Citrus Sinensis ID: 033463

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12

MIDKFVVSKGTTNTIKKCQLLQISWILCHLVYYFTGLSKLKSLGLAGIKLNRSILSSLTVFSSLRELHLRDTGFKGTFDVREFDSFNNLEVLDLSWNEIDNLVVPQGKQLKCYLITLF

cccccEEEcccccccccccccccccccccccccccccccccEEEcccccccccccHHHHHcccccccccccccccEEccHHHHcccccccEEEccccccccccccccHHHHHHHHHcc

cccEEEEEccccccEEEEEHHHHHHHHHHHHHHHccHHHccEEEcccccccccHHHHHcHHHHHHHEEEccccccccccHHHHHHcccccEEEcccccccccEEccHHHHHHHHHHcc

MIDKFVVskgttntikKCQLLQISWILCHLVYYFTGLSKLKSLGLAGIKLNRSILSSLTVFSSLrelhlrdtgfkgtfdvrefdsfnnlevldlswneidnlvvpqgkqlkcYLITLF

midkfvvskgttntikkcQLLQISWILCHLVYYFTGLSKLKSLGLAGIKLNRSILSSLTVFSSLRELHLRDTGFKGTFDVREFDSFNNLEVLDLSWNEIdnlvvpqgkqlkcylitlf

MIDKFVVSKGTTNTIKKCQLLQISWILCHLVYYFTglsklkslglagiklNRSILSSLTVFSSLRELHLRDTGFKGTFDVREFDSFNNLEVLDLSWNEIDNLVVPQGKQLKCYLITLF

****FVVSKGTTNTIKKCQLLQISWILCHLVYYFTGLSKLKSLGLAGIKLNRSILSSLTVFSSLRELHLRDTGFKGTFDVREFDSFNNLEVLDLSWNEIDNLVVPQGKQLKCYLITL*

*IDKFVVSKGTTNTIKKCQLLQISWILCHLVYYFTGLSKLKSLGLAGIKLNRSILSSLTVFSSLRELHLRDTGFKGTFDVREFDSFNNLEVLDLSWNEIDNLVVPQGKQLKCYLITLF

MIDKFVVSKGTTNTIKKCQLLQISWILCHLVYYFTGLSKLKSLGLAGIKLNRSILSSLTVFSSLRELHLRDTGFKGTFDVREFDSFNNLEVLDLSWNEIDNLVVPQGKQLKCYLITLF

iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MIDKFVVSKGTTNTIKKCQLLQISWILCHLVYYFTGLSKLKSLGLAGIKLNRSILSSLTVFSSLRELHLRDTGFKGTFDVREFDSFNNLEVLDLSWNEIDNLVVPQGKQLKCYLITLF

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		118	2.2.26 [Sep-21-2011]
Q3E991		659	Probable inactive leucine	yes	no	0.610	0.109	0.445	1e-06
C0LGQ4		678	Probable LRR receptor-lik	no	no	0.618	0.107	0.346	0.0003

>sp\|Q3E991\|Y5269_ARATH Probable inactive leucine-rich repeat receptor-like protein kinase At5g20690 OS=Arabidopsis thaliana GN=At5g20690 PE=2 SV=4	Back alignment and function desciption

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 41/74 (55%), Gaps = 2/74 (2%)

Query: 33  YFTGLSKLKSLGLAGIKLNRSILSSLTVFSSLRELHLRDTGFKGTFDVREFDSFNNLEVL 92
           +F  +SKLK L L   K   SI SS+T    L ELH++     G     EF S  NL+VL
Sbjct: 139 FFKDMSKLKRLFLDHNKFEGSIPSSITQLPQLEELHMQSNNLTGEIPP-EFGSMKNLKVL 197

Query: 93  DLSWNEIDNLVVPQ 106
           DLS N +D  +VPQ
Sbjct: 198 DLSTNSLDG-IVPQ 210

Arabidopsis thaliana (taxid: 3702)

>sp\|C0LGQ4\|MRH1_ARATH Probable LRR receptor-like serine/threonine-protein kinase MRH1 OS=Arabidopsis thaliana GN=MRH1 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		118
297745116		139	unnamed protein product [Vitis vinifera]	0.703	0.597	0.393	3e-08
224142513		290	predicted protein [Populus trichocarpa]	0.601	0.244	0.492	4e-08
359482757		1027	PREDICTED: LRR receptor-like serine/thre	0.627	0.072	0.415	6e-07
359483099		1231	PREDICTED: probable LRR receptor-like se	0.627	0.060	0.415	6e-07
359483163		1047	PREDICTED: LRR receptor-like serine/thre	0.516	0.058	0.491	2e-06
359482745		1026	PREDICTED: leucine-rich repeat receptor	0.618	0.071	0.407	1e-05
297743520		450	unnamed protein product [Vitis vinifera]	0.618	0.162	0.407	1e-05
255587333		477	serine-threonine protein kinase, plant-t	0.635	0.157	0.423	1e-05
359482725		1144	PREDICTED: leucine-rich repeat receptor	0.618	0.063	0.407	2e-05
359482731		918	PREDICTED: probable LRR receptor-like se	0.627	0.080	0.402	2e-05

>gi\|297745116\|emb\|CBI38955.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 55/89 (61%), Gaps = 6/89 (6%)

Query: 30  LVYYFTG------LSKLKSLGLAGIKLNRSILSSLTVFSSLRELHLRDTGFKGTFDVREF 83
           ++ YFTG      L KL+ L ++G + ++S L SL   SSL+ L L   G+ G+F ++E 
Sbjct: 51  ILLYFTGFKGLSSLKKLEILDISGNEFDKSDLKSLGAISSLKTLALCSMGWDGSFPIQEL 110

Query: 84  DSFNNLEVLDLSWNEIDNLVVPQGKQLKC 112
            S  NL+VLDLS+N++++  + QG  L C
Sbjct: 111 ASLRNLKVLDLSYNDLESFQLVQGTSLTC 139

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224142513\|ref\|XP_002324601.1\| predicted protein [Populus trichocarpa] gi\|222866035\|gb\|EEF03166.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|359482757\|ref\|XP_002268914.2\| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359483099\|ref\|XP_002262931.2\| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359483163\|ref\|XP_002263908.2\| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359482745\|ref\|XP_003632825.1\| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|297743520\|emb\|CBI36387.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255587333\|ref\|XP_002534233.1\| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi\|223525672\|gb\|EEF28156.1\| serine-threonine protein kinase, plant-type, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|359482725\|ref\|XP_003632817.1\| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359482731\|ref\|XP_003632819.1\| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180-like [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		118
TAIR\|locus:2180409		659	PRK6 "pollen receptor like kin	0.440	0.078	0.462	0.00018

TAIR\|locus:2180409 PRK6 "pollen receptor like kinase 6" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 102 (41.0 bits), Expect = 0.00018, P = 0.00018
 Identities = 25/54 (46%), Positives = 31/54 (57%)

Query:    53 SILSSLTVFSSLRELHLRDTGFKGTFDVREFDSFNNLEVLDLSWNEIDNLVVPQ 106
             SI SS+T    L ELH++     G     EF S  NL+VLDLS N +D  +VPQ
Sbjct:   159 SIPSSITQLPQLEELHMQSNNLTGEIPP-EFGSMKNLKVLDLSTNSLDG-IVPQ 210


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.327   0.140   0.428    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      118       103   0.00091  102 3  11 22  0.49    29
                                                     29  0.49    31


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  532 (57 KB)
  Total size of DFA:  120 KB (2079 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  10.83u 0.11s 10.94t   Elapsed:  00:00:00
  Total cpu time:  10.83u 0.11s 10.94t   Elapsed:  00:00:00
  Start:  Thu May  9 14:15:20 2013   End:  Thu May  9 14:15:20 2013

GO:0004672 "protein kinase activity" evidence=IEA

GO:0004674 "protein serine/threonine kinase activity" evidence=ISS

GO:0005524 "ATP binding" evidence=IEA;ISS

GO:0006468 "protein phosphorylation" evidence=IEA;ISS

GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS

GO:0009507 "chloroplast" evidence=ISM

GO:0016301 "kinase activity" evidence=ISS

GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	fgenesh4_pg.C_LG_XVIII001033	hypothetical protein (290 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
	gw1.4097.1.1	hypothetical protein (226 aa)	•	0.461
	eugene3.00110941	hypothetical protein (581 aa)	•	0.432
	gw1.V.3546.1	hypothetical protein (531 aa)	•	0.400

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		118
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.34
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.3
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	99.2
PLN03150		623	hypothetical protein; Provisional	99.15
PLN03150		623	hypothetical protein; Provisional	99.14
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.97
KOG0617		264	consensus Ras suppressor protein (contains leucine	98.93
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.88
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	98.86
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	98.83
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.71
KOG0472		565	consensus Leucine-rich repeat protein [Function un	98.69
KOG0617		264	consensus Ras suppressor protein (contains leucine	98.69
KOG0472		565	consensus Leucine-rich repeat protein [Function un	98.59
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	98.53
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	98.48
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	98.45
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	98.38
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	98.37
KOG4237		498	consensus Extracellular matrix protein slit, conta	98.36
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	98.29
PLN03210		1153	Resistant to P. syringae 6; Provisional	98.27
KOG4237		498	consensus Extracellular matrix protein slit, conta	98.18
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.15
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	98.06
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	98.05
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.03
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	97.99
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.98
PLN03210		1153	Resistant to P. syringae 6; Provisional	97.96
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	97.94
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	97.93
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	97.89
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	97.88
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	97.76
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	97.75
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	97.67
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.64
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	97.56
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	97.53
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.46
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	97.41
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	97.4
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.4
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	97.24
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	97.14
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.06
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	97.02
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	96.81
KOG2123		388	consensus Uncharacterized conserved protein [Funct	96.79
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	96.78
KOG2982		418	consensus Uncharacterized conserved protein [Funct	96.51
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	96.4
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	96.35
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	96.3
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	95.87
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	95.66
KOG2982		418	consensus Uncharacterized conserved protein [Funct	95.37
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	95.26
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	95.09
smart00370		26	LRR Leucine-rich repeats, outliers.	95.05
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	95.05
KOG2123		388	consensus Uncharacterized conserved protein [Funct	95.04
PRK15386		426	type III secretion protein GogB; Provisional	94.9
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	94.43
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	92.45
smart00365		26	LRR_SD22 Leucine-rich repeat, SDS22-like subfamily	91.31
smart00364		26	LRR_BAC Leucine-rich repeats, bacterial type.	90.59
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	89.83
PF13516		24	LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI	89.81
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	89.75
PRK15386		426	type III secretion protein GogB; Provisional	89.48
smart00368		28	LRR_RI Leucine rich repeat, ribonuclease inhibitor	88.73
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	88.33
KOG3864		221	consensus Uncharacterized conserved protein [Funct	87.21
KOG3763		585	consensus mRNA export factor TAP/MEX67 [RNA proces	85.73
KOG1947		482	consensus Leucine rich repeat proteins, some prote	83.81
KOG0473		326	consensus Leucine-rich repeat protein [Function un	82.63
KOG3864		221	consensus Uncharacterized conserved protein [Funct	82.6

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

Probab=99.34  E-value=3.6e-12  Score=98.08  Aligned_cols=102  Identities=17%  Similarity=0.194  Sum_probs=80.0

Q ss_pred             CceeecCCCccccccCccccEEEeccC-----chhhccCCCCCCEEecCCCcCCccccccccCCCCCcEEecCCCCCCCC
Q 033463            3 DKFVVSKGTTNTIKKCQLLQISWILCH-----LVYYFTGLSKLKSLGLAGIKLNRSILSSLTVFSSLRELHLRDTGFKGT   77 (118)
Q Consensus         3 ~~~~~~~~~p~~~~~l~~L~~L~l~~~-----~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~l~ls~n~l~~~   77 (118)
                      +.+.+++..|..+..+++|+.|+++++     .|+.+..+++|+.|++++|.+++..|..+..+++|+.|++++|.+.+.
T Consensus       483 s~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~  562 (968)
T PLN00113        483 SRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGE  562 (968)
T ss_pred             cCCccCCccChhhhhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCccccc
Confidence            344555667777888888888888744     366777888888888888888888888888888888888888888877


Q ss_pred             CChhhhcCCCCCCEEEcCCCCCCCCCcC
Q 033463           78 FDVREFDSFNNLEVLDLSWNEIDNLVVP  105 (118)
Q Consensus        78 ~~~~~~~~l~~L~~l~ls~N~l~~~~~~  105 (118)
                      .|. .+.++++|+.+++++|++++..|.
T Consensus       563 ~p~-~l~~l~~L~~l~ls~N~l~~~~p~  589 (968)
T PLN00113        563 IPK-NLGNVESLVQVNISHNHLHGSLPS  589 (968)
T ss_pred             CCh-hHhcCcccCEEeccCCcceeeCCC
Confidence            776 377788888888888888876664

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily	Back alignment and domain information

>smart00364 LRR_BAC Leucine-rich repeats, bacterial type	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		118
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	1e-06
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	9e-06
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	1e-04
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-06
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	4e-06
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	5e-06
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	5e-06
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	4e-05
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	7e-04
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-06
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-05
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	5e-05
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	7e-05
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-04
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-04
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-04
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	6e-04
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	4e-06
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	8e-06
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-05
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	3e-05
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	4e-05
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	8e-04
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	5e-06
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	2e-04
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	5e-04
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	5e-06
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-05
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-05
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	8e-05
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	7e-04
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	6e-06
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	7e-06
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-05
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-05
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-05
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	8e-05
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-04
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-04
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	1e-05
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	8e-05
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-05
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-05
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-05
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	4e-05
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	5e-05
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	8e-05
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	6e-04
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	2e-05
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	2e-04
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	3e-04
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	4e-04
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	5e-04
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	2e-05
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	2e-05
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	2e-04
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	3e-05
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	3e-05
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	6e-05
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	6e-04
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	8e-05
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	9e-05
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	9e-05
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	4e-04
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	1e-04
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	3e-04
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	8e-04
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	1e-04
1o6v_A		466	Internalin A; bacterial infection, extracellular r	3e-04
1o6v_A		466	Internalin A; bacterial infection, extracellular r	7e-04
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	3e-04
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	5e-04
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	5e-04
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	7e-04
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	6e-04
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	7e-04
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	9e-04

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

 Score = 44.6 bits (106), Expect = 1e-06
 Identities = 22/69 (31%), Positives = 29/69 (42%), Gaps = 4/69 (5%)

Query: 34  FTGLSKLKSLGLAGIKLNRSILSSLTVFSSLRELHLRDTGFKGTFDVREFDSFNNLEVLD 93
           F G+ KL  + +A   +  +I   L    SL ELHL         D       NNL  L 
Sbjct: 167 FQGMKKLSYIRIADTNI-TTIPQGL--PPSLTELHLDGNKIT-KVDAASLKGLNNLAKLG 222

Query: 94  LSWNEIDNL 102
           LS+N I  +
Sbjct: 223 LSFNSISAV 231

PyMOL of 1xku

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		118
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.6
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.57
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.57
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.56
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.56
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.56
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.54
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.54
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.52
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.52
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.52
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.51
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.51
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.5
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.5
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.49
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.49
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.49
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.49
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.48
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.48
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.48
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.47
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.47
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.47
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.46
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.46
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.46
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.46
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.45
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.45
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.45
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.45
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.44
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.44
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.44
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.44
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.44
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.43
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.43
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.42
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.42
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.4
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.4
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.4
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.39
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.39
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.39
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.39
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.39
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.38
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	99.38
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.37
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.37
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.37
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.37
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.37
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.36
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.36
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.35
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.35
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.35
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.34
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.34
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.33
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.33
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.32
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.32
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.32
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.32
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.32
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.31
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.31
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.31
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.31
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.31
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.3
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.3
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.29
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.28
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.28
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.28
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.28
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.28
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.27
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	99.26
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.26
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.25
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.25
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.24
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.23
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.23
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.23
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.23
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.23
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.22
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.22
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.22
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.22
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.21
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.21
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.21
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.2
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.18
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.18
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.18
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.18
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.17
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.16
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.14
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.12
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.11
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.11
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.1
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.06
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.06
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.03
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.02
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.0
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	98.95
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	98.93
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	98.93
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	98.92
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	98.92
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	98.88
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	98.86
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	98.86
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	98.85
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	98.8
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	98.78
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	98.75
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	98.72
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	98.72
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	98.66
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	98.62
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	98.5
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	98.37
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	98.36
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	98.35
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	98.35
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.29
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	98.28
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	98.14
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	98.11
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	98.02
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	97.94
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.87
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	97.77
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	97.66
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	97.64
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	97.46
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	97.26
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	97.19
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.05
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	96.91
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	96.76
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	96.71
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	96.63
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	96.61
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	96.14
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	95.95
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	95.78
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	95.48
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	94.6

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

Probab=99.60  E-value=1.2e-14  Score=93.91  Aligned_cols=101  Identities=21%  Similarity=0.145  Sum_probs=77.9

Q ss_pred             eeecCCCccccccCccccEEEeccCc-----hhhccCCCCCCEEecCCCcCCccccccccCCCCCcEEecCCCCCCCCCC
Q 033463            5 FVVSKGTTNTIKKCQLLQISWILCHL-----VYYFTGLSKLKSLGLAGIKLNRSILSSLTVFSSLRELHLRDTGFKGTFD   79 (118)
Q Consensus         5 ~~~~~~~p~~~~~l~~L~~L~l~~~~-----~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~l~ls~n~l~~~~~   79 (118)
                      +.+.+..+..+..+++|+.|+++++.     +..+..+++|+.|++++|.++...+..+..+++|+.|++++|.+.+..+
T Consensus        42 n~i~~i~~~~~~~l~~L~~L~Ls~N~i~~~~~~~~~~l~~L~~L~Ls~N~l~~l~~~~f~~l~~L~~L~L~~N~l~~~~~  121 (220)
T 2v9t_B           42 NTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRV  121 (220)
T ss_dssp             SCCCEECTTSSTTCTTCCEEECCSSCCCEECTTTTTTCSSCCEEECCSSCCCCCCTTTTTTCTTCCEEECCSSCCCCCCT
T ss_pred             CcCCCcCHhHhhCCCCCCEEECCCCcCCCcCHHHhhCCcCCCEEECCCCcCCccCHhHccCCCCCCEEECCCCCCCEeCH
Confidence            34444455567888888888888554     5567788888889998888886655567788888999999998886655


Q ss_pred             hhhhcCCCCCCEEEcCCCCCCCCCcCC
Q 033463           80 VREFDSFNNLEVLDLSWNEIDNLVVPQ  106 (118)
Q Consensus        80 ~~~~~~l~~L~~l~ls~N~l~~~~~~~  106 (118)
                      . .|..+++|+.|++++|.+++.++..
T Consensus       122 ~-~~~~l~~L~~L~L~~N~l~~~~~~~  147 (220)
T 2v9t_B          122 D-AFQDLHNLNLLSLYDNKLQTIAKGT  147 (220)
T ss_dssp             T-TTTTCTTCCEEECCSSCCSCCCTTT
T ss_pred             H-HcCCCCCCCEEECCCCcCCEECHHH
Confidence            4 4888888999999999888887753

PyMOL of 2v9t

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		118
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	6e-04
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	0.001

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 35.7 bits (81), Expect = 6e-04
 Identities = 15/88 (17%), Positives = 32/88 (36%), Gaps = 5/88 (5%)

Query: 15  IKKCQLLQISWILCHLVYYFTGLSKLKSLGLAGIKLNRSILSSLTVFSSLRELHLRDTGF 74
           +     L+++      +   + L  L  L L    +  S +S ++  + L+ L   +   
Sbjct: 284 LTALTNLELNENQLEDISPISNLKNLTYLTLYFNNI--SDISPVSSLTKLQRLFFANNKV 341

Query: 75  KGTFDVREFDSFNNLEVLDLSWNEIDNL 102
                V    +  N+  L    N+I +L
Sbjct: 342 SD---VSSLANLTNINWLSAGHNQISDL 366

PyMOL of d2omza2

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		118
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.52
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.49
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.48
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.39
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.35
d2ifga3		156	High affinity nerve growth factor receptor, N-term	99.34
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.33
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.3
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.29
d2ifga3		156	High affinity nerve growth factor receptor, N-term	99.27
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.24
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.23
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.22
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.21
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.11
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.09
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.08
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.06
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.01
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.01
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	98.99
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	98.92
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.9
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.89
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	98.86
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.74
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	98.58
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	98.47
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	98.32
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	98.21
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	98.14
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	98.12
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	98.08
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	97.94
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	97.91
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	97.9
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	97.81
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	97.76
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	97.54
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	97.02
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	95.97
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	94.75

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Slit
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

Probab=99.52  E-value=6.1e-14  Score=87.35  Aligned_cols=86  Identities=20%  Similarity=0.127  Sum_probs=45.2

Q ss_pred             ccccEEEeccCc------hhhccCCCCCCEEecCCCcCCccccccccCCCCCcEEecCCCCCCCCCChhhhcCCCCCCEE
Q 033463           19 QLLQISWILCHL------VYYFTGLSKLKSLGLAGIKLNRSILSSLTVFSSLRELHLRDTGFKGTFDVREFDSFNNLEVL   92 (118)
Q Consensus        19 ~~L~~L~l~~~~------~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~l~ls~n~l~~~~~~~~~~~l~~L~~l   92 (118)
                      +++++|+++++.      ...|..+++|+.|++++|.+....+..+..+++|++|++++|++....+. .|.++++|+.|
T Consensus        29 ~~l~~L~Ls~N~i~~~~~~~~f~~l~~L~~L~L~~N~i~~~~~~~~~~~~~L~~L~Ls~N~l~~l~~~-~F~~l~~L~~L  107 (192)
T d1w8aa_          29 LHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNK-MFLGLHQLKTL  107 (192)
T ss_dssp             TTCSEEECCSCCCCSBCCSCSGGGCTTCCEEECCSSCCCCBCTTTTTTCTTCCEEECCSCCCCEECSS-SSTTCTTCCEE
T ss_pred             CCCCEEEeCCCCCcccccccccCCCceEeeeeccccccccccccccccccccceeeeccccccccCHH-HHhCCCccccc
Confidence            345555555332      12334455555555555555555455555555555555555555533332 35555555555


Q ss_pred             EcCCCCCCCCCcC
Q 033463           93 DLSWNEIDNLVVP  105 (118)
Q Consensus        93 ~ls~N~l~~~~~~  105 (118)
                      +|++|+++++++.
T Consensus       108 ~L~~N~l~~i~~~  120 (192)
T d1w8aa_         108 NLYDNQISCVMPG  120 (192)
T ss_dssp             ECCSSCCCEECTT
T ss_pred             ccCCccccccCHH
Confidence            5555555555544

PyMOL of d1w8aa_

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure