Citrus Sinensis ID: 032998

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MEISSKNNEIVDVSYVDDECSEQSWMLRSLSESTVACITGDYAMQNVILQMGLRLLAPGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGENGIVLASRRPRITLRGTKVSISL
ccEEcccccccccccccccccccHHHHcccccccEEEEccHHHHHHHHHHHccEEEccccccEEEEEEEEEEccccccEEccccccccccccccccEEEEEEEEccccEEEEEEcccccccccEEcccc
cccccccccccEEEEEccccccccHHHcccccccEEEEEHHHHHHHHHHHHcccEEccccHHHHHHHHHHHHHHHHHHcccccccEccccccccccEEEEEEEEccccEEEEEccccEcccccEEEccc
meissknneivdvsyvddecseqswMLRSLSESTVACITGDYAMQNVILQMGLRllapggmqIRQLHRWILKCHACYTITAEIgrifcpkcgnggtlRKVAVTVGENgivlasrrpritlrgtkvsisl
meissknneivdvsyVDDECSEQSWMLRSLSESTVACITGDYAMQNVILQMGLRLLAPGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGengivlasrrpritlrgtkvsisl
MEISSKNNEIVDVSYVDDECSEQSWMLRSLSESTVACITGDYAMQNVILQMGLRLLAPGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGENGIVLASRRPRITLRGTKVSISL
*********IVDVSYVDDECSEQSWMLRSLSESTVACITGDYAMQNVILQMGLRLLAPGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGENGIVLASRRPRIT**********
*****************************LSESTVACITGDYAMQNVILQMGLRLLAPGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGENGIVLASRRPRITLRGTKVSISL
MEISSKNNEIVDVSYVDDECSEQSWMLRSLSESTVACITGDYAMQNVILQMGLRLLAPGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGENGIVLASRRPRITLRGTKVSISL
*******NEIVDVSYVDD***EQSWMLRSLSESTVACITGDYAMQNVILQMGLRLLAPGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGENGIVLASRRPRITLRGTKVSISL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEISSKNNEIVDVSYVDDECSEQSWMLRSLSESTVACITGDYAMQNVILQMGLRLLAPGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGENGIVLASRRPRITLRGTKVSISL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query129 2.2.26 [Sep-21-2011]
Q5RBB3411 RNA-binding protein NOB1 yes no 0.713 0.223 0.479 2e-20
Q3T042413 RNA-binding protein NOB1 yes no 0.713 0.222 0.479 2e-20
Q4R537412 RNA-binding protein NOB1 N/A no 0.713 0.223 0.479 2e-20
Q9ULX3412 RNA-binding protein NOB1 yes no 0.713 0.223 0.479 2e-20
Q6VEU1410 RNA-binding protein NOB1 yes no 0.713 0.224 0.458 5e-20
Q8BW10403 RNA-binding protein NOB1 yes no 0.713 0.228 0.458 5e-20
Q9UTK0388 20S-pre-rRNA D-site endon yes no 0.713 0.237 0.410 6e-16
Q08444459 20S-pre-rRNA D-site endon yes no 0.565 0.159 0.435 1e-10
O29862166 Putative ribonuclease Vap yes no 0.496 0.385 0.347 4e-05
>sp|Q5RBB3|NOB1_PONAB RNA-binding protein NOB1 OS=Pongo abelii GN=NOB1 PE=2 SV=1 Back     alignment and function desciption
 Score = 97.8 bits (242), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 46/96 (47%), Positives = 67/96 (69%), Gaps = 4/96 (4%)

Query: 35  VACITGDYAMQNVILQMGLRLLAPGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNG 94
           V C+T D+AMQNV+LQMGL +LA  GM IR+   +IL+CH C+  T+++ R+FC  CGN 
Sbjct: 231 VGCVTTDFAMQNVLLQMGLHVLAVNGMLIREARSYILRCHGCFKTTSDMSRVFCSHCGN- 289

Query: 95  GTLRKVAVTVGENGIVLA--SRRPRI-TLRGTKVSI 127
            TL+KV+VTV ++G +    SR P++   RG + S+
Sbjct: 290 KTLKKVSVTVSDDGTLHMHFSRNPKVLNPRGLRYSL 325
May play a role in mRNA degradation.
Pongo abelii (taxid: 9601)
>sp|Q3T042|NOB1_BOVIN RNA-binding protein NOB1 OS=Bos taurus GN=NOB1 PE=2 SV=1 Back     alignment and function description
>sp|Q4R537|NOB1_MACFA RNA-binding protein NOB1 OS=Macaca fascicularis GN=NOB1 PE=2 SV=1 Back     alignment and function description
>sp|Q9ULX3|NOB1_HUMAN RNA-binding protein NOB1 OS=Homo sapiens GN=NOB1 PE=1 SV=1 Back     alignment and function description
>sp|Q6VEU1|NOB1_RAT RNA-binding protein NOB1 OS=Rattus norvegicus GN=Nob1 PE=2 SV=1 Back     alignment and function description
>sp|Q8BW10|NOB1_MOUSE RNA-binding protein NOB1 OS=Mus musculus GN=Nob1 PE=1 SV=1 Back     alignment and function description
>sp|Q9UTK0|NOB1_SCHPO 20S-pre-rRNA D-site endonuclease nob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nob1 PE=3 SV=1 Back     alignment and function description
>sp|Q08444|NOB1_YEAST 20S-pre-rRNA D-site endonuclease NOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOB1 PE=1 SV=1 Back     alignment and function description
>sp|O29862|VAPC8_ARCFU Putative ribonuclease VapC8 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=vapC8 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query129
449495836 617 PREDICTED: LOW QUALITY PROTEIN: RNA-bind 1.0 0.209 0.837 1e-61
449452344 617 PREDICTED: RNA-binding protein NOB1-like 1.0 0.209 0.837 1e-61
359474015 633 PREDICTED: RNA-binding protein NOB1-like 1.0 0.203 0.806 2e-60
297742539 560 unnamed protein product [Vitis vinifera] 1.0 0.230 0.806 2e-60
147800398 621 hypothetical protein VITISV_020978 [Viti 1.0 0.207 0.806 2e-60
255537423 628 RNA-binding protein nob1, putative [Rici 1.0 0.205 0.821 3e-60
356513405 632 PREDICTED: uncharacterized protein LOC10 1.0 0.204 0.798 1e-58
224071796 588 predicted protein [Populus trichocarpa] 0.984 0.215 0.826 1e-58
357520491 613 RNA-binding protein NOB1 [Medicago trunc 0.984 0.207 0.804 3e-58
357138448 598 PREDICTED: RNA-binding protein NOB1-like 1.0 0.215 0.775 4e-58
>gi|449495836|ref|XP_004159959.1| PREDICTED: LOW QUALITY PROTEIN: RNA-binding protein NOB1-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 108/129 (83%), Positives = 120/129 (93%)

Query: 1   MEISSKNNEIVDVSYVDDECSEQSWMLRSLSESTVACITGDYAMQNVILQMGLRLLAPGG 60
           ME +S+ NE VD+S VDD  S+QSWMLRSLSES+VAC+TGDYAMQNV+LQMGLRLLAPGG
Sbjct: 404 MEDASQTNESVDMSNVDDVSSDQSWMLRSLSESSVACVTGDYAMQNVLLQMGLRLLAPGG 463

Query: 61  MQIRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGENGIVLASRRPRITL 120
           MQIRQLHRWILKCHACY +TAEIGRIFCPKCGNGGTLRKVAVTVGENG+VLA+R+PRITL
Sbjct: 464 MQIRQLHRWILKCHACYNVTAEIGRIFCPKCGNGGTLRKVAVTVGENGVVLAARKPRITL 523

Query: 121 RGTKVSISL 129
           RGTK S+ L
Sbjct: 524 RGTKFSLPL 532

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449452344|ref|XP_004143919.1| PREDICTED: RNA-binding protein NOB1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|359474015|ref|XP_002269627.2| PREDICTED: RNA-binding protein NOB1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297742539|emb|CBI34688.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147800398|emb|CAN66411.1| hypothetical protein VITISV_020978 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255537423|ref|XP_002509778.1| RNA-binding protein nob1, putative [Ricinus communis] gi|223549677|gb|EEF51165.1| RNA-binding protein nob1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356513405|ref|XP_003525404.1| PREDICTED: uncharacterized protein LOC100800291 [Glycine max] Back     alignment and taxonomy information
>gi|224071796|ref|XP_002303575.1| predicted protein [Populus trichocarpa] gi|222841007|gb|EEE78554.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357520491|ref|XP_003630534.1| RNA-binding protein NOB1 [Medicago truncatula] gi|355524556|gb|AET05010.1| RNA-binding protein NOB1 [Medicago truncatula] Back     alignment and taxonomy information
>gi|357138448|ref|XP_003570804.1| PREDICTED: RNA-binding protein NOB1-like [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query129
TAIR|locus:2163071602 NOB1 [Arabidopsis thaliana (ta 1.0 0.214 0.753 2.8e-50
UNIPROTKB|Q3T042413 NOB1 "RNA-binding protein NOB1 0.713 0.222 0.479 2e-19
UNIPROTKB|Q9ULX3412 NOB1 "RNA-binding protein NOB1 0.713 0.223 0.479 2.6e-19
MGI|MGI:1914869403 Nob1 "NIN1/RPN12 binding prote 0.713 0.228 0.458 3.9e-19
RGD|735222410 Nob1 "NIN1/RPN12 binding prote 0.713 0.224 0.458 4.2e-19
FB|FBgn0030177472 CG2972 [Drosophila melanogaste 0.627 0.171 0.505 6.6e-17
POMBASE|SPAC1486.09388 SPAC1486.09 "ribosome biogenes 0.713 0.237 0.4 1.3e-15
WB|WBGene00021843364 Y54E10BR.4 [Caenorhabditis ele 0.565 0.200 0.445 3.7e-13
ASPGD|ASPL0000014547431 AN8253 [Emericella nidulans (t 0.565 0.169 0.453 3.3e-12
UNIPROTKB|G4MQ79467 MGG_09254 "20S-pre-rRNA D-site 0.558 0.154 0.397 8.3e-12
TAIR|locus:2163071 NOB1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 523 (189.2 bits), Expect = 2.8e-50, P = 2.8e-50
 Identities = 98/130 (75%), Positives = 114/130 (87%)

Query:     1 MEISSKNNEIVDVSYV-DDECSEQSWMLRSLSESTVACITGDYAMQNVILQMGLRLLAPG 59
             +EI+S+  +  + S + DD  SEQSW LR+LSES+VACITGDYAMQNVILQMGLRLLAPG
Sbjct:   389 LEIASEAEDTFEASSIGDDGSSEQSWSLRALSESSVACITGDYAMQNVILQMGLRLLAPG 448

Query:    60 GMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGENGIVLASRRPRIT 119
             GMQIRQLHRWILKCHACYT+T EIGRIFCPKCGNGGTLRKVAVT+G NG ++A+ +PRIT
Sbjct:   449 GMQIRQLHRWILKCHACYTVTPEIGRIFCPKCGNGGTLRKVAVTIGANGAIIAACKPRIT 508

Query:   120 LRGTKVSISL 129
             LRGT+ SI +
Sbjct:   509 LRGTQYSIPM 518
GO:0005634 "nucleus" evidence=ISM
GO:0006606 "protein import into nucleus" evidence=RCA
GO:0000469 "cleavage involved in rRNA processing" evidence=IDA
GO:0004521 "endoribonuclease activity" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0006364 "rRNA processing" evidence=IMP
GO:0009553 "embryo sac development" evidence=IMP
GO:0009555 "pollen development" evidence=IMP
UNIPROTKB|Q3T042 NOB1 "RNA-binding protein NOB1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9ULX3 NOB1 "RNA-binding protein NOB1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1914869 Nob1 "NIN1/RPN12 binding protein 1 homolog (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|735222 Nob1 "NIN1/RPN12 binding protein 1 homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0030177 CG2972 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
POMBASE|SPAC1486.09 SPAC1486.09 "ribosome biogenesis protein Nob1 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
WB|WBGene00021843 Y54E10BR.4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ASPGD|ASPL0000014547 AN8253 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|G4MQ79 MGG_09254 "20S-pre-rRNA D-site endonuclease NOB1" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00000393001
SubName- Full=Chromosome chr2 scaffold_105, whole genome shotgun sequence; (611 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00020673001
SubName- Full=Chromosome chr14 scaffold_21, whole genome shotgun sequence; (607 aa)
   •    0.427
GSVIVG00035100001
SubName- Full=Chromosome chr1 scaffold_75, whole genome shotgun sequence; (207 aa)
    •   0.408

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
pfam0877273 pfam08772, NOB1_Zn_bind, Nin one binding (NOB1) Zn 2e-26
COG1439177 COG1439, COG1439, Predicted nucleic acid-binding p 2e-12
>gnl|CDD|192150 pfam08772, NOB1_Zn_bind, Nin one binding (NOB1) Zn-ribbon like Back     alignment and domain information 
 Score = 93.8 bits (234), Expect = 2e-26
 Identities = 33/68 (48%), Positives = 46/68 (67%), Gaps = 3/68 (4%)

Query: 62  QIRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGENG--IVLASRRPRIT 119
           +I+QL RWIL+CHAC+  T ++ + FCPKCGN  TLR+VAV+V E+G   +   +  +  
Sbjct: 1   RIKQLRRWILRCHACFKTTPDMTKQFCPKCGN-ATLRRVAVSVDEDGEIKLHLKKNFQWN 59

Query: 120 LRGTKVSI 127
            RGT  SI
Sbjct: 60  TRGTIYSI 67

This domain corresponds to a zinc ribbon and is found on the RNA binding protein NOB1 (Nin one binding). Length = 73
>gnl|CDD|224356 COG1439, COG1439, Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 129
KOG2463376 consensus Predicted RNA-binding protein Nob1p invo 100.0
PF0877273 NOB1_Zn_bind: Nin one binding (NOB1) Zn-ribbon lik 99.96
COG1439177 Predicted nucleic acid-binding protein, consists o 99.91
PRK12496164 hypothetical protein; Provisional 99.83
TIGR03875206 RNA_lig_partner RNA ligase partner, MJ_0950 family 97.9
PRK04358217 hypothetical protein; Provisional 97.75
PF0972342 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 96.96
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 96.9
PF08745205 UPF0278: UPF0278 family; InterPro: IPR022785 This 96.84
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 96.75
PF1324826 zf-ribbon_3: zinc-ribbon domain 96.68
PF1324023 zinc_ribbon_2: zinc-ribbon domain 96.52
COG1545140 Predicted nucleic-acid-binding protein containing 95.79
PF1217237 DUF35_N: Rubredoxin-like zinc ribbon domain (DUF35 95.77
TIGR00100115 hypA hydrogenase nickel insertion protein HypA. In 95.72
PRK03681114 hypA hydrogenase nickel incorporation protein; Val 95.67
PRK00564117 hypA hydrogenase nickel incorporation protein; Pro 95.63
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 95.62
PRK12380113 hydrogenase nickel incorporation protein HybF; Pro 95.53
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 95.5
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 95.46
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 95.33
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 95.1
PRK03824135 hypA hydrogenase nickel incorporation protein; Pro 95.02
PRK1313056 H/ACA RNA-protein complex component Nop10p; Review 94.92
PF09845131 DUF2072: Zn-ribbon containing protein (DUF2072); I 94.72
PF01155113 HypA: Hydrogenase expression/synthesis hypA family 94.65
PF10263157 SprT-like: SprT-like family; InterPro: IPR006640 T 94.61
COG199649 RPC10 DNA-directed RNA polymerase, subunit RPC10 ( 94.55
COG3364112 Zn-ribbon containing protein [General function pre 94.51
COG1592166 Rubrerythrin [Energy production and conversion] 94.31
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 94.16
COG209364 DNA-directed RNA polymerase, subunit E'' [Transcri 93.96
PF0519136 ADK_lid: Adenylate kinase, active site lid; InterP 93.95
PF0413553 Nop10p: Nucleolar RNA-binding protein, Nop10p fami 93.58
COG226059 Predicted Zn-ribbon RNA-binding protein [Translati 93.21
PRK0639364 rpoE DNA-directed RNA polymerase subunit E''; Vali 93.19
PRK04351149 hypothetical protein; Provisional 92.98
PRK0835161 DNA-directed RNA polymerase subunit E''; Validated 92.95
PF0360432 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa 92.92
PRK07591 421 threonine synthase; Validated 92.55
TIGR03844 398 cysteate_syn cysteate synthase. Members of this fa 91.98
PRK00762124 hypA hydrogenase nickel incorporation protein; Pro 91.89
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 91.84
PF1501787 AF1Q: Drug resistance and apoptosis regulator 91.8
COG1645131 Uncharacterized Zn-finger containing protein [Gene 91.72
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 91.58
PF11023114 DUF2614: Protein of unknown function (DUF2614); In 91.54
PRK06450 338 threonine synthase; Validated 91.29
PF0030147 Rubredoxin: Rubredoxin; InterPro: IPR004039 Rubred 91.07
PRK00241256 nudC NADH pyrophosphatase; Reviewed 90.96
PF1277350 DZR: Double zinc ribbon 90.86
COG233182 Uncharacterized protein conserved in bacteria [Fun 90.85
PF07295146 DUF1451: Protein of unknown function (DUF1451); In 90.82
COG5257 415 GCD11 Translation initiation factor 2, gamma subun 90.67
PF1480334 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C. 90.59
COG1198 730 PriA Primosomal protein N' (replication factor Y) 90.49
PF1277350 DZR: Double zinc ribbon 90.43
PRK14714 1337 DNA polymerase II large subunit; Provisional 90.41
PRK06260 397 threonine synthase; Validated 90.12
PF0719170 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 90.1
smart00731146 SprT SprT homologues. Predicted to have roles in t 89.9
TIGR00595 505 priA primosomal protein N'. All proteins in this f 89.82
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 89.82
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 89.71
PRK00420112 hypothetical protein; Validated 89.48
PRK11032160 hypothetical protein; Provisional 89.3
cd0073050 rubredoxin Rubredoxin; nonheme iron binding domain 89.22
COG0375115 HybF Zn finger protein HypA/HybF (possibly regulat 88.08
PF0728269 OrfB_Zn_ribbon: Putative transposase DNA-binding d 87.75
PRK05978148 hypothetical protein; Provisional 87.34
PF0929732 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon do 87.27
TIGR003541095 polC DNA polymerase, archaeal type II, large subun 87.14
TIGR00354 1095 polC DNA polymerase, archaeal type II, large subun 86.37
TIGR02827586 RNR_anaer_Bdell anaerobic ribonucleoside-triphosph 86.25
cd01675555 RNR_III Class III ribonucleotide reductase. Ribonu 86.16
PF13638133 PIN_4: PIN domain; PDB: 2HWW_C 2HWX_A 2DOK_B 2HWY_ 86.1
PRK14873 665 primosome assembly protein PriA; Provisional 85.87
PF1420555 Cys_rich_KTR: Cysteine-rich KTR 85.65
PF0311928 DNA_ligase_ZBD: NAD-dependent DNA ligase C4 zinc f 85.47
PF14319111 Zn_Tnp_IS91: Transposase zinc-binding domain 85.41
PF1420555 Cys_rich_KTR: Cysteine-rich KTR 85.33
PRK040231121 DNA polymerase II large subunit; Validated 85.09
PF1436935 zf-RING_3: zinc-finger 84.95
PRK14559 645 putative protein serine/threonine phosphatase; Pro 84.73
PRK147141337 DNA polymerase II large subunit; Provisional 84.61
PF0879233 A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: I 84.54
COG1933253 Archaeal DNA polymerase II, large subunit [DNA rep 84.26
PF0215035 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; I 84.08
PRK07111735 anaerobic ribonucleoside triphosphate reductase; P 84.04
PF13597546 NRDD: Anaerobic ribonucleoside-triphosphate reduct 84.02
PF14353128 CpXC: CpXC protein 84.01
PRK11788389 tetratricopeptide repeat protein; Provisional 83.9
smart00531147 TFIIE Transcription initiation factor IIE. 83.7
PRK02935110 hypothetical protein; Provisional 83.68
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 83.68
PRK05580 679 primosome assembly protein PriA; Validated 83.4
PF1371736 zinc_ribbon_4: zinc-ribbon domain 83.2
COG026750 RpmG Ribosomal protein L33 [Translation, ribosomal 82.99
PF06676148 DUF1178: Protein of unknown function (DUF1178); In 82.95
COG0846250 SIR2 NAD-dependent protein deacetylases, SIR2 fami 82.78
PLN02569 484 threonine synthase 82.72
TIGR02487579 NrdD anaerobic ribonucleoside-triphosphate reducta 82.66
COG3091156 SprT Zn-dependent metalloprotease, SprT family [Ge 82.28
PRK147151627 DNA polymerase II large subunit; Provisional 82.24
PRK14559 645 putative protein serine/threonine phosphatase; Pro 82.13
PRK11823 446 DNA repair protein RadA; Provisional 82.03
PRK05452479 anaerobic nitric oxide reductase flavorubredoxin; 81.86
PF1371937 zinc_ribbon_5: zinc-ribbon domain 81.86
PRK05638 442 threonine synthase; Validated 81.49
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 81.45
PRK08270656 anaerobic ribonucleoside triphosphate reductase; P 81.42
TIGR00686109 phnA alkylphosphonate utilization operon protein P 81.41
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 80.73
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 80.72
cd01407218 SIR2-fam SIR2 family of proteins includes silent i 80.48
cd04476166 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds cor 80.33
PRK10220111 hypothetical protein; Provisional 80.09
PF0190755 Ribosomal_L37e: Ribosomal protein L37e; InterPro: 80.07
>KOG2463 consensus Predicted RNA-binding protein Nob1p involved in 26S proteasome assembly [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=9.6e-44  Score=298.70  Aligned_cols=104  Identities=46%  Similarity=0.811  Sum_probs=97.7

Q ss_pred             eeeec--------------CCCceeeEeechHHHHHHHHHhCceeecCCCCcceeeeeEEEEccCccccccccCccccCC
Q 032998           25 WMLRS--------------LSESTVACITGDYAMQNVILQMGLRLLAPGGMQIRQLHRWILKCHACYTITAEIGRIFCPK   90 (129)
Q Consensus        25 wi~~~--------------~~~~~va~~TdDyamQNVl~~lGL~~~s~~g~~I~~~k~W~~rC~~C~k~~~~~~~~fCp~   90 (129)
                      |||++              +.+..|+|+|+||||||||+||||+++++.|++|+++++|++||||||+++++|++.|||+
T Consensus       183 witp~ni~~~~~e~~al~~pe~~~Vac~TtDfamQNVlLqm~L~l~~~~G~~Ir~~r~~iLRCh~Cfsit~~m~k~FCp~  262 (376)
T KOG2463|consen  183 WITPSNITEAIIELGALNRPENQLVACLTTDFAMQNVLLQMNLNLLAMSGMKIRSVRSYILRCHGCFSITSEMPKDFCPS  262 (376)
T ss_pred             ccccchHHHHHHhhhcccccccceeeeecccHHHHHHHHHhcccccCccchhhhhhhhheeEeeeeeEecCccchhcccc
Confidence            99976              2567899999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCceeEEEEEeCCCceEEeec--CCccccCceeecCCC
Q 032998           91 CGNGGTLRKVAVTVGENGIVLASR--RPRITLRGTKVSISL  129 (129)
Q Consensus        91 CG~~~tL~rv~v~v~~~G~~~~~~--~~~~n~RG~~ySlP~  129 (129)
                      ||++ ||+|++|+|++||+++.|.  |++||+||++||||+
T Consensus       263 CG~~-TL~K~aVsv~~dG~~~~h~k~r~~~n~RG~~YSlp~  302 (376)
T KOG2463|consen  263 CGHK-TLTKCAVSVDEDGNGQTHFKKRFQWNNRGLQYSLPK  302 (376)
T ss_pred             cCCC-eeeEEEEEecCCCceeEEeecccccccCcceeecCC
Confidence            9999 9999999999999987664  556999999999996

>PF08772 NOB1_Zn_bind: Nin one binding (NOB1) Zn-ribbon like; InterPro: IPR014881 This entry corresponds to a zinc ribbon and is found on the RNA binding protein NOB1 Back     alignment and domain information
>COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only] Back     alignment and domain information
>PRK12496 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03875 RNA_lig_partner RNA ligase partner, MJ_0950 family Back     alignment and domain information
>PRK04358 hypothetical protein; Provisional Back     alignment and domain information
>PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>PF08745 UPF0278: UPF0278 family; InterPro: IPR022785 This entry contains proteins of the UPF0278 family and proteins containing PIN domains Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>PF13248 zf-ribbon_3: zinc-ribbon domain Back     alignment and domain information
>PF13240 zinc_ribbon_2: zinc-ribbon domain Back     alignment and domain information
>COG1545 Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only] Back     alignment and domain information
>PF12172 DUF35_N: Rubredoxin-like zinc ribbon domain (DUF35_N); InterPro: IPR022002 This domain has no known function and is found in conserved hypothetical archaeal and bacterial proteins Back     alignment and domain information
>TIGR00100 hypA hydrogenase nickel insertion protein HypA Back     alignment and domain information
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated Back     alignment and domain information
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed Back     alignment and domain information
>PF09845 DUF2072: Zn-ribbon containing protein (DUF2072); InterPro: IPR018645 This archaeal Zinc-ribbon containing proteins have no known function Back     alignment and domain information
>PF01155 HypA: Hydrogenase expression/synthesis hypA family; InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation Back     alignment and domain information
>PF10263 SprT-like: SprT-like family; InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT) Back     alignment and domain information
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription] Back     alignment and domain information
>COG3364 Zn-ribbon containing protein [General function prediction only] Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>COG2093 DNA-directed RNA polymerase, subunit E'' [Transcription] Back     alignment and domain information
>PF05191 ADK_lid: Adenylate kinase, active site lid; InterPro: IPR007862 Adenylate kinases (ADK; 2 Back     alignment and domain information
>PF04135 Nop10p: Nucleolar RNA-binding protein, Nop10p family; InterPro: IPR007264 H/ACA ribonucleoprotein particles (RNPs) are a family of RNA pseudouridine synthases that specify modification sites through guide RNAs Back     alignment and domain information
>COG2260 Predicted Zn-ribbon RNA-binding protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06393 rpoE DNA-directed RNA polymerase subunit E''; Validated Back     alignment and domain information
>PRK04351 hypothetical protein; Provisional Back     alignment and domain information
>PRK08351 DNA-directed RNA polymerase subunit E''; Validated Back     alignment and domain information
>PF03604 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa subunit; InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates Back     alignment and domain information
>PRK07591 threonine synthase; Validated Back     alignment and domain information
>TIGR03844 cysteate_syn cysteate synthase Back     alignment and domain information
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>PF15017 AF1Q: Drug resistance and apoptosis regulator Back     alignment and domain information
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only] Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF11023 DUF2614: Protein of unknown function (DUF2614); InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins Back     alignment and domain information
>PRK06450 threonine synthase; Validated Back     alignment and domain information
>PF00301 Rubredoxin: Rubredoxin; InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier [] Back     alignment and domain information
>PRK00241 nudC NADH pyrophosphatase; Reviewed Back     alignment and domain information
>PF12773 DZR: Double zinc ribbon Back     alignment and domain information
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07295 DUF1451: Protein of unknown function (DUF1451); InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF14803 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF12773 DZR: Double zinc ribbon Back     alignment and domain information
>PRK14714 DNA polymerase II large subunit; Provisional Back     alignment and domain information
>PRK06260 threonine synthase; Validated Back     alignment and domain information
>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length Back     alignment and domain information
>smart00731 SprT SprT homologues Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PRK00420 hypothetical protein; Validated Back     alignment and domain information
>PRK11032 hypothetical protein; Provisional Back     alignment and domain information
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center Back     alignment and domain information
>COG0375 HybF Zn finger protein HypA/HybF (possibly regulating hydrogenase expression) [General function prediction only] Back     alignment and domain information
>PF07282 OrfB_Zn_ribbon: Putative transposase DNA-binding domain; InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins Back     alignment and domain information
>PRK05978 hypothetical protein; Provisional Back     alignment and domain information
>PF09297 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon domain; InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains Back     alignment and domain information
>TIGR00354 polC DNA polymerase, archaeal type II, large subunit Back     alignment and domain information
>TIGR00354 polC DNA polymerase, archaeal type II, large subunit Back     alignment and domain information
>TIGR02827 RNR_anaer_Bdell anaerobic ribonucleoside-triphosphate reductase Back     alignment and domain information
>cd01675 RNR_III Class III ribonucleotide reductase Back     alignment and domain information
>PF13638 PIN_4: PIN domain; PDB: 2HWW_C 2HWX_A 2DOK_B 2HWY_B 2WP8_J Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PF14205 Cys_rich_KTR: Cysteine-rich KTR Back     alignment and domain information
>PF03119 DNA_ligase_ZBD: NAD-dependent DNA ligase C4 zinc finger domain; InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14319 Zn_Tnp_IS91: Transposase zinc-binding domain Back     alignment and domain information
>PF14205 Cys_rich_KTR: Cysteine-rich KTR Back     alignment and domain information
>PRK04023 DNA polymerase II large subunit; Validated Back     alignment and domain information
>PF14369 zf-RING_3: zinc-finger Back     alignment and domain information
>PRK14559 putative protein serine/threonine phosphatase; Provisional Back     alignment and domain information
>PRK14714 DNA polymerase II large subunit; Provisional Back     alignment and domain information
>PF08792 A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors [] Back     alignment and domain information
>COG1933 Archaeal DNA polymerase II, large subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PF02150 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; InterPro: IPR001529 DNA-directed RNA polymerases 2 Back     alignment and domain information
>PRK07111 anaerobic ribonucleoside triphosphate reductase; Provisional Back     alignment and domain information
>PF13597 NRDD: Anaerobic ribonucleoside-triphosphate reductase; PDB: 1HK8_A 1H78_A 1H7A_A 1H79_A 1H7B_A Back     alignment and domain information
>PF14353 CpXC: CpXC protein Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>PRK02935 hypothetical protein; Provisional Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>COG0267 RpmG Ribosomal protein L33 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF06676 DUF1178: Protein of unknown function (DUF1178); InterPro: IPR009562 This family consists of several hypothetical bacterial proteins of around 150 residues in length Back     alignment and domain information
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription] Back     alignment and domain information
>PLN02569 threonine synthase Back     alignment and domain information
>TIGR02487 NrdD anaerobic ribonucleoside-triphosphate reductase Back     alignment and domain information
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only] Back     alignment and domain information
>PRK14715 DNA polymerase II large subunit; Provisional Back     alignment and domain information
>PRK14559 putative protein serine/threonine phosphatase; Provisional Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>PRK05638 threonine synthase; Validated Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK08270 anaerobic ribonucleoside triphosphate reductase; Provisional Back     alignment and domain information
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>cd01407 SIR2-fam SIR2 family of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose Back     alignment and domain information
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70) Back     alignment and domain information
>PRK10220 hypothetical protein; Provisional Back     alignment and domain information
>PF01907 Ribosomal_L37e: Ribosomal protein L37e; InterPro: IPR001569 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
2con_A79 Solution Structure Of Rsgi Ruh-035, A Zn-Ribbon Mod 5e-09
>pdb|2CON|A Chain A, Solution Structure Of Rsgi Ruh-035, A Zn-Ribbon Module In Mouse Cdna Length = 79 Back     alignment and structure 
Iteration: 1

 Score = 56.2 bits (134), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 46/73 (63%), Gaps = 4/73 (5%)
Query: 57  APGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGENGIVLA--SR 114
           + G   +R+   +IL+CH C+  T+++ R+FC  CGN  TL+KV+VT+ ++G +    SR
Sbjct: 2   SSGSSGVREARSYILRCHGCFKTTSDMNRVFCGHCGN-KTLKKVSVTINDDGTLHMHFSR 60
Query: 115 RPRI-TLRGTKVS 126
            P++   RG + S
Sbjct: 61  NPKVLNPRGLRYS 73

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
2con_A79 RUH-035 protein, NIN one binding protein; ribosome 3e-27
2lcq_A165 Putative toxin VAPC6; PIN domain, Zn ribbon domain 8e-20
>2con_A RUH-035 protein, NIN one binding protein; ribosome, RNA binding protein, unknown function, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.41.15.1 Length = 79 Back     alignment and structure
 Score = 95.6 bits (238), Expect = 3e-27
 Identities = 24/74 (32%), Positives = 43/74 (58%), Gaps = 4/74 (5%)

Query: 57  APGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGENGIV---LAS 113
           + G   +R+   +IL+CH C+  T+++ R+FC  CGN  TL+KV+VT+ ++G +    + 
Sbjct: 2   SSGSSGVREARSYILRCHGCFKTTSDMNRVFCGHCGN-KTLKKVSVTINDDGTLHMHFSR 60

Query: 114 RRPRITLRGTKVSI 127
               +  RG + S 
Sbjct: 61  NPKVLNPRGLRYSS 74
>2lcq_A Putative toxin VAPC6; PIN domain, Zn ribbon domain, ribosome biogenesis, metal BIN protein; NMR {Pyrococcus horikoshii} Length = 165 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query129
2con_A79 RUH-035 protein, NIN one binding protein; ribosome 99.97
2lcq_A165 Putative toxin VAPC6; PIN domain, Zn ribbon domain 99.73
3irb_A145 Uncharacterized protein from DUF35 family; 1381535 96.94
2gnr_A145 Conserved hypothetical protein; 13815350, structur 96.65
2kdx_A119 HYPA, hydrogenase/urease nickel incorporation prot 96.32
3i8o_A142 KH domain-containing protein MJ1533; APC89320.5, m 95.34
2apo_B60 Ribosome biogenesis protein NOP10; protein-protein 95.25
3a43_A139 HYPD, hydrogenase nickel incorporation protein HYP 94.89
3pwf_A170 Rubrerythrin; non heme iron peroxidases, oxidative 94.78
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 94.74
2aus_D60 NOP10, ribosome biogenesis protein NOP10; isomeras 94.69
1twf_L70 ABC10-alpha, DNA-directed RNA polymerases I, II, a 94.68
3ix7_A134 Uncharacterized protein TTHA0540; unknown function 94.07
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 93.8
1lko_A191 Rubrerythrin all-iron(II) form; reduced form, DIIR 93.18
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 93.16
4rxn_A54 Rubredoxin; electron transfer(iron-sulfur protein) 92.44
1e8j_A52 Rubredoxin; iron-sulfur-protein, zinc-substitution 92.11
2jrp_A81 Putative cytoplasmic protein; two-zinc binding pro 91.26
2v3b_B55 Rubredoxin 2, rubredoxin; alkane degradation, iron 91.14
1yk4_A52 Rubredoxin, RD; electron transport; 0.69A {Pyrococ 90.94
1s24_A87 Rubredoxin 2; electron transport; NMR {Pseudomonas 90.49
3cng_A 189 Nudix hydrolase; structural genomics, APC7497, PSI 90.31
2kn9_A81 Rubredoxin; metalloprotein, ssgcid, structural gen 90.31
1dx8_A70 Rubredoxin; electron transport, zinc-substitution; 89.76
3h0g_L63 DNA-directed RNA polymerases I, II, and III subuni 89.47
1vk6_A269 NADH pyrophosphatase; 1790429, structural genomics 88.73
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 87.59
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 87.02
3j20_Y50 30S ribosomal protein S27AE; archaea, archaeal, KI 86.5
3p8b_A81 DNA-directed RNA polymerase, subunit E''; transcri 86.38
3j21_g51 50S ribosomal protein L40E; archaea, archaeal, KIN 85.6
1ryq_A69 DNA-directed RNA polymerase, subunit E''; structur 84.45
1m2k_A249 Silent information regulator 2; protein-ligand com 83.94
2k4x_A55 30S ribosomal protein S27AE; metal-binding, ribonu 82.07
2jne_A101 Hypothetical protein YFGJ; zinc fingers, two zinc, 81.66
1yc5_A246 NAD-dependent deacetylase; SIR2, sirtuin, SIR2TM, 80.05
>2con_A RUH-035 protein, NIN one binding protein; ribosome, RNA binding protein, unknown function, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.41.15.1 Back     alignment and structure
Probab=99.97  E-value=1.8e-32  Score=189.11  Aligned_cols=72  Identities=35%  Similarity=0.804  Sum_probs=67.9

Q ss_pred             cCCCCcceeeeeEEEEccCccccccccCccccCCCCCCCceeEEEEEeCCCceEEeec--CCc-cccCceeecCCC
Q 032998           57 APGGMQIRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGENGIVLASR--RPR-ITLRGTKVSISL  129 (129)
Q Consensus        57 s~~g~~I~~~k~W~~rC~~C~k~~~~~~~~fCp~CG~~~tL~rv~v~v~~~G~~~~~~--~~~-~n~RG~~ySlP~  129 (129)
                      +++|++|+++|+|+|||+|||+++.+|++.|||+||++ ||+||+++||+||++++|.  +++ ||+||++||||+
T Consensus         2 s~~G~~Ir~~k~~iLrC~aCf~~t~~~~k~FCp~CGn~-TL~Rvsvsvd~~G~~~~hl~~n~~~~n~RG~~ySlPk   76 (79)
T 2con_A            2 SSGSSGVREARSYILRCHGCFKTTSDMNRVFCGHCGNK-TLKKVSVTINDDGTLHMHFSRNPKVLNPRGLRYSSGP   76 (79)
T ss_dssp             CCCCCCCCCCCCEEEECSSSCCEESCSSCCSCSSSCCS-CCEEEECBCCSSCCCBCCCCCCCCCCCCCCCCCCCCC
T ss_pred             CCCceEeeeeeeeeeEecccceECCCcccccccccCcc-cceEEEEEECCCCcEEEeccCCccccccCCCCccCCC
Confidence            67999999999999999999999999999999999998 9999999999999987664  578 999999999996
>2lcq_A Putative toxin VAPC6; PIN domain, Zn ribbon domain, ribosome biogenesis, metal BIN protein; NMR {Pyrococcus horikoshii} Back     alignment and structure
>3irb_A Uncharacterized protein from DUF35 family; 13815350, protein with unknown function from DUF35 family, S genomics; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>2gnr_A Conserved hypothetical protein; 13815350, structural genomics, PSI, protein structure initiative; 1.80A {Sulfolobus solfataricus P2} PDB: 3irb_A Back     alignment and structure
>2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori} Back     alignment and structure
>3i8o_A KH domain-containing protein MJ1533; APC89320.5, methanocaldococcus jannaschii DSM 2661, structural genomics, PSI-2; 2.64A {Methanocaldococcus jannaschii} Back     alignment and structure
>2apo_B Ribosome biogenesis protein NOP10; protein-protein complex, box H/ACA, snoRNP, pseudouridine synthase, RNA modification; 1.95A {Methanocaldococcus jannaschii} SCOP: g.41.16.1 PDB: 2aqc_A Back     alignment and structure
>3a43_A HYPD, hydrogenase nickel incorporation protein HYPA; [NIFE] hydrogenase maturation, zinc-finger, nickel binding, metal-binding; HET: FME; 2.30A {Pyrococcus kodakaraensis} PDB: 3a44_A* Back     alignment and structure
>3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>2aus_D NOP10, ribosome biogenesis protein NOP10; isomerase, structural protein, isomerase-structural protein; 2.10A {Pyrococcus abyssi} PDB: 3lwr_B 3lwo_B* 3lwq_B* 3lwp_B 3lwv_B 3hax_C* 2hvy_C* 3hay_C* 2ey4_E 3hjw_B* 2rfk_B* 3hjy_B 3mqk_B Back     alignment and structure
>1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... Back     alignment and structure
>3ix7_A Uncharacterized protein TTHA0540; unknown function, thermus thermophilus HB8, structural genom 2, protein structure initiative; HET: MSE; 2.15A {Thermus thermophilus} Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure
>1lko_A Rubrerythrin all-iron(II) form; reduced form, DIIRON, four-helix bundle, rubre like, electron transport; 1.63A {Desulfovibrio vulgaris} SCOP: a.25.1.1 g.41.5.1 PDB: 1dvb_A 1jyb_A 1b71_A 1lkm_A 1lkp_A 1qyb_A 1s2z_A 1s30_A 1ryt_A Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure
>4rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.20A {Clostridium pasteurianum} SCOP: g.41.5.1 PDB: 5rxn_A 1bfy_A 1fhh_A 1fhm_A 1irn_A 1iro_A 1r0f_A 1r0g_A 1r0h_A 1r0i_A 1r0j_A 1t9q_A 1c09_A 1b2j_A 1b13_A 1smm_A 1smu_A 1smw_A 1be7_A 1t9o_A ... Back     alignment and structure
>1e8j_A Rubredoxin; iron-sulfur-protein, zinc-substitution, thermostability; NMR {Desulfovibrio gigas} SCOP: g.41.5.1 PDB: 1rdg_A 2dsx_A 1spw_A Back     alignment and structure
>2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>2v3b_B Rubredoxin 2, rubredoxin; alkane degradation, iron-sulfur protein, oxidoreductase, ELE transfer, electron transport, FAD, NAD, iron; HET: FAD; 2.45A {Pseudomonas aeruginosa} Back     alignment and structure
>1yk4_A Rubredoxin, RD; electron transport; 0.69A {Pyrococcus abyssi} PDB: 2pya_A 1yk5_A 1bq8_A 1bq9_A* 3kyu_A 3kyv_A 3kyw_A 3kyx_A 3kyy_A 3ryg_A 3rz6_A 3rzt_A 3ss2_A 1brf_A 1caa_A 1cad_A 1vcx_A 1zrp_A 1iu5_A 1iu6_A ... Back     alignment and structure
>1s24_A Rubredoxin 2; electron transport; NMR {Pseudomonas oleovorans} SCOP: g.41.5.1 Back     alignment and structure
>3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} Back     alignment and structure
>2kn9_A Rubredoxin; metalloprotein, ssgcid, structural genomics, seattle structural genomics center for infectious electron transport, iron; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>1dx8_A Rubredoxin; electron transport, zinc-substitution; NMR {Guillardia theta} SCOP: g.41.5.1 PDB: 1h7v_A Back     alignment and structure
>3h0g_L DNA-directed RNA polymerases I, II, and III subunit rpabc4; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3j20_Y 30S ribosomal protein S27AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>3p8b_A DNA-directed RNA polymerase, subunit E''; transcription elongation factor, RNA polymerase, transferase transcription complex; 1.80A {Pyrococcus furiosus} Back     alignment and structure
>3j21_g 50S ribosomal protein L40E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>1ryq_A DNA-directed RNA polymerase, subunit E''; structural genomics, zinc, PSI, protein structure initiative; 1.38A {Pyrococcus furiosus} SCOP: g.41.9.3 PDB: 3qqc_E Back     alignment and structure
>1m2k_A Silent information regulator 2; protein-ligand complex, gene regulation; HET: APR; 1.47A {Archaeoglobus fulgidus} SCOP: c.31.1.5 PDB: 1m2g_A* 1m2h_A* 1m2j_A* 1m2n_A* 1ici_A* Back     alignment and structure
>2k4x_A 30S ribosomal protein S27AE; metal-binding, ribonucleoprotein, zinc, zinc-finger, structural genomics, PSI-2; NMR {Thermoplasma acidophilum} SCOP: g.41.8.8 Back     alignment and structure
>2jne_A Hypothetical protein YFGJ; zinc fingers, two zinc, structural genomics, PSI-2, protein structure initiative; NMR {Escherichia coli} SCOP: g.41.18.1 Back     alignment and structure
>1yc5_A NAD-dependent deacetylase; SIR2, sirtuin, SIR2TM, SIRT1, nicotinamide, hydrolase; HET: ALY; 1.40A {Thermotoga maritima} SCOP: c.31.1.5 PDB: 2h2d_A* 2h2f_A 2h2g_A* 2h2h_A* 2h2i_A* 2h4f_A* 2h4j_A* 3d4b_A* 3d81_A* 3pdh_A* 2h4h_A* 3jr3_A* 2h59_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 129
d2cona166 g.41.15.1 (A:8-73) RNA-binding protein NOB1 (Nin o 3e-25
>d2cona1 g.41.15.1 (A:8-73) RNA-binding protein NOB1 (Nin one binding) {Mouse (Mus musculus) [TaxId: 10090]} Length = 66 Back     information, alignment and structure

class: Small proteins
fold: Rubredoxin-like
superfamily: NOB1 zinc finger-like
family: NOB1 zinc finger-like
domain: RNA-binding protein NOB1 (Nin one binding)
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 88.6 bits (220), Expect = 3e-25
 Identities = 23/67 (34%), Positives = 41/67 (61%), Gaps = 4/67 (5%)

Query: 63  IRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGENG---IVLASRRPRIT 119
           +R+   +IL+CH C+  T+++ R+FC  CGN  TL+KV+VT+ ++G   +  +     + 
Sbjct: 1   VREARSYILRCHGCFKTTSDMNRVFCGHCGN-KTLKKVSVTINDDGTLHMHFSRNPKVLN 59

Query: 120 LRGTKVS 126
            RG + S
Sbjct: 60  PRGLRYS 66

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query129
d2cona166 RNA-binding protein NOB1 (Nin one binding) {Mouse 99.95
d2gnra1137 Hypothetical protein SSO2064 {Sulfolobus solfatari 96.55
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 96.01
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 95.56
d2apob155 Ribosome biogenesis protein Nop10 {Archaeon Methan 95.46
d2ey4e152 Ribosome biogenesis protein Nop10 {Archaeon Pyroco 95.4
d2ak3a237 Microbial and mitochondrial ADK, insert "zinc fing 94.01
d1lkoa244 Rubrerythrin, C-terminal domain {Desulfovibrio vul 93.87
d1e4va235 Microbial and mitochondrial ADK, insert "zinc fing 93.06
d1zina235 Microbial and mitochondrial ADK, insert "zinc fing 92.63
d1akya238 Microbial and mitochondrial ADK, insert "zinc fing 91.5
d6rxna_45 Rubredoxin {Desulfovibrio desulfuricans, strain 27 91.39
d1s24a_56 Two-iron rubredoxin {Pseudomonas oleovorans [TaxId 91.38
d1s3ga235 Microbial and mitochondrial ADK, insert "zinc fing 91.09
d2dsxa152 Rubredoxin {Desulfovibrio gigas [TaxId: 879]} 90.99
d1iroa_53 Rubredoxin {Clostridium pasteurianum [TaxId: 1501] 88.59
d1brfa_53 Rubredoxin {Archaeon Pyrococcus furiosus [TaxId: 2 88.04
d2jnea171 Hypothetical protein YfgJ {Escherichia coli [TaxId 86.96
d2dkta174 RING finger and CHY zinc finger domain-containing 86.37
d1neea237 Zinc-binding domain of translation initiation fact 83.17
d1ryqa_67 putative DNA-directed RNA polymerase subunit E'' ( 83.16
d1k81a_36 Zinc-binding domain of translation initiation fact 82.6
d1vqo1156 Ribosomal protein L37e {Archaeon Haloarcula marism 82.46
d1dx8a_70 Rubredoxin {Guillardia theta [TaxId: 55529]} 81.68
d2gmga1105 Hypothetical protein PF0610 {Pyrococcus furiosus [ 81.26
>d2cona1 g.41.15.1 (A:8-73) RNA-binding protein NOB1 (Nin one binding) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: Rubredoxin-like
superfamily: NOB1 zinc finger-like
family: NOB1 zinc finger-like
domain: RNA-binding protein NOB1 (Nin one binding)
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.95  E-value=6.2e-29  Score=164.77  Aligned_cols=63  Identities=38%  Similarity=0.903  Sum_probs=58.2

Q ss_pred             ceeeeeEEEEccCccccccccCccccCCCCCCCceeEEEEEeCCCceEEeecC--Cc-cccCceeec
Q 032998           63 IRQLHRWILKCHACYTITAEIGRIFCPKCGNGGTLRKVAVTVGENGIVLASRR--PR-ITLRGTKVS  126 (129)
Q Consensus        63 I~~~k~W~~rC~~C~k~~~~~~~~fCp~CG~~~tL~rv~v~v~~~G~~~~~~~--~~-~n~RG~~yS  126 (129)
                      |+++|+|++||+|||+++.+|++.|||+||++ ||+||+|+||+||++++|.+  ++ ||+||++||
T Consensus         1 Ir~vr~~~LrC~aCf~~t~~~~k~FCpkCGn~-TL~rvsvsvd~~G~~~~h~~~~~k~~n~RG~~yS   66 (66)
T d2cona1           1 VREARSYILRCHGCFKTTSDMNRVFCGHCGNK-TLKKVSVTINDDGTLHMHFSRNPKVLNPRGLRYS   66 (66)
T ss_dssp             CCCCCCEEEECSSSCCEESCSSCCSCSSSCCS-CCEEEECBCCSSCCCBCCCCCCCCCCCCCCCCCC
T ss_pred             ChhhheeeeEeeecCcCcCCcccccCcccCCC-ceeEEEEEECCCCcEEEEecCCCceecCCccCCc
Confidence            68899999999999999999999999999998 99999999999999877653  34 899999998
>d2gnra1 b.40.4.15 (A:8-144) Hypothetical protein SSO2064 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2apob1 g.41.16.1 (B:403-457) Ribosome biogenesis protein Nop10 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2ey4e1 g.41.16.1 (E:4-55) Ribosome biogenesis protein Nop10 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1lkoa2 g.41.5.1 (A:148-191) Rubrerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1e4va2 g.41.2.1 (A:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1akya2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d6rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]} Back     information, alignment and structure
>d1s24a_ g.41.5.1 (A:) Two-iron rubredoxin {Pseudomonas oleovorans [TaxId: 301]} Back     information, alignment and structure
>d1s3ga2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2dsxa1 g.41.5.1 (A:1-52) Rubredoxin {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1iroa_ g.41.5.1 (A:) Rubredoxin {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1brfa_ g.41.5.1 (A:) Rubredoxin {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dkta1 g.89.1.1 (A:8-81) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1neea2 g.59.1.1 (A:99-135) Zinc-binding domain of translation initiation factor 2 beta {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ryqa_ g.41.9.3 (A:) putative DNA-directed RNA polymerase subunit E'' (RpoE2) {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1k81a_ g.59.1.1 (A:) Zinc-binding domain of translation initiation factor 2 beta {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vqo11 g.41.8.2 (1:1-56) Ribosomal protein L37e {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1dx8a_ g.41.5.1 (A:) Rubredoxin {Guillardia theta [TaxId: 55529]} Back     information, alignment and structure
>d2gmga1 a.4.5.82 (A:1-105) Hypothetical protein PF0610 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure