylase; Provision 9e-29
TIGR00079161 TIGR00079, pept_deformyl, peptide deformylase 2e-27
PRK14595162 PRK14595, PRK14595, peptide deformylase; Provision 5e-18
PRK09218136 PRK09218, PRK09218, peptide deformylase; Validated 5e-15
>gnl|CDD|216435 pfam01327, Pep_deformylase, Polypeptide deformylase Back     alignment and domain information 
 Score =  159 bits (405), Expect = 2e-51
 Identities = 49/118 (41%), Positives = 75/118 (63%)

Query: 1   MFDVMYKTDGIGLSAPQVGINVQLMVFNPVGERGEGEEIVLVNPRVNKYSNKMIPYEEGC 60
           M + MY  +G+GL+APQ+G++ ++ V +   E GE E +VL+NP +   S + +  EEGC
Sbjct: 34  MLETMYAANGVGLAAPQIGVSKRIFVIDVGDEDGEPEPLVLINPEIISASEETVEGEEGC 93

Query: 61  LSFPGIHADVERPESVKIDARDINGARFSVSLSDLPARVFQHEFDHLQGILFFERMTD 118
           LS PG+  +VERP+ + +  +D+NG    +      ARV QHE DHL GILF +R++ 
Sbjct: 94  LSVPGLRGEVERPKRITVRYQDLNGNEHELEADGFLARVLQHEIDHLNGILFLDRLSK 151

Length = 155
>gnl|CDD|238271 cd00487, Pep_deformylase, Polypeptide or peptide deformylase; a family of metalloenzymes that catalyzes the removal of the N-terminal formyl group in a growing polypeptide chain following translation initiation during protein synthesis in prokaryotes Back     alignment and domain information
>gnl|CDD|234668 PRK00150, def, peptide deformylase; Reviewed Back     alignment and domain information
>gnl|CDD|223320 COG0242, Def, N-formylmethionyl-tRNA deformylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|237227 PRK12846, PRK12846, peptide deformylase; Reviewed Back     alignment and domain information
>gnl|CDD|237761 PRK14597, PRK14597, peptide deformylase; Provisional Back     alignment and domain information
>gnl|CDD|237762 PRK14598, PRK14598, peptide deformylase; Provisional Back     alignment and domain information
>gnl|CDD|184758 PRK14596, PRK14596, peptide deformylase; Provisional Back     alignment and domain information
>gnl|CDD|232815 TIGR00079, pept_deformyl, peptide deformylase Back     alignment and domain information
>gnl|CDD|184757 PRK14595, PRK14595, peptide deformylase; Provisional Back     alignment and domain information
>gnl|CDD|181704 PRK09218, PRK09218, peptide deformylase; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 130
COG0242168 Def N-formylmethionyl-tRNA deformylase [Translatio 100.0
PRK12846165 peptide deformylase; Reviewed 100.0
TIGR00079161 pept_deformyl peptide deformylase. Peptide deformy 100.0
PRK14597166 peptide deformylase; Provisional 100.0
PRK00150165 def peptide deformylase; Reviewed 100.0
PRK14598187 peptide deformylase; Provisional 100.0
PRK14595162 peptide deformylase; Provisional 100.0
PF01327156 Pep_deformylase: Polypeptide deformylase; InterPro 100.0
PRK14596199 peptide deformylase; Provisional 100.0
cd00487141 Pep_deformylase Polypeptide or peptide deformylase 100.0
PRK09218136 peptide deformylase; Validated 100.0
KOG3137267 consensus Peptide deformylase [Translation, riboso 100.0
COG4740176 Predicted metalloprotease [General function predic 98.39
>COG0242 Def N-formylmethionyl-tRNA deformylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
Probab=100.00  E-value=2.8e-55  Score=330.15  Aligned_cols=129  Identities=37%  Similarity=0.707  Sum_probs=119.9

Q ss_pred             ChHhhhcCCCeEEeccccCccceEEEEecCCCC-CCceeEEEEcceEEeeCCcEeeCeeeccccCCCeeeecCCCceEEE
Q 032961            1 MFDVMYKTDGIGLSAPQVGINVQLMVFNPVGER-GEGEEIVLVNPRVNKYSNKMIPYEEGCLSFPGIHADVERPESVKID   79 (130)
Q Consensus         1 m~~tm~~~~gvGLAApQIG~~~ri~vi~~~~~~-~~~~~~v~iNP~I~~~s~~~~~~~EgClS~pg~~~~V~R~~~I~v~   79 (130)
                      |++|||++.||||||||||+++|+||++...+. .+..+.+||||+|++.|.+....+|||||+||+++.|+||.+|+|+
T Consensus        35 M~etm~~~~GVGLAApQIGi~kri~vi~~~~~~~~~~~~~vlINP~I~~~~~~~~~~~EGCLSvP~~~~~V~R~~~I~V~  114 (168)
T COG0242          35 MLETMYAAEGVGLAAPQIGISKRIFVIDVEEDGRPKEPPLVLINPEIISKSEETLTGEEGCLSVPGVRGEVERPERITVK  114 (168)
T ss_pred             HHHHHHhCCCeeeeehhcCceeeEEEEEccCccCcCcCceEEECCEEeecCCcccccCcceEeecCceeeeecccEEEEE
Confidence            899999999999999999999999999986542 2345689999999999888889999999999999999999999999


Q ss_pred             EEcCCCCEEEEEEeccceehHhhhhhhhCCceeeecCCHHHHHHHHHHhc
Q 032961           80 ARDINGARFSVSLSDLPARVFQHEFDHLQGILFFERMTDDVLDSIREQLE  129 (130)
Q Consensus        80 ~~d~~g~~~~~~~~g~~Ar~~QHEiDHL~G~l~~Dr~~~~~~~~~~~~~~  129 (130)
                      |+|.+|++++++++||+|||+|||+|||+|+||+||+++.+++.++++++
T Consensus       115 ~~D~~G~~~~~~a~G~lA~~iQHEiDHLnGvlf~D~l~~~k~~~~~~~~~  164 (168)
T COG0242         115 YLDRNGKPQELEAEGLLARCIQHEIDHLNGVLFIDRLSPLKRDRLKKKLK  164 (168)
T ss_pred             EEcCCCCEEEEEEcCceeEEeEeeccccCcEEeeeecChhhhhhHHHHHH
Confidence            99999999999999999999999999999999999999988888877754

>PRK12846 peptide deformylase; Reviewed Back     alignment and domain information
>TIGR00079 pept_deformyl peptide deformylase Back     alignment and domain information
>PRK14597 peptide deformylase; Provisional Back     alignment and domain information
>PRK00150 def peptide deformylase; Reviewed Back     alignment and domain information
>PRK14598 peptide deformylase; Provisional Back     alignment and domain information
>PRK14595 peptide deformylase; Provisional Back     alignment and domain information
>PF01327 Pep_deformylase: Polypeptide deformylase; InterPro: IPR023635 Peptide deformylase (PDF) is an essential metalloenzyme required for the removal of the formyl group at the N terminus of nascent polypeptide chains in eubacteria: 3 Back     alignment and domain information
>PRK14596 peptide deformylase; Provisional Back     alignment and domain information
>cd00487 Pep_deformylase Polypeptide or peptide deformylase; a family of metalloenzymes that catalyzes the removal of the N-terminal formyl group in a growing polypeptide chain following translation initiation during protein synthesis in prokaryotes Back     alignment and domain information
>PRK09218 peptide deformylase; Validated Back     alignment and domain information
>KOG3137 consensus Peptide deformylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4740 Predicted metalloprotease [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
3cpm_A193 Plant Peptide Deformylase Pdf1b Crystal Structure L 6e-60
3m6o_A193 Crystal Structure Of Arabidopsis Thaliana Peptide D 9e-60
3m6q_A193 Crystal Structure Of Arabidopsis Thaliana Peptide D 6e-59
3m6r_A193 Crystal Structure Of Arabidopsis Thaliana Peptide D 8e-59
1rl4_A188 Plasmodium Falciparum Peptide Deformylase Complex W 2e-27
4dr9_A192 Crystal Structure Of A Peptide Deformylase From Syn 8e-26
1rqc_A185 Crystals Of Peptide Deformylase From Plasmodium Fal 3e-25
1jym_A183 Crystals Of Peptide Deformylase From Plasmodium Fal 5e-23
3uwa_A154 Crystal Structure Of A Probable Peptide Deformylase 7e-21
1y6h_A177 Crystal Structure Of Lipdf Length = 177 2e-20
1n5n_A180 Crystal Structure Of Peptide Deformylase From Pseud 2e-20
1lry_A167 Crystal Structure Of P. Aeruginosa Peptide Deformyl 3e-20
1ix1_A171 Crystal Structure Of P.Aeruginosa Peptide Deformyla 3e-20
1szz_A177 Crystal Structure Of Peptide Deformylase From Lepto 1e-19
3qu1_A171 Peptide Deformylase From Vibrio Cholerae Length = 1 5e-19
1ws0_A156 Structure Analysis Of Peptide Deformylase From Baci 2e-18
1lme_A176 Crystal Structure Of Peptide Deformylase From Therm 6e-18
1v3y_A192 The Crystal Structure Of Peptide Deformylase From T 6e-18
4al2_A186 Peptide Deformylase (Ni-Form) With Hydrosulfide Len 3e-17
1icj_A168 Pdf Protein Is Crystallized As Ni2+ Containing Form 4e-17
3k6l_A169 The Structure Of E.Coli Peptide Deformylase (Pdf) I 4e-17
1dff_A164 Peptide Deformylase Length = 164 4e-17
2w3t_A188 Chloro Complex Of The Ni-Form Of E.Coli Deformylase 4e-17
4az4_A186 E.Coli Deformylase With Co(Ii) And Hydrosulfide Len 5e-17
2ew5_A181 Structure Of Helicobacter Pylori Peptide Deformylas 9e-17
2def_A147 Peptide Deformylase Catalytic Core (Residues 1-147) 1e-16
1def_A147 Peptide Deformylase Catalytic Core (Residues 1-147) 1e-16
1zxz_A197 X-Ray Structure Of Peptide Deformylase From Arabido 2e-16
3u04_A190 Crystal Structure Of Peptide Deformylase From Ehrli 8e-16
3oca_A209 Crystal Structure Of Peptide Deformylase From Ehrli 8e-16
4al3_A186 Peptide Deformylase (Co-Form) With Mercaptoethanol 1e-15
3fwx_A169 The Crystal Structure Of The Peptide Deformylase Fr 8e-15
1lqw_A183 Crystal Structure Of S.Aureus Peptide Deformylase L 9e-15
1lmh_A184 Crystal Structure Of S. Aureus Peptide Deformylase 2e-14
3g5k_A183 Structure And Activity Of Human Mitochondrial Pepti 2e-14
1q1y_A191 Crystal Structures Of Peptide Deformylase From Stap 8e-14
3dld_A171 Crystal Structure Of Peptide Deformylase, Xoo1075, 9e-14
1lm4_A194 Structure Of Peptide Deformylase From Staphylococcu 2e-13
2okl_A185 Crystal Structure Of Peptide Deformylase 2 With Act 4e-13
1lqy_A184 Crystal Structure Of Bacillus Stearothermophilus Pe 7e-13
3e3u_A197 Crystal Structure Of Mycobacterium Tuberculosis Pep 2e-12
2os3_A205 Structures Of Actinonin Bound Peptide Deformylases 2e-09
3g6n_A191 Crystal Structure Of An Efpdf Complex With Met-Ala- 3e-09
3cmd_A196 Crystal Structure Of Peptide Deformylase From Vre-E 3e-09
2ai7_A203 S.Pneumoniae Polypeptide Deformylase Complexed With 5e-09
3str_P203 Strep Peptide Deformylase With A Time Dependent Thi 5e-09
2aie_P203 S.Pneumoniae Polypeptide Deformylase Complexed With 5e-09
2os1_A188 Structures Of Actinonin Bound Peptide Deformylases 2e-08
2os0_A188 Structures Of Actinonin Bound Peptide Deformylases 1e-07
1lm6_A215 Crystal Structure Of Peptide Deformylase From Strep 1e-07
3svj_P203 Strep Peptide Deformylase With A Time Dependent Thi 1e-07
3l87_A238 The Crystal Structure Of Smu.143c From Streptococcu 4e-07
>pdb|3CPM|A Chain A, Plant Peptide Deformylase Pdf1b Crystal Structure Length = 193 Back     alignment and structure 
Iteration: 1

 Score =  225 bits (573), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 121/129 (93%)
Query: 1   MFDVMYKTDGIGLSAPQVGINVQLMVFNPVGERGEGEEIVLVNPRVNKYSNKMIPYEEGC 60
           MFDVMYKTDGIGLSAPQVG+NVQLMVFNP GE GEG+EIVLVNP++ KYS+K++P++EGC
Sbjct: 48  MFDVMYKTDGIGLSAPQVGLNVQLMVFNPAGEPGEGKEIVLVNPKIKKYSDKLVPFDEGC 107
Query: 61  LSFPGIHADVERPESVKIDARDINGARFSVSLSDLPARVFQHEFDHLQGILFFERMTDDV 120
           LSFPGI+A+V RP+SVKIDARDI G RFS+SLS LPAR+FQHE+DHL+G+LFF+RMTD V
Sbjct: 108 LSFPGIYAEVVRPQSVKIDARDITGERFSISLSRLPARIFQHEYDHLEGVLFFDRMTDQV 167
Query: 121 LDSIREQLE 129
           LDSIRE+LE
Sbjct: 168 LDSIREELE 176
>pdb|3M6O|A Chain A, Crystal Structure Of Arabidopsis Thaliana Peptide Deformylase 1b (Atpdf1b) Length = 193 Back     alignment and structure
>pdb|3M6Q|A Chain A, Crystal Structure Of Arabidopsis Thaliana Peptide Deformylase 1b (Atpdf1b) G41q Mutant In Complex With Actinonin Length = 193 Back     alignment and structure
>pdb|3M6R|A Chain A, Crystal Structure Of Arabidopsis Thaliana Peptide Deformylase 1b (Atpdf1b) G41m Mutant In Complex With Actinonin Length = 193 Back     alignment and structure
>pdb|1RL4|A Chain A, Plasmodium Falciparum Peptide Deformylase Complex With Inhibitor Length = 188 Back     alignment and structure
>pdb|4DR9|A Chain A, Crystal Structure Of A Peptide Deformylase From Synechococcus Elongatus In Complex With Actinonin Length = 192 Back     alignment and structure
>pdb|1RQC|A Chain A, Crystals Of Peptide Deformylase From Plasmodium Falciparum With Ten Subunits Per Asymmetric Unit Reveal Critical Characteristics Of The Active Site For Drug Design Length = 185 Back     alignment and structure
>pdb|1JYM|A Chain A, Crystals Of Peptide Deformylase From Plasmodium Falciparum With Ten Subunits Per Asymmetric Unit Reveal Critical Characteristics Of The Active Site For Drug Design Length = 183 Back     alignment and structure
>pdb|3UWA|A Chain A, Crystal Structure Of A Probable Peptide Deformylase From Synechococcus Phage S-Ssm7 Length = 154 Back     alignment and structure
>pdb|1Y6H|A Chain A, Crystal Structure Of Lipdf Length = 177 Back     alignment and structure
>pdb|1N5N|A Chain A, Crystal Structure Of Peptide Deformylase From Pseudomonas Aeruginosa Length = 180 Back     alignment and structure
>pdb|1LRY|A Chain A, Crystal Structure Of P. Aeruginosa Peptide Deformylase Complexed With Antibiotic Actinonin Length = 167 Back     alignment and structure
>pdb|1IX1|A Chain A, Crystal Structure Of P.Aeruginosa Peptide Deformylase Complexed With Antibiotic Actinonin Length = 171 Back     alignment and structure
>pdb|1SZZ|A Chain A, Crystal Structure Of Peptide Deformylase From Leptospira Interrogans Complexed With Inhibitor Actinonin Length = 177 Back     alignment and structure
>pdb|3QU1|A Chain A, Peptide Deformylase From Vibrio Cholerae Length = 171 Back     alignment and structure
>pdb|1WS0|A Chain A, Structure Analysis Of Peptide Deformylase From Bacillus Cereus Length = 156 Back     alignment and structure
>pdb|1LME|A Chain A, Crystal Structure Of Peptide Deformylase From Thermotoga Maritima Length = 176 Back     alignment and structure
>pdb|1V3Y|A Chain A, The Crystal Structure Of Peptide Deformylase From Thermus Thermophilus Hb8 Length = 192 Back     alignment and structure
>pdb|4AL2|A Chain A, Peptide Deformylase (Ni-Form) With Hydrosulfide Length = 186 Back     alignment and structure
>pdb|1ICJ|A Chain A, Pdf Protein Is Crystallized As Ni2+ Containing Form, Cocrystallized With Inhibitor Polyethylene Glycol (Peg) Length = 168 Back     alignment and structure
>pdb|3K6L|A Chain A, The Structure Of E.Coli Peptide Deformylase (Pdf) In Complex With Peptidomimetic Ligand Bb2827 Length = 169 Back     alignment and structure
>pdb|1DFF|A Chain A, Peptide Deformylase Length = 164 Back     alignment and structure
>pdb|2W3T|A Chain A, Chloro Complex Of The Ni-Form Of E.Coli Deformylase Length = 188 Back     alignment and structure
>pdb|4AZ4|A Chain A, E.Coli Deformylase With Co(Ii) And Hydrosulfide Length = 186 Back     alignment and structure
>pdb|2EW5|A Chain A, Structure Of Helicobacter Pylori Peptide Deformylase In Complex With Inhibitor Length = 181 Back     alignment and structure
>pdb|2DEF|A Chain A, Peptide Deformylase Catalytic Core (Residues 1-147), Nmr, 20 Structures Length = 147 Back     alignment and structure
>pdb|1DEF|A Chain A, Peptide Deformylase Catalytic Core (Residues 1-147), Nmr, 9 Structures Length = 147 Back     alignment and structure
>pdb|1ZXZ|A Chain A, X-Ray Structure Of Peptide Deformylase From Arabidopsis Thaliana (Atpdf1a); Crystals Grown In Peg-5000 Mme As Precipitant Length = 197 Back     alignment and structure
>pdb|3U04|A Chain A, Crystal Structure Of Peptide Deformylase From Ehrlichia Chaffeensis In Complex With Actinonin Length = 190 Back     alignment and structure
>pdb|3OCA|A Chain A, Crystal Structure Of Peptide Deformylase From Ehrlichia Chaffeensis Length = 209 Back     alignment and structure
>pdb|4AL3|A Chain A, Peptide Deformylase (Co-Form) With Mercaptoethanol Length = 186 Back     alignment and structure
>pdb|3FWX|A Chain A, The Crystal Structure Of The Peptide Deformylase From Vibrio Cholerae O1 Biovar El Tor Str. N16961 Length = 169 Back     alignment and structure
>pdb|1LQW|A Chain A, Crystal Structure Of S.Aureus Peptide Deformylase Length = 183 Back     alignment and structure
>pdb|1LMH|A Chain A, Crystal Structure Of S. Aureus Peptide Deformylase Length = 184 Back     alignment and structure
>pdb|3G5K|A Chain A, Structure And Activity Of Human Mitochondrial Peptide Deformylase, A Novel Cancer Target Length = 183 Back     alignment and structure
>pdb|1Q1Y|A Chain A, Crystal Structures Of Peptide Deformylase From Staphylococcus Aureus Complexed With Actinonin Length = 191 Back     alignment and structure
>pdb|3DLD|A Chain A, Crystal Structure Of Peptide Deformylase, Xoo1075, From Xanthomonas Oryzae Pv. Oryzae Kacc10331 Length = 171 Back     alignment and structure
>pdb|1LM4|A Chain A, Structure Of Peptide Deformylase From Staphylococcus Aureus At 1.45 A Length = 194 Back     alignment and structure
>pdb|2OKL|A Chain A, Crystal Structure Of Peptide Deformylase 2 With Actinonin From Bacillus Cereus Length = 185 Back     alignment and structure
>pdb|1LQY|A Chain A, Crystal Structure Of Bacillus Stearothermophilus Peptide Deformylase Complexed With Antibiotic Actinonin Length = 184 Back     alignment and structure
>pdb|3E3U|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Peptide Deformylase In Complex With Inhibitor Length = 197 Back     alignment and structure
>pdb|2OS3|A Chain A, Structures Of Actinonin Bound Peptide Deformylases From E. Faecalis And S. Pyogenes Length = 205 Back     alignment and structure
>pdb|3G6N|A Chain A, Crystal Structure Of An Efpdf Complex With Met-Ala-Ser Length = 191 Back     alignment and structure
>pdb|3CMD|A Chain A, Crystal Structure Of Peptide Deformylase From Vre-E.Faecium Length = 196 Back     alignment and structure
>pdb|2AI7|A Chain A, S.Pneumoniae Polypeptide Deformylase Complexed With Sb- 485345 Length = 203 Back     alignment and structure
>pdb|3STR|P Chain P, Strep Peptide Deformylase With A Time Dependent Thiazolidine Hydroxamic Acid Length = 203 Back     alignment and structure
>pdb|2AIE|P Chain P, S.Pneumoniae Polypeptide Deformylase Complexed With Sb- 505684 Length = 203 Back     alignment and structure
>pdb|2OS1|A Chain A, Structures Of Actinonin Bound Peptide Deformylases From E. Faecalis And S. Pyogenes Length = 188 Back     alignment and structure
>pdb|2OS0|A Chain A, Structures Of Actinonin Bound Peptide Deformylases From E. Faecalis And S. Pyogenes Length = 188 Back     alignment and structure
>pdb|1LM6|A Chain A, Crystal Structure Of Peptide Deformylase From Streptococcus Pneumoniae Length = 215 Back     alignment and structure
>pdb|3SVJ|P Chain P, Strep Peptide Deformylase With A Time Dependent Thiazolidine Amide Length = 203 Back     alignment and structure
>pdb|3L87|A Chain A, The Crystal Structure Of Smu.143c From Streptococcus Mutans Ua159 Length = 238 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
3pn3_A193 Peptide deformylase 1B, chloroplastic; PDF, N-term 2e-57
1rl4_A188 Formylmethionine deformylase; crystal engineering, 6e-49
1y6h_A177 Peptide deformylase; open and close conformation, 1e-47
3dld_A171 Peptide deformylase; bacterial blight, XOO1075, xa 5e-47
3g5k_A183 Peptide deformylase, mitochondrial; actinonin, hyd 4e-46
1zxz_A197 PDF, peptide deformylase, mitochondrial; PDF1A, eu 2e-45
1lme_A176 PDF, peptide deformylase; thermophIle, metalloenzy 8e-45
1n5n_A180 Peptide deformylase; metalloenzyme, drug design, d 3e-44
2ew5_A181 Peptide deformylase; inhibitor, hydrolase; HET: Y1 6e-44
3e3u_A197 Peptide deformylase; metallo-enzyme, hydrolase, ir 9e-44
1v3y_A192 Peptide deformylase; protein synthesis, riken stru 2e-43
2okl_A185 Peptide deformylase 2; hydrolase; HET: BB2 CIT; 1. 3e-43
1xeo_A168 Peptide deformylase; cobalt deformylase, formate, 3e-43
1ws0_A156 Peptide deformylase 1; alpha + beta topology, hydr 3e-43
2w3t_A188 Peptide deformylase; protein biosynthesis, iron, n 4e-43
3u04_A190 Peptide deformylase 1; ssgcid, actinonin, ehrlichi 5e-42
3svj_P203 Peptide deformylase 3; alpha-beta, metal binding p 5e-42
3qu1_A171 Peptide deformylase 2; structural genomics, center 1e-41
2os0_A188 Peptide deformylase; PDF, hydrolase; 1.30A {Entero 3e-41
3l87_A238 Peptide deformylase; hydrolase, iron, metal-bindin 2e-39
1lm4_A194 Peptide deformylase PDF1; metalloenzyme, hydrolase 1e-37
>3pn3_A Peptide deformylase 1B, chloroplastic; PDF, N-terminal excision pathway, N induced-FIT, hydrolase-hydrolase inhibitor complex; HET: PN3; 1.30A {Arabidopsis thaliana} PDB: 3m6p_A* 3o3j_A* 3pn2_A 3m6o_A* 3pn4_A* 3pn5_A 3m6q_A 3pn6_A 3m6r_A 3cpm_A Length = 193 Back     alignment and structure
 Score =  175 bits (446), Expect = 2e-57
 Identities = 102/129 (79%), Positives = 121/129 (93%)

Query: 1   MFDVMYKTDGIGLSAPQVGINVQLMVFNPVGERGEGEEIVLVNPRVNKYSNKMIPYEEGC 60
           MFDVMYKTDGIGLSAPQVG+NVQLMVFNP GE GEG+EIVLVNP++ KYS+K++P++EGC
Sbjct: 32  MFDVMYKTDGIGLSAPQVGLNVQLMVFNPAGEPGEGKEIVLVNPKIKKYSDKLVPFDEGC 91

Query: 61  LSFPGIHADVERPESVKIDARDINGARFSVSLSDLPARVFQHEFDHLQGILFFERMTDDV 120
           LSFPGI+A+V RP+SVKIDARDI G RFS+SLS LPAR+FQHE+DHL+G+LFF+RMTD V
Sbjct: 92  LSFPGIYAEVVRPQSVKIDARDITGERFSISLSRLPARIFQHEYDHLEGVLFFDRMTDQV 151

Query: 121 LDSIREQLE 129
           LDSIRE+LE
Sbjct: 152 LDSIREELE 160
>1rl4_A Formylmethionine deformylase; crystal engineering, drug design, malaria, PDF, peptide DEFO plasmodium, hydrolase; HET: BRR BL5; 2.18A {Plasmodium falciparum} SCOP: d.167.1.1 PDB: 1rqc_A 1jym_A Length = 188 Back     alignment and structure
>1y6h_A Peptide deformylase; open and close conformation, PDF, hydrolase; 2.20A {Leptospira interrogans} SCOP: d.167.1.1 PDB: 1sv2_A* 1vey_A* 1vev_A 1vez_A 1szz_A* Length = 177 Back     alignment and structure
>3dld_A Peptide deformylase; bacterial blight, XOO1075, xanthomonas oryzae PV. oryzae KACC10331, hydrolase; 2.60A {Xanthomonas oryzae PV} Length = 171 Back     alignment and structure
>3g5k_A Peptide deformylase, mitochondrial; actinonin, hydrolase, iron, metal-bindi mitochondrion, protein biosynthesis, transit peptide; HET: BB2; 1.70A {Homo sapiens} PDB: 3g5p_A Length = 183 Back     alignment and structure
>1zxz_A PDF, peptide deformylase, mitochondrial; PDF1A, eukaryote, higher plant, zinc ION, hydrolase; 2.80A {Arabidopsis thaliana} PDB: 1zy0_A 1zy1_A Length = 197 Back     alignment and structure
>1lme_A PDF, peptide deformylase; thermophIle, metalloenzyme, deformylation, structural genomics, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: d.167.1.1 Length = 176 Back     alignment and structure
>1n5n_A Peptide deformylase; metalloenzyme, drug design, deformylation, hydrolase; 1.80A {Pseudomonas aeruginosa} SCOP: d.167.1.1 PDB: 1s17_A* 1ix1_A* 1lry_A* Length = 180 Back     alignment and structure
>2ew5_A Peptide deformylase; inhibitor, hydrolase; HET: Y12; 2.20A {Helicobacter pylori} PDB: 2ew6_A* 2ew7_A Length = 181 Back     alignment and structure
>3e3u_A Peptide deformylase; metallo-enzyme, hydrolase, iron, metal-binding, protein biosynthesis; HET: NVC; 1.56A {Mycobacterium tuberculosis} Length = 197 Back     alignment and structure
>1v3y_A Peptide deformylase; protein synthesis, riken structural genomics/proteomics initiative, RSGI, structural genomics, hydrolase; 1.81A {Thermus thermophilus} SCOP: d.167.1.1 Length = 192 Back     alignment and structure
>2okl_A Peptide deformylase 2; hydrolase; HET: BB2 CIT; 1.70A {Bacillus cereus} PDB: 1lqy_A* Length = 185 Back     alignment and structure
>1xeo_A Peptide deformylase; cobalt deformylase, formate, hydrolase; 1.30A {Escherichia coli} SCOP: d.167.1.1 PDB: 1bs5_A 1bs6_A 1bs7_A 1bs8_A 1bsj_A* 1bsk_A* 1bsz_A* 1g27_A* 1bs4_A* 1icj_A* 1lru_A* 1xem_A 1xen_A 1g2a_A 2ai8_A* 4al3_A 4al2_A 3k6l_A* 1dff_A 1def_A ... Length = 168 Back     alignment and structure
>1ws0_A Peptide deformylase 1; alpha + beta topology, hydrolase; 1.70A {Bacillus cereus} PDB: 1ws1_A* Length = 156 Back     alignment and structure
>2w3t_A Peptide deformylase; protein biosynthesis, iron, nickel, hydrolase, metal-binding; 1.69A {Escherichia coli} PDB: 2w3u_A Length = 188 Back     alignment and structure
>3u04_A Peptide deformylase 1; ssgcid, actinonin, ehrlichia chaffeensi structural genomics; HET: BB2; 1.70A {Ehrlichia chaffeensis} PDB: 3oca_A Length = 190 Back     alignment and structure
>3svj_P Peptide deformylase 3; alpha-beta, metal binding protein, HYDR hydrolase inhibitor complex; HET: 4LI; 1.55A {Streptococcus pneumoniae} PDB: 3str_P* 3sw8_P* 1lm6_A 2aia_A* 2ai7_A* 2aie_P* 2os3_A* Length = 203 Back     alignment and structure
>3qu1_A Peptide deformylase 2; structural genomics, center for structural genomics of infec diseases, csgid, metal binding; 1.80A {Vibrio cholerae} Length = 171 Back     alignment and structure
>2os0_A Peptide deformylase; PDF, hydrolase; 1.30A {Enterococcus faecalis} PDB: 2os1_A* 3g6n_A 3cmd_A Length = 188 Back     alignment and structure
>3l87_A Peptide deformylase; hydrolase, iron, metal-binding, PR biosynthesis; 2.00A {Streptococcus mutans} Length = 238 Back     alignment and structure
>1lm4_A Peptide deformylase PDF1; metalloenzyme, hydrolase; 1.45A {Staphylococcus aureus} SCOP: d.167.1.1 PDB: 1lqw_A 2ai9_A 1lmh_A 1q1y_A* Length = 194 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
3u04_A190 Peptide deformylase 1; ssgcid, actinonin, ehrlichi 100.0
3pn3_A193 Peptide deformylase 1B, chloroplastic; PDF, N-term 100.0
1xeo_A168 Peptide deformylase; cobalt deformylase, formate, 100.0
1n5n_A180 Peptide deformylase; metalloenzyme, drug design, d 100.0
1rl4_A188 Formylmethionine deformylase; crystal engineering, 100.0
3qu1_A171 Peptide deformylase 2; structural genomics, center 100.0
3uwb_A154 RIIA-RIIB membrane-associated protein; actinonin, 100.0
2ew5_A181 Peptide deformylase; inhibitor, hydrolase; HET: Y1 100.0
2w3t_A188 Peptide deformylase; protein biosynthesis, iron, n 100.0
1lme_A176 PDF, peptide deformylase; thermophIle, metalloenzy 100.0
4dr9_A192 Peptide deformylase; hydrolase-hydrolase inhibitor 100.0
3e3u_A197 Peptide deformylase; metallo-enzyme, hydrolase, ir 100.0
1v3y_A192 Peptide deformylase; protein synthesis, riken stru 100.0
1y6h_A177 Peptide deformylase; open and close conformation, 100.0
3dld_A171 Peptide deformylase; bacterial blight, XOO1075, xa 100.0
1ws0_A156 Peptide deformylase 1; alpha + beta topology, hydr 100.0
3g5k_A183 Peptide deformylase, mitochondrial; actinonin, hyd 100.0
1zxz_A197 PDF, peptide deformylase, mitochondrial; PDF1A, eu 100.0
2okl_A185 Peptide deformylase 2; hydrolase; HET: BB2 CIT; 1. 100.0
2os0_A188 Peptide deformylase; PDF, hydrolase; 1.30A {Entero 100.0
1lm4_A194 Peptide deformylase PDF1; metalloenzyme, hydrolase 100.0
3svj_P203 Peptide deformylase 3; alpha-beta, metal binding p 100.0
3l87_A238 Peptide deformylase; hydrolase, iron, metal-bindin 100.0
>3u04_A Peptide deformylase 1; ssgcid, actinonin, ehrlichia chaffeensi structural genomics; HET: BB2; 1.70A {Ehrlichia chaffeensis} SCOP: d.167.1.0 PDB: 3oca_A Back     alignment and structure
Probab=100.00  E-value=9.5e-56  Score=337.55  Aligned_cols=129  Identities=32%  Similarity=0.564  Sum_probs=119.5

Q ss_pred             ChHhhhcCCCeEEeccccCccceEEEEecCCCCC-----------------CceeEEEEcceEEeeCCcEeeCeeecccc
Q 032961            1 MFDVMYKTDGIGLSAPQVGINVQLMVFNPVGERG-----------------EGEEIVLVNPRVNKYSNKMIPYEEGCLSF   63 (130)
Q Consensus         1 m~~tm~~~~gvGLAApQIG~~~ri~vi~~~~~~~-----------------~~~~~v~iNP~I~~~s~~~~~~~EgClS~   63 (130)
                      |++|||+++||||||||||+++|+||++......                 ...+.+||||+|++.|++....+|||||+
T Consensus        37 M~eTM~~~~GvGLAApQIGv~~Ri~vid~~~~~~~~~~~~~~~~~~~~~~~~~~~~vlINP~I~~~s~~~~~~~EGCLSv  116 (190)
T 3u04_A           37 MFETMHANQGLGLAAVQVGVHKRILVMNVPEEFEDSEDIENVEDKIEGYELYGGPYCIINPKIVDISQEKVKLKEGCLSV  116 (190)
T ss_dssp             HHHHHHHTTCSEEEGGGGTCCBSEEEEEECCC-------------CTTCBSSEEEEEEEEEEEEEECSCEEEEEECCTTS
T ss_pred             HHHHHHHcCCeEEehhhcCCceeEEEEEcCccccccccccccccccccccccCCCEEEECCEEEecCCCEeeccCCCCCc
Confidence            8999999999999999999999999999764211                 23578999999999999988889999999


Q ss_pred             CCCeeeecCCCceEEEEEcCCCCEEEEEEeccceehHhhhhhhhCCceeeecCCHHHHHHHHHHhc
Q 032961           64 PGIHADVERPESVKIDARDINGARFSVSLSDLPARVFQHEFDHLQGILFFERMTDDVLDSIREQLE  129 (130)
Q Consensus        64 pg~~~~V~R~~~I~v~~~d~~g~~~~~~~~g~~Ar~~QHEiDHL~G~l~~Dr~~~~~~~~~~~~~~  129 (130)
                      ||+++.|+||.+|+|+|+|++|++++++++||+|||||||+|||+|+||+||+++.+|.+++++++
T Consensus       117 Pg~~~~V~R~~~I~V~~~D~~G~~~~~~~~G~~Ar~iQHEiDHL~GiLfiDrl~~~~r~~~~~~~~  182 (190)
T 3u04_A          117 PGYFDYIVRPQRIAVQYLDYNGNECIIKAQGWLARCLQHEIDHLNGTVFLKYLSKFKRDFAIEKVK  182 (190)
T ss_dssp             TTCCEEEEEESCEEEEEECTTSCEEEEEECHHHHHHHHHHHHHHTTCCGGGGSCHHHHHHHHHHHH
T ss_pred             CCcceeeccchheEEEEECCCCCEEEEEEEChhhhhhhhHHHhcCCEeeeeecCHHHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999999999999999999999988764
>3pn3_A Peptide deformylase 1B, chloroplastic; PDF, N-terminal excision pathway, N induced-FIT, hydrolase-hydrolase inhibitor complex; HET: PN3; 1.30A {Arabidopsis thaliana} PDB: 3m6p_A* 3o3j_A* 3pn2_A 3m6o_A* 3pn4_A* 3pn5_A 3m6q_A 3pn6_A 3m6r_A 3cpm_A Back     alignment and structure
>1xeo_A Peptide deformylase; cobalt deformylase, formate, hydrolase; 1.30A {Escherichia coli} SCOP: d.167.1.1 PDB: 1bs5_A 1bs6_A 1bs7_A 1bs8_A 1bsj_A* 1bsk_A* 1bsz_A* 1g27_A* 1bs4_A* 1icj_A* 1lru_A* 1xem_A 1xen_A 1g2a_A 2ai8_A* 4al3_A 4al2_A 3k6l_A* 1dff_A 1def_A ... Back     alignment and structure
>1n5n_A Peptide deformylase; metalloenzyme, drug design, deformylation, hydrolase; 1.80A {Pseudomonas aeruginosa} SCOP: d.167.1.1 PDB: 1s17_A* 1ix1_A* 1lry_A* Back     alignment and structure
>1rl4_A Formylmethionine deformylase; crystal engineering, drug design, malaria, PDF, peptide DEFO plasmodium, hydrolase; HET: BRR BL5; 2.18A {Plasmodium falciparum} SCOP: d.167.1.1 PDB: 1rqc_A 1jym_A Back     alignment and structure
>3qu1_A Peptide deformylase 2; structural genomics, center for structural genomics of infec diseases, csgid, metal binding; 1.80A {Vibrio cholerae} SCOP: d.167.1.0 Back     alignment and structure
>3uwb_A RIIA-RIIB membrane-associated protein; actinonin, probable peptide deformylase hydrolase-antibiotic complex; HET: BB2; 1.70A {Synechococcus phage s-ssm7} PDB: 3uwa_A* Back     alignment and structure
>2ew5_A Peptide deformylase; inhibitor, hydrolase; HET: Y12; 2.20A {Helicobacter pylori} PDB: 2ew6_A* 2ew7_A Back     alignment and structure
>2w3t_A Peptide deformylase; protein biosynthesis, iron, nickel, hydrolase, metal-binding; 1.69A {Escherichia coli} PDB: 2w3u_A Back     alignment and structure
>1lme_A PDF, peptide deformylase; thermophIle, metalloenzyme, deformylation, structural genomics, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: d.167.1.1 Back     alignment and structure
>4dr9_A Peptide deformylase; hydrolase-hydrolase inhibitor complex; HET: BB2; 1.90A {Synechococcus elongatus} Back     alignment and structure
>3e3u_A Peptide deformylase; metallo-enzyme, hydrolase, iron, metal-binding, protein biosynthesis; HET: NVC; 1.56A {Mycobacterium tuberculosis} Back     alignment and structure
>1v3y_A Peptide deformylase; protein synthesis, riken structural genomics/proteomics initiative, RSGI, structural genomics, hydrolase; 1.81A {Thermus thermophilus} SCOP: d.167.1.1 Back     alignment and structure
>1y6h_A Peptide deformylase; open and close conformation, PDF, hydrolase; 2.20A {Leptospira interrogans} SCOP: d.167.1.1 PDB: 1sv2_A* 1vey_A* 1vev_A 1vez_A 1szz_A* Back     alignment and structure
>3dld_A Peptide deformylase; bacterial blight, XOO1075, xanthomonas oryzae PV. oryzae KACC10331, hydrolase; 2.60A {Xanthomonas oryzae PV} SCOP: d.167.1.0 Back     alignment and structure
>1ws0_A Peptide deformylase 1; alpha + beta topology, hydrolase; 1.70A {Bacillus cereus} PDB: 1ws1_A* Back     alignment and structure
>3g5k_A Peptide deformylase, mitochondrial; actinonin, hydrolase, iron, metal-bindi mitochondrion, protein biosynthesis, transit peptide; HET: BB2; 1.70A {Homo sapiens} PDB: 3g5p_A Back     alignment and structure
>1zxz_A PDF, peptide deformylase, mitochondrial; PDF1A, eukaryote, higher plant, zinc ION, hydrolase; 2.80A {Arabidopsis thaliana} PDB: 1zy0_A 1zy1_A Back     alignment and structure
>2okl_A Peptide deformylase 2; hydrolase; HET: BB2 CIT; 1.70A {Bacillus cereus} PDB: 1lqy_A* Back     alignment and structure
>2os0_A Peptide deformylase; PDF, hydrolase; 1.30A {Enterococcus faecalis} PDB: 2os1_A* 3g6n_A 3cmd_A Back     alignment and structure
>1lm4_A Peptide deformylase PDF1; metalloenzyme, hydrolase; 1.45A {Staphylococcus aureus} SCOP: d.167.1.1 PDB: 1lqw_A 2ai9_A 1lmh_A 1q1y_A* Back     alignment and structure
>3svj_P Peptide deformylase 3; alpha-beta, metal binding protein, HYDR hydrolase inhibitor complex; HET: 4LI; 1.55A {Streptococcus pneumoniae} SCOP: d.167.1.1 PDB: 3str_P* 3sw8_P* 4eox_P* 1lm6_A 2aia_A* 2ai7_A* 2aie_P* 2os3_A* Back     alignment and structure
>3l87_A Peptide deformylase; hydrolase, iron, metal-binding, PR biosynthesis; 2.00A {Streptococcus mutans} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 130
d1v3ya_182 d.167.1.1 (A:) Peptide deformylase {Thermus thermo 5e-30
d1y6ha_177 d.167.1.1 (A:) Peptide deformylase {Leptospira int 9e-29
d1lmea_154 d.167.1.1 (A:) Peptide deformylase {Thermotoga mar 8e-24
d1ix1a_169 d.167.1.1 (A:) Peptide deformylase {Pseudomonas ae 1e-23
d1lm6a_202 d.167.1.1 (A:) Peptide deformylase {Streptococcus 2e-22
d1rl4a_165 d.167.1.1 (A:) Peptide deformylase {Malaria parasi 2e-22
d1xeoa1164 d.167.1.1 (A:1-164) Peptide deformylase {Escherich 4e-21
d1lqya_184 d.167.1.1 (A:) Peptide deformylase {Bacillus stear 4e-20
d1lm4a_194 d.167.1.1 (A:) Peptide deformylase {Staphylococcus 3e-19
>d1v3ya_ d.167.1.1 (A:) Peptide deformylase {Thermus thermophilus [TaxId: 274]} Length = 182 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Peptide deformylase
superfamily: Peptide deformylase
family: Peptide deformylase
domain: Peptide deformylase
species: Thermus thermophilus [TaxId: 274]

 Score =  104 bits (260), Expect = 5e-30
 Identities = 49/140 (35%), Positives = 76/140 (54%), Gaps = 11/140 (7%)

Query: 1   MFDVMYKTDGIGLSAPQVGINVQLMVFNPVGERGEGEE----------IVLVNPRVNKYS 50
           M + M++  G+GL+APQ+G++ +L V     +  EGEE          + +V   V  Y 
Sbjct: 33  MLETMFEAKGVGLAAPQIGLSQRLFVAVEYADEPEGEEERPLRELVRRVYVVANPVITYR 92

Query: 51  NKMIPYEEGCLSFPGIHA-DVERPESVKIDARDINGARFSVSLSDLPARVFQHEFDHLQG 109
             ++   EGCLS PG+++ +V R E ++++ +D  G    + L    ARVFQHE DHL G
Sbjct: 93  EGLVEGTEGCLSLPGLYSEEVPRAERIRVEYQDEEGRGRVLELEGYMARVFQHEIDHLDG 152

Query: 110 ILFFERMTDDVLDSIREQLE 129
           ILFFER+     ++  E   
Sbjct: 153 ILFFERLPKPKREAFLEANR 172
>d1y6ha_ d.167.1.1 (A:) Peptide deformylase {Leptospira interrogans [TaxId: 173]} Length = 177 Back     information, alignment and structure
>d1lmea_ d.167.1.1 (A:) Peptide deformylase {Thermotoga maritima [TaxId: 2336]} Length = 154 Back     information, alignment and structure
>d1ix1a_ d.167.1.1 (A:) Peptide deformylase {Pseudomonas aeruginosa [TaxId: 287]} Length = 169 Back     information, alignment and structure
>d1lm6a_ d.167.1.1 (A:) Peptide deformylase {Streptococcus pneumoniae [TaxId: 1313]} Length = 202 Back     information, alignment and structure
>d1rl4a_ d.167.1.1 (A:) Peptide deformylase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 165 Back     information, alignment and structure
>d1xeoa1 d.167.1.1 (A:1-164) Peptide deformylase {Escherichia coli [TaxId: 562]} Length = 164 Back     information, alignment and structure
>d1lqya_ d.167.1.1 (A:) Peptide deformylase {Bacillus stearothermophilus [TaxId: 1422]} Length = 184 Back     information, alignment and structure
>d1lm4a_ d.167.1.1 (A:) Peptide deformylase {Staphylococcus aureus [TaxId: 1280]} Length = 194 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
d1xeoa1164 Peptide deformylase {Escherichia coli [TaxId: 562] 100.0
d1ix1a_169 Peptide deformylase {Pseudomonas aeruginosa [TaxId 100.0
d1rl4a_165 Peptide deformylase {Malaria parasite (Plasmodium 100.0
d1y6ha_177 Peptide deformylase {Leptospira interrogans [TaxId 100.0
d1lmea_154 Peptide deformylase {Thermotoga maritima [TaxId: 2 100.0
d1v3ya_182 Peptide deformylase {Thermus thermophilus [TaxId: 100.0
d1lm6a_202 Peptide deformylase {Streptococcus pneumoniae [Tax 100.0
d1lqya_184 Peptide deformylase {Bacillus stearothermophilus [ 100.0
d1lm4a_194 Peptide deformylase {Staphylococcus aureus [TaxId: 100.0
>d1xeoa1 d.167.1.1 (A:1-164) Peptide deformylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Peptide deformylase
superfamily: Peptide deformylase
family: Peptide deformylase
domain: Peptide deformylase
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=1.1e-53  Score=317.64  Aligned_cols=126  Identities=40%  Similarity=0.638  Sum_probs=117.7

Q ss_pred             ChHhhhcCCCeEEeccccCccceEEEEecCCCCCCceeEEEEcceEEeeCCcEeeCeeeccccCCCeeeecCCCceEEEE
Q 032961            1 MFDVMYKTDGIGLSAPQVGINVQLMVFNPVGERGEGEEIVLVNPRVNKYSNKMIPYEEGCLSFPGIHADVERPESVKIDA   80 (130)
Q Consensus         1 m~~tm~~~~gvGLAApQIG~~~ri~vi~~~~~~~~~~~~v~iNP~I~~~s~~~~~~~EgClS~pg~~~~V~R~~~I~v~~   80 (130)
                      |++||++++|+||||||||+++|+||++....  ...+.+||||+|++.|+. ...+|||||+||+++.|+||.+|+|+|
T Consensus        34 m~~tm~~~~GvGLAApQIG~~~rifvv~~~~~--~~~~~v~iNP~I~~~~~~-~~~~EgCLS~Pg~~~~V~R~~~I~v~y  110 (164)
T d1xeoa1          34 MFETMYAEEGIGLAATQVDIHQRIIVIDVSEN--RDERLVLINPELLEKSGE-TGIEEGCLSIPEQRALVPRAEKVKIRA  110 (164)
T ss_dssp             HHHHHHHTTCSEEEGGGGTCCBSEEEECCCTT--SCCCEEEEEEEEEEEECC-BCCEECCTTSTTCCEECCBCSEEEEEE
T ss_pred             HHHHhhhcCcceeeehhhccccceEEEEeecc--cCceEEecCcEEeeecce-eeecCCcccccccccccccccEEEEEE
Confidence            78999999999999999999999999987643  345789999999998877 578999999999999999999999999


Q ss_pred             EcCCCCEEEEEEeccceehHhhhhhhhCCceeeecCCHHHHHHHHHHhc
Q 032961           81 RDINGARFSVSLSDLPARVFQHEFDHLQGILFFERMTDDVLDSIREQLE  129 (130)
Q Consensus        81 ~d~~g~~~~~~~~g~~Ar~~QHEiDHL~G~l~~Dr~~~~~~~~~~~~~~  129 (130)
                      +|++|++++.+++||.|||+|||+|||+|+||+||+++.+|.++.++++
T Consensus       111 ~d~~G~~~~~~~~g~~Ar~~QHEiDHL~Gilf~Dr~~~~~~~~~~kk~~  159 (164)
T d1xeoa1         111 LDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVE  159 (164)
T ss_dssp             ECTTSCEEEEEECHHHHHHHHHHHHHHTTCCGGGGSCHHHHHHHHHHHH
T ss_pred             EcCCCCEEEEEEeeeeeehHHHHHHHhCCEehhhhcCHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999988864
>d1ix1a_ d.167.1.1 (A:) Peptide deformylase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rl4a_ d.167.1.1 (A:) Peptide deformylase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1y6ha_ d.167.1.1 (A:) Peptide deformylase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d1lmea_ d.167.1.1 (A:) Peptide deformylase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v3ya_ d.167.1.1 (A:) Peptide deformylase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lm6a_ d.167.1.1 (A:) Peptide deformylase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1lqya_ d.167.1.1 (A:) Peptide deformylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lm4a_ d.167.1.1 (A:) Peptide deformylase {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure