Citrus Sinensis ID: 033301

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120--
MGNTLQTPKENLAKEEEEEEESSGSSFTCEICIEPMAASKKFKNKNLCTHPFSQDCIAKYIQVKVQDDNTAKIECPGLECRHDLDPFSCEPIVPASLFSKWCDVLCEDYVLGFERSYCPNTN
ccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccEEEEcccccccccccHHHHcccccHHHHHHHHHHHHHHHHcccccccccccc
cccccccccHHHccHHHcccccccccEEEEEEEcccccccEEEcccccccHHHHHHHHHHHEEEEccccEEEEEcccccccccccHHHHHHHccHHHHHHHHHHHHHHHccccccEEccccc
mgntlqtpkenlakeeeeeeessgssftceiciepmaaskkfknknlcthpfsqDCIAKYIQVKvqddntakiecpglecrhdldpfscepivpaslfsKWCDVLCedyvlgfersycpntn
mgntlqtpkenlakeeeeeeessgssftcEICIEPMAASKKFKNKNLCTHPFSQDCIAKYIQVKVQDDNTAKIECPGLECRHDLDPFSCEPIVPASLFSKWCDVLCEDYVLGfersycpntn
MGNTLQTPKENLAKeeeeeeessgssFTCEICIEPMAASKKFKNKNLCTHPFSQDCIAKYIQVKVQDDNTAKIECPGLECRHDLDPFSCEPIVPASLFSKWCDVLCEDYVLGFERSYCPNTN
************************************************THPFSQDCIAKYIQVKVQDDNTAKIECPGLECRHDLDPFSCEPIVPASLFSKWCDVLCEDYVLGFERSYC****
*****************************EICIEPMAASKKFKNKNLCTHPFSQDCIAKYIQVKVQDDNTAKIECPGLECRHDLDPFSCEPIVPASLFSKWCDVLCEDYVLGFERSYCPNTN
**************************FTCEICIEPMAASKKFKNKNLCTHPFSQDCIAKYIQVKVQDDNTAKIECPGLECRHDLDPFSCEPIVPASLFSKWCDVLCEDYVLGFERSYCPNTN
***********************GSSFTCEICIEPMAASKKFKNKNLCTHPFSQDCIAKYIQVKVQDDNTAKIECPGLECRHDLDPFSCEPIVPASLFSKWCDVLCEDYVLGFERSYCPNT*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNTLQTPKENLAKEEEEEEESSGSSFTCEICIEPMAASKKFKNKNLCTHPFSQDCIAKYIQVKVQDDNTAKIECPGLECRHDLDPFSCEPIVPASLFSKWCDVLCEDYVLGFERSYCPNTN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query122
255578926 255 zinc finger protein, putative [Ricinus c 0.967 0.462 0.563 4e-32
224135813 228 predicted protein [Populus trichocarpa] 0.967 0.517 0.537 3e-28
224146525 241 predicted protein [Populus trichocarpa] 0.967 0.489 0.487 2e-27
255578922213 zinc finger protein, putative [Ricinus c 0.786 0.450 0.577 2e-24
359478253212 PREDICTED: LOW QUALITY PROTEIN: probable 0.893 0.514 0.545 4e-24
224068789 237 predicted protein [Populus trichocarpa] 0.950 0.489 0.483 1e-21
255550305 264 zinc finger protein, putative [Ricinus c 0.942 0.435 0.367 3e-15
225444595 358 PREDICTED: probable E3 ubiquitin-protein 0.754 0.256 0.414 3e-15
297738503 329 unnamed protein product [Vitis vinifera] 0.754 0.279 0.414 3e-15
356522438 303 PREDICTED: probable E3 ubiquitin-protein 0.901 0.363 0.362 2e-14
>gi|255578926|ref|XP_002530316.1| zinc finger protein, putative [Ricinus communis] gi|223530172|gb|EEF32083.1| zinc finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  141 bits (356), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 84/119 (70%), Gaps = 1/119 (0%)

Query: 1   MGNTLQTPKENLAKEEEEEEESSGSSFTCEICIEPMAASKKFKNKNLCTHPFSQDCIAKY 60
           MGN LQ P+E    EE E++E   SSFTCEICIEPM ++KKF+N +LCTHPF  DCI+KY
Sbjct: 1   MGNKLQKPQETNVVEEHEQKEEVVSSFTCEICIEPMLSNKKFENASLCTHPFCLDCISKY 60

Query: 61  IQVKVQDDNTAKIECPGLECRHDLDPFSCEPIVPASLFSKWCDVLCEDYVLGFERSYCP 119
           ++VKV+      I+CPG  C+H LDP SC  I+   +F KWCD+LC+  V G ER YCP
Sbjct: 61  VEVKVE-GFIGNIKCPGTSCKHPLDPLSCRSIISKPVFDKWCDLLCDSVVSGVERCYCP 118

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224135813|ref|XP_002327310.1| predicted protein [Populus trichocarpa] gi|222835680|gb|EEE74115.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224146525|ref|XP_002326038.1| predicted protein [Populus trichocarpa] gi|222862913|gb|EEF00420.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255578922|ref|XP_002530314.1| zinc finger protein, putative [Ricinus communis] gi|223530170|gb|EEF32081.1| zinc finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359478253|ref|XP_003632093.1| PREDICTED: LOW QUALITY PROTEIN: probable E3 ubiquitin-protein ligase RNF144A-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224068789|ref|XP_002326200.1| predicted protein [Populus trichocarpa] gi|222833393|gb|EEE71870.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255550305|ref|XP_002516203.1| zinc finger protein, putative [Ricinus communis] gi|223544689|gb|EEF46205.1| zinc finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225444595|ref|XP_002277363.1| PREDICTED: probable E3 ubiquitin-protein ligase RNF144A-B-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297738503|emb|CBI27748.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356522438|ref|XP_003529853.1| PREDICTED: probable E3 ubiquitin-protein ligase RNF144A-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query122
TAIR|locus:2091030 303 AT3G14250 [Arabidopsis thalian 0.737 0.297 0.318 5.3e-17
TAIR|locus:2084116 320 AT3G53690 [Arabidopsis thalian 0.745 0.284 0.397 1.8e-16
TAIR|locus:504955785 213 AT3G45555 [Arabidopsis thalian 0.745 0.427 0.333 3.6e-09
TAIR|locus:2101074346 AT3G43750 [Arabidopsis thalian 0.745 0.263 0.301 1.4e-08
ASPGD|ASPL0000014787 511 AN3689 [Emericella nidulans (t 0.770 0.183 0.306 4.3e-07
TAIR|locus:2040065 373 AT2G25360 [Arabidopsis thalian 0.754 0.246 0.276 8.9e-07
TAIR|locus:1006230127 384 AT2G26135 [Arabidopsis thalian 0.745 0.236 0.279 9.4e-07
TAIR|locus:2133935 532 AT4G19670 [Arabidopsis thalian 0.721 0.165 0.284 9.6e-07
TAIR|locus:2085612 348 AT3G45540 [Arabidopsis thalian 0.754 0.264 0.255 1.7e-06
TAIR|locus:2085657312 AT3G45570 [Arabidopsis thalian 0.745 0.291 0.290 1.7e-06
TAIR|locus:2091030 AT3G14250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 209 (78.6 bits), Expect = 5.3e-17, P = 5.3e-17
 Identities = 29/91 (31%), Positives = 56/91 (61%)

Query:    29 CEICIEPMAASKKFKNKNLCTHPFSQDCIAKYIQVKVQDDNTAKIECPGLECRHDLDPFS 88
             C IC++   +S  F+    CTH +  DC  +Y+  K+++ N ++I+CP +EC   ++P++
Sbjct:    95 CMICMDEKPSSDIFRGTTNCTHAYCTDCTVRYVATKIKE-NASRIKCPDVECTRLIEPYT 153

Query:    89 CEPIVPASLFSKWCDVLCEDYVLGFERSYCP 119
             C  ++P  +F +W  +LCE  +  +++ YCP
Sbjct:   154 CRDLIPKDVFDRWEKILCESLISSWDKFYCP 184
GO:0008270 "zinc ion binding" evidence=IEA
TAIR|locus:2084116 AT3G53690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955785 AT3G45555 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101074 AT3G43750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000014787 AN3689 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
TAIR|locus:2040065 AT2G25360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1006230127 AT2G26135 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133935 AT4G19670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085612 AT3G45540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085657 AT3G45570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00410007
hypothetical protein (228 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 122
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 99.83
KOG1812 384 consensus Predicted E3 ubiquitin ligase [Posttrans 99.63
KOG1815 444 consensus Predicted E3 ubiquitin ligase [Posttrans 99.55
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.99
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.93
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.9
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.86
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.86
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.84
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.8
PHA02926242 zinc finger-like protein; Provisional 98.74
PF1463444 zf-RING_5: zinc-RING finger domain 98.66
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.63
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.54
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.51
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.45
PHA02929238 N1R/p28-like protein; Provisional 98.41
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.4
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.39
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.38
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.23
KOG0006 446 consensus E3 ubiquitin-protein ligase (Parkin prot 98.19
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.1
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 98.07
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 98.02
KOG1002 791 consensus Nucleotide excision repair protein RAD16 98.0
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.0
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 97.85
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.79
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 97.79
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 97.69
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 97.6
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 97.54
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.49
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 97.38
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.33
KOG2660 331 consensus Locus-specific chromosome binding protei 97.03
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.01
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 96.86
COG5152259 Uncharacterized conserved protein, contains RING a 96.78
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 96.77
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 96.75
PHA03096284 p28-like protein; Provisional 96.73
smart0064764 IBR In Between Ring fingers. the domains occurs be 96.46
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 96.44
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 96.42
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 96.35
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 96.24
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 96.2
KOG4739 233 consensus Uncharacterized protein involved in syna 96.09
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 95.82
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 95.71
PF0148564 IBR: IBR domain; InterPro: IPR002867 Zinc finger ( 95.6
PF04641260 Rtf2: Rtf2 RING-finger 95.38
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 95.34
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 95.27
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 95.26
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 95.2
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 95.07
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 94.87
KOG4445 368 consensus Uncharacterized conserved protein, conta 94.75
KOG3002 299 consensus Zn finger protein [General function pred 94.67
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 94.48
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 94.4
KOG0297 391 consensus TNF receptor-associated factor [Signal t 94.13
COG5175 480 MOT2 Transcriptional repressor [Transcription] 93.89
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 93.58
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 93.36
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 93.25
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 93.22
COG52191525 Uncharacterized conserved protein, contains RING Z 92.58
KOG3039303 consensus Uncharacterized conserved protein [Funct 92.05
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 91.93
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 91.05
KOG1941518 consensus Acetylcholine receptor-associated protei 90.55
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 90.25
KOG0825 1134 consensus PHD Zn-finger protein [General function 90.17
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 90.1
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 89.34
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 89.1
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 88.31
PF0684468 DUF1244: Protein of unknown function (DUF1244); In 88.12
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 88.11
KOG149384 consensus Anaphase-promoting complex (APC), subuni 88.0
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 87.21
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 87.01
KOG1940276 consensus Zn-finger protein [General function pred 86.86
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 86.8
KOG4367 699 consensus Predicted Zn-finger protein [Function un 86.59
KOG3053 293 consensus Uncharacterized conserved protein [Funct 85.31
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 85.31
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 83.53
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 81.95
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 81.82
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 81.56
COG5236 493 Uncharacterized conserved protein, contains RING Z 80.79
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.83  E-value=1.5e-21  Score=148.46  Aligned_cols=115  Identities=23%  Similarity=0.496  Sum_probs=105.7

Q ss_pred             CCCCCCcchHHHHHHhhCCCccccccccccccccccccccCCcCCcchHHHHHHHHHHHhhcCCCceecCCCCCCCCCCC
Q 033301            6 QTPKENLAKEEEEEEESSGSSFTCEICIEPMAASKKFKNKNLCTHPFSQDCIAKYIQVKVQDDNTAKIECPGLECRHDLD   85 (122)
Q Consensus         6 ~~~~~~~~~~~~~~~~~~~~~~~C~IC~~~~~~~~~~~~~~~C~H~fC~~C~~~~i~~~i~~~~~~~i~CP~~~C~~~i~   85 (122)
                      ++++..+..++++.+.+..+.+.|.||+++..+...| ..++|+|+||+.|++.|+...|++|....++||+.+|+...+
T Consensus       164 l~~~Il~~deea~~~~F~~slf~C~ICf~e~~G~~c~-~~lpC~Hv~Ck~C~kdY~~~~i~eg~v~~l~Cp~~~C~~~a~  242 (445)
T KOG1814|consen  164 LKKEILQFDEEATLEKFVNSLFDCCICFEEQMGQHCF-KFLPCSHVFCKSCLKDYFTIQIQEGQVSCLKCPDPKCGSVAP  242 (445)
T ss_pred             HHHHHHhhhHHHHHHHHHhhcccceeeehhhcCccee-eecccchHHHHHHHHHHHHHhhhcceeeeecCCCCCCcccCC
Confidence            3455566788888899999999999999999887777 499999999999999999999999999999999999999999


Q ss_pred             hhhcccCCCHHHHHHHHHHHHhhhh-cCCCceecCCC
Q 033301           86 PFSCEPIVPASLFSKWCDVLCEDYV-LGFERSYCPNT  121 (122)
Q Consensus        86 ~~~i~~~l~~~~~~ky~~~~~~~~i-~~~~~~~CP~~  121 (122)
                      +..++.+|+.++++||++++++..+ .+++.+|||++
T Consensus       243 ~g~vKelvg~EL~arYe~l~lqk~l~~msdv~yCPr~  279 (445)
T KOG1814|consen  243 PGQVKELVGDELFARYEKLMLQKTLELMSDVVYCPRA  279 (445)
T ss_pred             chHHHHHHHHHHHHHHHHHHHHHHHHhhcccccCChh
Confidence            9999999999999999999999999 57788999985

>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>smart00647 IBR In Between Ring fingers Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF01485 IBR: IBR domain; InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>PF06844 DUF1244: Protein of unknown function (DUF1244); InterPro: IPR009654 This family consists of several short bacterial proteins of around 100 residues in length Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query122
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 5e-11
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 Back     alignment and structure
 Score = 54.1 bits (130), Expect = 5e-11
 Identities = 17/90 (18%), Positives = 34/90 (37%), Gaps = 3/90 (3%)

Query: 23  SGSSFTCEICIEPMAASKKFKNKNLCTHPFSQDCIAKYIQVKVQDDNTAKIECPGLECRH 82
           S  S  C++C+      +       C   F   C+ +Y+++ +++     I CP   C  
Sbjct: 2   SSGSSGCKLCLGEYPVEQMTTIAQ-CQCIFCTLCLKQYVELLIKEGLETAISCPDAACPK 60

Query: 83  D--LDPFSCEPIVPASLFSKWCDVLCEDYV 110
              L     E +V A +  ++  +  E   
Sbjct: 61  QGHLQENEIECMVAAEIMQRYKKLQFERSG 90

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query122
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 99.89
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.21
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.14
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.11
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.06
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.06
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.06
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.06
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.04
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.04
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.03
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.02
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.02
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.01
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.98
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.97
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.94
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.93
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.93
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.92
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.92
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.91
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.91
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.9
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.89
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.89
2ect_A78 Ring finger protein 126; metal binding protein, st 98.87
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.85
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.85
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.83
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.83
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.83
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.81
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.78
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.78
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.77
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.77
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.77
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.75
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.75
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.73
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.73
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.7
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.69
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.68
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.67
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.64
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.63
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.63
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.61
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.58
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.54
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.51
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.43
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.42
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.42
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.37
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.37
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.24
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.22
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.18
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.15
2ea5_A68 Cell growth regulator with ring finger domain prot 98.11
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.1
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 97.81
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 97.75
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 97.68
2jmo_A80 Parkin; IBR, E3 ligase, zinc binding domain, RBR; 97.53
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 97.52
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.47
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 96.59
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 96.48
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 95.94
3nw0_A238 Non-structural maintenance of chromosomes element 94.76
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 94.76
2ct7_A86 Ring finger protein 31; IBR, structural genomics, 91.27
2d8v_A67 Zinc finger FYVE domain-containing protein 19; zfy 89.92
2o35_A105 Hypothetical protein DUF1244; helix bundle, struct 84.85
3fyb_A104 Protein of unknown function (DUF1244); hydrocar de 83.12
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 80.59
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
Probab=99.89  E-value=8.8e-24  Score=132.87  Aligned_cols=89  Identities=18%  Similarity=0.418  Sum_probs=79.2

Q ss_pred             CCccccccccccccccccccccCCcCCcchHHHHHHHHHHHhhcCCCceecCCCCCCCCC--CChhhcccCCCHHHHHHH
Q 033301           24 GSSFTCEICIEPMAASKKFKNKNLCTHPFSQDCIAKYIQVKVQDDNTAKIECPGLECRHD--LDPFSCEPIVPASLFSKW  101 (122)
Q Consensus        24 ~~~~~C~IC~~~~~~~~~~~~~~~C~H~fC~~C~~~~i~~~i~~~~~~~i~CP~~~C~~~--i~~~~i~~~l~~~~~~ky  101 (122)
                      ...++|+||++++..+..+ .+.+|||.||++||..|+..+|.+|...+++||.++|+..  ++++.++.+|+++++++|
T Consensus         3 ~~~~~C~IC~~~~~~~~~~-~l~~CgH~FC~~Cl~~~~~~~i~~g~~~~i~CP~~~C~~~~~~~~~~i~~ll~~~~~~ky   81 (94)
T 1wim_A            3 SGSSGCKLCLGEYPVEQMT-TIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRY   81 (94)
T ss_dssp             CSBCCCSSSCCCCBGGGEE-EETTTTEEEEHHHHHHHHHHHHHHCSCCCEECSCTTCSSCCEECHHHHHHHSCHHHHHHH
T ss_pred             CCCcCCcccCcccccccce-EcCCCCCcccHHHHHHHHHHHhhcCCcccccCccccCCCCCccCHHHHHHHCCHHHHHHH
Confidence            4578999999999877655 2457999999999999999999987667999999999999  999999999999999999


Q ss_pred             HHHHHhhhhcCC
Q 033301          102 CDVLCEDYVLGF  113 (122)
Q Consensus       102 ~~~~~~~~i~~~  113 (122)
                      ++++++.++..+
T Consensus        82 ~~~~~~~~v~~~   93 (94)
T 1wim_A           82 KKLQFERSGPSS   93 (94)
T ss_dssp             HHHHHHSSCSSC
T ss_pred             HHHHHHhhhccC
Confidence            999999998543
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 Back     alignment and structure
>2d8v_A Zinc finger FYVE domain-containing protein 19; zfyve19, ZF- B_BOX, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.43.1.1 Back     alignment and structure
>2o35_A Hypothetical protein DUF1244; helix bundle, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.12A {Sinorhizobium meliloti} SCOP: a.293.1.1 Back     alignment and structure
>3fyb_A Protein of unknown function (DUF1244); hydrocar degrading, structural genomics, PSI-2; HET: PEG; 1.80A {Alcanivorax borkumensis SK2} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 122
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 1e-07
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: UbcM4-interacting protein 4 (KIAA0161)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 44.3 bits (104), Expect = 1e-07
 Identities = 17/90 (18%), Positives = 34/90 (37%), Gaps = 3/90 (3%)

Query: 23  SGSSFTCEICIEPMAASKKFKNKNLCTHPFSQDCIAKYIQVKVQDDNTAKIECPGLECRH 82
           S  S  C++C+      +       C   F   C+ +Y+++ +++     I CP   C  
Sbjct: 2   SSGSSGCKLCLGEYPVEQMTTIAQ-CQCIFCTLCLKQYVELLIKEGLETAISCPDAACPK 60

Query: 83  D--LDPFSCEPIVPASLFSKWCDVLCEDYV 110
              L     E +V A +  ++  +  E   
Sbjct: 61  QGHLQENEIECMVAAEIMQRYKKLQFERSG 90

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query122
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 99.89
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.14
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.11
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.02
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.98
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.97
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.92
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.9
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.85
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.84
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.77
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.77
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.77
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.75
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.22
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.02
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.0
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 95.81
d2o35a179 Hypothetical protein SMc04008 {Rhizobium meliloti 86.83
d1z60a159 TFIIH p44 subunit cysteine-rich domain {Human (Hom 84.21
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: UbcM4-interacting protein 4 (KIAA0161)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.89  E-value=1e-23  Score=131.10  Aligned_cols=88  Identities=18%  Similarity=0.431  Sum_probs=78.3

Q ss_pred             CCccccccccccccccccccccCCcCCcchHHHHHHHHHHHhhcCCCceecCCCCCCCC--CCChhhcccCCCHHHHHHH
Q 033301           24 GSSFTCEICIEPMAASKKFKNKNLCTHPFSQDCIAKYIQVKVQDDNTAKIECPGLECRH--DLDPFSCEPIVPASLFSKW  101 (122)
Q Consensus        24 ~~~~~C~IC~~~~~~~~~~~~~~~C~H~fC~~C~~~~i~~~i~~~~~~~i~CP~~~C~~--~i~~~~i~~~l~~~~~~ky  101 (122)
                      +....|+||+++++..+.+ .+++|+|.||.+||+.|+..+|++|...+|+||..+|+.  .+++.+|+.+|++++++||
T Consensus         3 ~~~~~C~IC~~~~~~~~~~-~~~~C~H~fC~~Cl~~~~~~~i~~~~~~~i~CP~~~C~~~~~~~~~~i~~ll~~~~~~ky   81 (94)
T d1wima_           3 SGSSGCKLCLGEYPVEQMT-TIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRY   81 (94)
T ss_dssp             CSBCCCSSSCCCCBGGGEE-EETTTTEEEEHHHHHHHHHHHHHHCSCCCEECSCTTCSSCCEECHHHHHHHSCHHHHHHH
T ss_pred             CCCCcCccCCCcccCCceE-EECCCCCEeCCcCHHHHHHHHHhcCCccccCCcCCCCCCCcccCHHHHHHhCCHHHHHHH
Confidence            5667999999999877766 478999999999999999999998888899999988975  5788999999999999999


Q ss_pred             HHHHHhhhhcC
Q 033301          102 CDVLCEDYVLG  112 (122)
Q Consensus       102 ~~~~~~~~i~~  112 (122)
                      ++++++.+++.
T Consensus        82 ~~~~l~~~~~s   92 (94)
T d1wima_          82 KKLQFERSGPS   92 (94)
T ss_dssp             HHHHHHSSCSS
T ss_pred             HHHHHHhcccc
Confidence            99999988744
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o35a1 a.293.1.1 (A:2-80) Hypothetical protein SMc04008 {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure