Citrus Sinensis ID: 033487

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIR
cccccccccHHHHHHccccccccEEEEEEEcccccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHcccccccHHHHHHcccccccccHHEEEHHHHHHHHHHHHHHHHHcc
ccccccHHHHHHEEEEccccccccHHHHHHHHHcHHHHHHHHHHHHHccccHcHccccccHHHHHHHHHHHHcHHHccccHHHHccccccccccccEEEcHHHHHHHHHHHHHHHHcc
MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVanprqfkipdwflnrqkdykdgkysQVVSNALDMKLRDDLERLKKIR
MSLVANEDFQHILRVlntnvdgkqKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANprqfkipdwflnrqkdykdgkysqvvsnaldmklrddlerlkkir
MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIR
*******DFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVV*******************
*****NEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKI*
MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIR
*SLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query118 2.2.26 [Sep-21-2011]
P34788152 40S ribosomal protein S18 yes no 1.0 0.776 0.966 2e-62
Q8ISP0152 40S ribosomal protein S18 N/A no 1.0 0.776 0.745 4e-49
Q8IT98152 40S ribosomal protein S18 N/A no 1.0 0.776 0.728 2e-48
Q8JGS9152 40S ribosomal protein S18 yes no 1.0 0.776 0.694 8e-46
P62271152 40S ribosomal protein S18 yes no 1.0 0.776 0.686 2e-45
P62272152 40S ribosomal protein S18 yes no 1.0 0.776 0.686 2e-45
P62270152 40S ribosomal protein S18 yes no 1.0 0.776 0.686 2e-45
P62269152 40S ribosomal protein S18 yes no 1.0 0.776 0.686 2e-45
A5JST6152 40S ribosomal protein S18 N/A no 1.0 0.776 0.686 2e-45
Q5TJE9152 40S ribosomal protein S18 yes no 1.0 0.776 0.686 2e-45
>sp|P34788|RS18_ARATH 40S ribosomal protein S18 OS=Arabidopsis thaliana GN=RPS18A PE=1 SV=1 Back     alignment and function desciption
 Score =  236 bits (603), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 114/118 (96%), Positives = 117/118 (99%)

Query: 1   MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELS 60
           MSLVANE+FQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELS
Sbjct: 1   MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELS 60

Query: 61  AAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIR 118
           AAE+DNLM +VANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIR
Sbjct: 61  AAEIDNLMTIVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIR 118
Located at the top of the head of the 40S subunit, it contacts several helices of the 18S rRNA.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8ISP0|RS18_BRABE 40S ribosomal protein S18 OS=Branchiostoma belcheri GN=RPS18 PE=2 SV=1 Back     alignment and function description
>sp|Q8IT98|RS18_ARGIR 40S ribosomal protein S18 OS=Argopecten irradians GN=RPS18 PE=2 SV=1 Back     alignment and function description
>sp|Q8JGS9|RS18_DANRE 40S ribosomal protein S18 OS=Danio rerio GN=rps18 PE=2 SV=1 Back     alignment and function description
>sp|P62271|RS18_RAT 40S ribosomal protein S18 OS=Rattus norvegicus GN=Rps18 PE=1 SV=3 Back     alignment and function description
>sp|P62272|RS18_PIG 40S ribosomal protein S18 OS=Sus scrofa GN=RPS18 PE=2 SV=3 Back     alignment and function description
>sp|P62270|RS18_MOUSE 40S ribosomal protein S18 OS=Mus musculus GN=Rps18 PE=1 SV=3 Back     alignment and function description
>sp|P62269|RS18_HUMAN 40S ribosomal protein S18 OS=Homo sapiens GN=RPS18 PE=1 SV=3 Back     alignment and function description
>sp|A5JST6|RS18_CAPHI 40S ribosomal protein S18 OS=Capra hircus GN=RPS18 PE=2 SV=1 Back     alignment and function description
>sp|Q5TJE9|RS18_CANFA 40S ribosomal protein S18 OS=Canis familiaris GN=RPS18 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query118
449443847152 PREDICTED: 40S ribosomal protein S18-lik 1.0 0.776 0.983 3e-61
255566712152 40S ribosomal protein S18, putative [Ric 1.0 0.776 0.974 5e-61
15219950152 40S ribosomal protein S18 [Arabidopsis t 1.0 0.776 0.966 9e-61
224085191152 predicted protein [Populus trichocarpa] 1.0 0.776 0.966 1e-60
13877525152 S18.A ribosomal protein [Arabidopsis tha 1.0 0.776 0.957 2e-60
296085211 912 unnamed protein product [Vitis vinifera] 1.0 0.129 0.949 3e-60
255559398152 40S ribosomal protein S18, putative [Ric 1.0 0.776 0.966 5e-60
296081217194 unnamed protein product [Vitis vinifera] 1.0 0.608 0.949 5e-60
313586543152 40S ribosomal protein S18C [Hevea brasil 1.0 0.776 0.966 7e-60
225432662152 PREDICTED: 40S ribosomal protein S18-lik 1.0 0.776 0.949 1e-59
>gi|449443847|ref|XP_004139687.1| PREDICTED: 40S ribosomal protein S18-like [Cucumis sativus] gi|449525091|ref|XP_004169553.1| PREDICTED: 40S ribosomal protein S18-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  238 bits (607), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 116/118 (98%), Positives = 117/118 (99%)

Query: 1   MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELS 60
           MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRR ANIVCKKADVDMNKRAGEL+
Sbjct: 1   MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELT 60

Query: 61  AAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIR 118
           AAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIR
Sbjct: 61  AAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIR 118

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255566712|ref|XP_002524340.1| 40S ribosomal protein S18, putative [Ricinus communis] gi|223536431|gb|EEF38080.1| 40S ribosomal protein S18, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|15219950|ref|NP_173692.1| 40S ribosomal protein S18 [Arabidopsis thaliana] gi|15234790|ref|NP_192718.1| 40S ribosomal protein S18 [Arabidopsis thaliana] gi|18399100|ref|NP_564434.1| 40S ribosomal protein S18 [Arabidopsis thaliana] gi|297809155|ref|XP_002872461.1| hypothetical protein ARALYDRAFT_489832 [Arabidopsis lyrata subsp. lyrata] gi|297845304|ref|XP_002890533.1| hypothetical protein ARALYDRAFT_472522 [Arabidopsis lyrata subsp. lyrata] gi|297851838|ref|XP_002893800.1| hypothetical protein ARALYDRAFT_473557 [Arabidopsis lyrata subsp. lyrata] gi|464707|sp|P34788.1|RS18_ARATH RecName: Full=40S ribosomal protein S18 gi|10086474|gb|AAG12534.1|AC015446_15 ribosomal protein S18 [Arabidopsis thaliana] gi|10092450|gb|AAG12853.1|AC079286_10 40S ribosomal protein S18; 25853-24673 [Arabidopsis thaliana] gi|14423408|gb|AAK62386.1|AF386941_1 S18.A ribosomal protein [Arabidopsis thaliana] gi|15724158|gb|AAL06471.1|AF411781_1 At1g22780/T22J18_5 [Arabidopsis thaliana] gi|405613|emb|CAA80684.1| ribosomal protein S18A [Arabidopsis thaliana] gi|434343|emb|CAA82273.1| S18 ribosomal protein [Arabidopsis thaliana] gi|434345|emb|CAA82274.1| S18 ribosomal protein [Arabidopsis thaliana] gi|434906|emb|CAA82275.1| S18 ribosomal protein [Arabidopsis thaliana] gi|2505871|emb|CAA72909.1| ribosomal protein S18A [Arabidopsis thaliana] gi|3287678|gb|AAC25506.1| Match to ribosomal S18 gene mRNA gb|Z28701, DNA gb|Z23165 from A. thaliana. ESTs gb|T21121, gb|Z17755, gb|R64776 and gb|R30430 come from this gene [Arabidopsis thaliana] gi|4538910|emb|CAB39647.1| S18.A ribosomal protein [Arabidopsis thaliana] gi|7267675|emb|CAB78103.1| S18.A ribosomal protein [Arabidopsis thaliana] gi|14334584|gb|AAK59471.1| putative ribosomal protein S18 [Arabidopsis thaliana] gi|17979113|gb|AAL47500.1| putative ribosomal protein S18 [Arabidopsis thaliana] gi|21555397|gb|AAM63849.1| ribosomal protein S18, putative [Arabidopsis thaliana] gi|21592452|gb|AAM64403.1| ribosomal protein S18, putative [Arabidopsis thaliana] gi|21593027|gb|AAM64976.1| ribosomal protein S18, putative [Arabidopsis thaliana] gi|30102858|gb|AAP21347.1| At4g09800 [Arabidopsis thaliana] gi|56236126|gb|AAV84519.1| At1g22780 [Arabidopsis thaliana] gi|98961089|gb|ABF59028.1| At1g22780 [Arabidopsis thaliana] gi|145713244|gb|ABP96570.1| pointed first leaf [Arabidopsis thaliana] gi|145713246|gb|ABP96571.1| pointed first leaf [Arabidopsis thaliana] gi|145713248|gb|ABP96572.1| pointed first leaf [Arabidopsis thaliana] gi|145713250|gb|ABP96573.1| pointed first leaf [Arabidopsis thaliana] gi|145713252|gb|ABP96574.1| pointed first leaf [Arabidopsis thaliana] gi|145713254|gb|ABP96575.1| pointed first leaf [Arabidopsis thaliana] gi|145713256|gb|ABP96576.1| pointed first leaf [Arabidopsis thaliana] gi|145713258|gb|ABP96577.1| pointed first leaf [Arabidopsis thaliana] gi|145713260|gb|ABP96578.1| pointed first leaf [Arabidopsis thaliana] gi|145713262|gb|ABP96579.1| pointed first leaf [Arabidopsis thaliana] gi|145713264|gb|ABP96580.1| pointed first leaf [Arabidopsis thaliana] gi|145713266|gb|ABP96581.1| pointed first leaf [Arabidopsis thaliana] gi|145713268|gb|ABP96582.1| pointed first leaf [Arabidopsis thaliana] gi|145713270|gb|ABP96583.1| pointed first leaf [Arabidopsis thaliana] gi|145713272|gb|ABP96584.1| pointed first leaf [Arabidopsis thaliana] gi|145713274|gb|ABP96585.1| pointed first leaf [Arabidopsis thaliana] gi|145713276|gb|ABP96586.1| pointed first leaf [Arabidopsis thaliana] gi|145713278|gb|ABP96587.1| pointed first leaf [Arabidopsis thaliana] gi|145713280|gb|ABP96588.1| pointed first leaf [Arabidopsis thaliana] gi|145713282|gb|ABP96589.1| pointed first leaf [Arabidopsis thaliana] gi|145713284|gb|ABP96590.1| pointed first leaf [Arabidopsis thaliana] gi|297318298|gb|EFH48720.1| hypothetical protein ARALYDRAFT_489832 [Arabidopsis lyrata subsp. lyrata] gi|297336375|gb|EFH66792.1| hypothetical protein ARALYDRAFT_472522 [Arabidopsis lyrata subsp. lyrata] gi|297339642|gb|EFH70059.1| hypothetical protein ARALYDRAFT_473557 [Arabidopsis lyrata subsp. lyrata] gi|332192166|gb|AEE30287.1| 40S ribosomal protein S18 [Arabidopsis thaliana] gi|332193538|gb|AEE31659.1| 40S ribosomal protein S18 [Arabidopsis thaliana] gi|332657400|gb|AEE82800.1| 40S ribosomal protein S18 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224085191|ref|XP_002307515.1| predicted protein [Populus trichocarpa] gi|222856964|gb|EEE94511.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|13877525|gb|AAK43840.1|AF370463_1 S18.A ribosomal protein [Arabidopsis thaliana] gi|17978783|gb|AAL47385.1| S18.A ribosomal protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|296085211|emb|CBI28706.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255559398|ref|XP_002520719.1| 40S ribosomal protein S18, putative [Ricinus communis] gi|223540104|gb|EEF41681.1| 40S ribosomal protein S18, putative [Ricinus communis] gi|313586541|gb|ADR71281.1| 40S ribosomal protein S18A [Hevea brasiliensis] Back     alignment and taxonomy information
>gi|296081217|emb|CBI18243.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|313586543|gb|ADR71282.1| 40S ribosomal protein S18C [Hevea brasiliensis] Back     alignment and taxonomy information
>gi|225432662|ref|XP_002282412.1| PREDICTED: 40S ribosomal protein S18-like [Vitis vinifera] gi|225460586|ref|XP_002262702.1| PREDICTED: 40S ribosomal protein S18-like [Vitis vinifera] gi|359479621|ref|XP_003632303.1| PREDICTED: 40S ribosomal protein S18-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query118
TAIR|locus:2199670152 PFL "POINTED FIRST LEAVES" [Ar 1.0 0.776 0.966 7.5e-57
TAIR|locus:2009066152 AT1G34030 [Arabidopsis thalian 1.0 0.776 0.966 7.5e-57
TAIR|locus:2005541152 RPS18C "S18 ribosomal protein" 1.0 0.776 0.966 7.5e-57
UNIPROTKB|Q8H590152 OJ1656_E11.104 "Putative ribos 1.0 0.776 0.847 1.9e-51
UNIPROTKB|Q8H588148 OJ1656_E11.108 "Putative ribos 0.949 0.756 0.866 2e-49
ZFIN|ZDB-GENE-020419-20152 rps18 "ribosomal protein S18" 1.0 0.776 0.694 1.9e-42
UNIPROTKB|A8HVP2153 RPS18 "Ribosomal protein S18" 0.991 0.764 0.700 5.2e-42
UNIPROTKB|Q90YQ5152 rps18 "40S ribosomal protein S 1.0 0.776 0.686 6.6e-42
UNIPROTKB|Q3T0R1152 RPS18 "40S ribosomal protein S 1.0 0.776 0.686 8.4e-42
UNIPROTKB|Q5TJE9152 RPS18 "40S ribosomal protein S 1.0 0.776 0.686 8.4e-42
TAIR|locus:2199670 PFL "POINTED FIRST LEAVES" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 585 (211.0 bits), Expect = 7.5e-57, P = 7.5e-57
 Identities = 114/118 (96%), Positives = 117/118 (99%)

Query:     1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELS 60
             MSLVANE+FQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELS
Sbjct:     1 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELS 60

Query:    61 AAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIR 118
             AAE+DNLM +VANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIR
Sbjct:    61 AAEIDNLMTIVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIR 118
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003723 "RNA binding" evidence=IEA
GO:0003735 "structural constituent of ribosome" evidence=IEA;ISS
GO:0005622 "intracellular" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0005840 "ribosome" evidence=IEA;ISS
GO:0006412 "translation" evidence=IEA;ISS
GO:0015935 "small ribosomal subunit" evidence=ISS
GO:0042254 "ribosome biogenesis" evidence=IBA
GO:0005618 "cell wall" evidence=IDA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0022627 "cytosolic small ribosomal subunit" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=RCA
GO:0006413 "translational initiation" evidence=TAS
TAIR|locus:2009066 AT1G34030 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005541 RPS18C "S18 ribosomal protein" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q8H590 OJ1656_E11.104 "Putative ribosomal protein S18A" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q8H588 OJ1656_E11.108 "Putative ribosomal protein S18" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-020419-20 rps18 "ribosomal protein S18" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|A8HVP2 RPS18 "Ribosomal protein S18" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
UNIPROTKB|Q90YQ5 rps18 "40S ribosomal protein S18" [Ictalurus punctatus (taxid:7998)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0R1 RPS18 "40S ribosomal protein S18" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q5TJE9 RPS18 "40S ribosomal protein S18" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q869U7RS18_DICDINo assigned EC number0.63240.99150.7597yesno
Q3T0R1RS18_BOVINNo assigned EC number0.68641.00.7763yesno
Q8JGS9RS18_DANRENo assigned EC number0.69491.00.7763yesno
P62269RS18_HUMANNo assigned EC number0.68641.00.7763yesno
Q8ISP0RS18_BRABENo assigned EC number0.74571.00.7763N/Ano
Q8IT98RS18_ARGIRNo assigned EC number0.72881.00.7763N/Ano
P34788RS18_ARATHNo assigned EC number0.96611.00.7763yesno
Q5TJE9RS18_CANFANo assigned EC number0.68641.00.7763yesno
O94754RS18_SCHPONo assigned EC number0.67791.00.7763yesno
P0CX55RS18A_YEASTNo assigned EC number0.6251.00.8082yesno
P0CX56RS18B_YEASTNo assigned EC number0.6251.00.8082yesno
P62271RS18_RATNo assigned EC number0.68641.00.7763yesno
P62270RS18_MOUSENo assigned EC number0.68641.00.7763yesno
P41094RS18_DROMENo assigned EC number0.64401.00.7763yesno
P62272RS18_PIGNo assigned EC number0.68641.00.7763yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh2_kg.1__3511__AT1G34030.1
annotation not avaliable (152 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
fgenesh2_kg.6__1496__AT5G15200.1
annotation not avaliable (198 aa)
•  •••• 0.928
fgenesh2_kg.7__3438__AT5G39850.1
annotation not avaliable (197 aa)
•  •••• 0.927
fgenesh2_kg.6__1842__AT2G09990.1
annotation not avaliable (146 aa)
•  •••• 0.879
fgenesh2_kg.3__384__AT3G04230.1
annotation not avaliable (146 aa)
•  •••• 0.875
fgenesh2_kg.3__1244__AT3G11940.2
annotation not avaliable (207 aa)
   •••• 0.813
fgenesh2_kg.6__206__AT5G02960.1
annotation not avaliable (142 aa)
   •••• 0.810
fgenesh2_kg.4__1779__AT2G37270.2
annotation not avaliable (207 aa)
   •••• 0.808
fgenesh2_kg.7__621__AT4G34670.1
annotation not avaliable (262 aa)
   •••• 0.806
fgenesh2_kg.3__991__AT3G09680.1
annotation not avaliable (142 aa)
   •••• 0.802
scaffold_502339.1
annotation not avaliable (149 aa)
•  •• • 0.798

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query118
PTZ00134154 PTZ00134, PTZ00134, 40S ribosomal protein S18; Pro 2e-69
PRK04053149 PRK04053, rps13p, 30S ribosomal protein S13P; Revi 7e-42
TIGR03629144 TIGR03629, arch_S13P, archaeal ribosomal protein S 1e-36
pfam00416106 pfam00416, Ribosomal_S13, Ribosomal protein S13/S1 1e-26
COG0099121 COG0099, RpsM, Ribosomal protein S13 [Translation, 3e-22
TIGR03631113 TIGR03631, bact_S13, 30S ribosomal protein S13 2e-09
PRK05179122 PRK05179, rpsM, 30S ribosomal protein S13; Validat 3e-08
>gnl|CDD|185469 PTZ00134, PTZ00134, 40S ribosomal protein S18; Provisional Back     alignment and domain information 
 Score =  204 bits (522), Expect = 2e-69
 Identities = 79/118 (66%), Positives = 100/118 (84%)

Query: 1   MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELS 60
           ++L   +DFQHILR+LNTNVDGK+K+ +ALT+IKGIGRR A +VCKKA +D+ KRAGEL+
Sbjct: 3   LTLEKADDFQHILRILNTNVDGKRKVPYALTAIKGIGRRFAYLVCKKAGIDVTKRAGELT 62

Query: 61  AAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIR 118
           A E++ ++ ++ANP QFKIPDWFLNRQ+D KDGK S + SN LD KLR+DLERLKKIR
Sbjct: 63  AEEIEKIVEIIANPLQFKIPDWFLNRQRDPKDGKNSHLTSNMLDTKLREDLERLKKIR 120

Length = 154
>gnl|CDD|235215 PRK04053, rps13p, 30S ribosomal protein S13P; Reviewed Back     alignment and domain information
>gnl|CDD|213839 TIGR03629, arch_S13P, archaeal ribosomal protein S13P Back     alignment and domain information
>gnl|CDD|144128 pfam00416, Ribosomal_S13, Ribosomal protein S13/S18 Back     alignment and domain information
>gnl|CDD|223177 COG0099, RpsM, Ribosomal protein S13 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|213840 TIGR03631, bact_S13, 30S ribosomal protein S13 Back     alignment and domain information
>gnl|CDD|235358 PRK05179, rpsM, 30S ribosomal protein S13; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 118
PTZ00134154 40S ribosomal protein S18; Provisional 100.0
PRK04053149 rps13p 30S ribosomal protein S13P; Reviewed 100.0
TIGR03629144 arch_S13P archaeal ribosomal protein S13P. This mo 100.0
KOG3311152 consensus Ribosomal protein S18 [Translation, ribo 99.97
COG0099121 RpsM Ribosomal protein S13 [Translation, ribosomal 99.96
CHL00137122 rps13 ribosomal protein S13; Validated 99.95
PRK05179122 rpsM 30S ribosomal protein S13; Validated 99.95
PF00416107 Ribosomal_S13: Ribosomal protein S13/S18; InterPro 99.94
TIGR03631113 bact_S13 30S ribosomal protein S13. This model des 99.94
PF0683192 H2TH: Formamidopyrimidine-DNA glycosylase H2TH dom 97.6
PRK04184 535 DNA topoisomerase VI subunit B; Validated 97.3
PRK01103274 formamidopyrimidine/5-formyluracil/ 5-hydroxymethy 97.24
TIGR01052 488 top6b DNA topoisomerase VI, B subunit. This model 96.96
PRK14810272 formamidopyrimidine-DNA glycosylase; Provisional 96.77
PRK14811269 formamidopyrimidine-DNA glycosylase; Provisional 96.68
PRK10445263 endonuclease VIII; Provisional 96.53
PRK13945282 formamidopyrimidine-DNA glycosylase; Provisional 96.46
TIGR00577272 fpg formamidopyrimidine-DNA glycosylase (fpg). All 96.37
COG1389 538 DNA topoisomerase VI, subunit B [DNA replication, 96.23
PF05833 455 FbpA: Fibronectin-binding protein A N-terminus (Fb 95.68
COG0266273 Nei Formamidopyrimidine-DNA glycosylase [DNA repli 95.02
TIGR00275400 flavoprotein, HI0933 family. The model when search 94.75
PF0063330 HHH: Helix-hairpin-helix motif; InterPro: IPR00044 94.63
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylati 93.24
PF1179832 IMS_HHH: IMS family HHH motif; InterPro: IPR024728 92.96
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 92.78
PF1039152 DNA_pol_lambd_f: Fingers domain of DNA polymerase 92.66
PF1452060 HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU 92.55
PRK02515132 psbU photosystem II complex extrinsic protein prec 92.49
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 90.78
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 90.64
smart0027826 HhH1 Helix-hairpin-helix DNA-binding motif class 1 90.43
TIGR03252177 uncharacterized HhH-GPD family protein. This model 88.16
PF00398262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 88.07
PRK14606188 ruvA Holliday junction DNA helicase RuvA; Provisio 87.62
PRK14605194 ruvA Holliday junction DNA helicase RuvA; Provisio 87.27
PRK14601183 ruvA Holliday junction DNA helicase RuvA; Provisio 87.18
PF09883225 DUF2110: Uncharacterized protein conserved in arch 86.69
PRK14603197 ruvA Holliday junction DNA helicase RuvA; Provisio 86.57
PRK14604195 ruvA Holliday junction DNA helicase RuvA; Provisio 86.46
PRK13901196 ruvA Holliday junction DNA helicase RuvA; Provisio 85.89
PRK00116192 ruvA Holliday junction DNA helicase RuvA; Reviewed 85.38
PRK14602203 ruvA Holliday junction DNA helicase RuvA; Provisio 85.35
COG1293 564 Predicted RNA-binding protein homologous to eukary 85.21
COG3743133 Uncharacterized conserved protein [Function unknow 85.18
PF1457990 HHH_6: Helix-hairpin-helix motif; PDB: 2HPM_A 2HPI 84.86
COG0632201 RuvA Holliday junction resolvasome, DNA-binding su 84.54
PF1452060 HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU 83.23
TIGR00084191 ruvA Holliday junction DNA helicase, RuvA subunit. 82.85
cd0008075 HhH2_motif Helix-hairpin-helix class 2 (Pol1 famil 82.11
PRK14605194 ruvA Holliday junction DNA helicase RuvA; Provisio 81.52
TIGR0042669 competence protein ComEA helix-hairpin-helix repea 81.29
PRK14602203 ruvA Holliday junction DNA helicase RuvA; Provisio 80.58
PF1283665 HHH_3: Helix-hairpin-helix motif; PDB: 2EDU_A 2OCE 80.41
PRK14606188 ruvA Holliday junction DNA helicase RuvA; Provisio 80.23
PRK14600186 ruvA Holliday junction DNA helicase RuvA; Provisio 80.21
PRK14601183 ruvA Holliday junction DNA helicase RuvA; Provisio 80.15
PRK14600186 ruvA Holliday junction DNA helicase RuvA; Provisio 80.14
>PTZ00134 40S ribosomal protein S18; Provisional Back     alignment and domain information 
Probab=100.00  E-value=9.8e-46  Score=271.88  Aligned_cols=112  Identities=70%  Similarity=1.126  Sum_probs=109.4

Q ss_pred             cccccchhhccccCCCCeehhhhhhhhcccCcchHHHHHHHhCCCCCCcCCCCCHHHHHHHHHHHhCCCCccCCcchhcc
Q 033487            7 EDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNR   86 (118)
Q Consensus         7 ~~~~~mvrI~g~~i~~~K~v~~aLt~IyGIG~~~A~~Ic~~lgi~~~~r~~~Ls~~qi~~L~~~i~~~~~~~ip~w~~nr   86 (118)
                      +||+||+||+||+||++|+|.+||++|||||+++|.+||+++||||++++++||++|+++|+++|++|.+|.+|+||+||
T Consensus         9 ~~~~~mvrI~~~~l~~~K~v~~aLt~I~GIG~~~A~~I~~~lgi~~~~~~~~Lt~~qi~~l~~~i~~~~~~~iP~w~~nr   88 (154)
T PTZ00134          9 DDFQHILRILNTNVDGKRKVPYALTAIKGIGRRFAYLVCKKAGIDVTKRAGELTAEEIEKIVEIIANPLQFKIPDWFLNR   88 (154)
T ss_pred             hhhhhhhhccCccCCCCCEEEEeecccccccHHHHHHHHHHcCcCcCCCcccCCHHHHHHHHHHHhccccCCCChhHhhc
Confidence            58999999999999999999999999999999999999999999999999999999999999999987678999999999


Q ss_pred             ccccCCCccceeehhhHHHHHHHHHHHHHhCC
Q 033487           87 QKDYKDGKYSQVVSNALDMKLRDDLERLKKIR  118 (118)
Q Consensus        87 ~kd~~tg~~~h~i~~dL~~~~~~dI~rl~~I~  118 (118)
                      |||++||++.|+||+||++.+++||+||++|+
T Consensus        89 ~kd~~tG~d~h~i~~dL~~~~~~dI~Rl~~I~  120 (154)
T PTZ00134         89 QRDPKDGKNSHLTSNMLDTKLREDLERLKKIR  120 (154)
T ss_pred             cccccccchhhhhHHHHHHHHHHHHHHHHHhc
Confidence            99999999999999999999999999999986

>PRK04053 rps13p 30S ribosomal protein S13P; Reviewed Back     alignment and domain information
>TIGR03629 arch_S13P archaeal ribosomal protein S13P Back     alignment and domain information
>KOG3311 consensus Ribosomal protein S18 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0099 RpsM Ribosomal protein S13 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>CHL00137 rps13 ribosomal protein S13; Validated Back     alignment and domain information
>PRK05179 rpsM 30S ribosomal protein S13; Validated Back     alignment and domain information
>PF00416 Ribosomal_S13: Ribosomal protein S13/S18; InterPro: IPR001892 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>TIGR03631 bact_S13 30S ribosomal protein S13 Back     alignment and domain information
>PF06831 H2TH: Formamidopyrimidine-DNA glycosylase H2TH domain; InterPro: IPR015886 This entry represents a helix-2turn-helix DNA-binding domain found in DNA glycosylase/AP lyase enzymes, which are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents Back     alignment and domain information
>PRK04184 DNA topoisomerase VI subunit B; Validated Back     alignment and domain information
>PRK01103 formamidopyrimidine/5-formyluracil/ 5-hydroxymethyluracil DNA glycosylase; Validated Back     alignment and domain information
>TIGR01052 top6b DNA topoisomerase VI, B subunit Back     alignment and domain information
>PRK14810 formamidopyrimidine-DNA glycosylase; Provisional Back     alignment and domain information
>PRK14811 formamidopyrimidine-DNA glycosylase; Provisional Back     alignment and domain information
>PRK10445 endonuclease VIII; Provisional Back     alignment and domain information
>PRK13945 formamidopyrimidine-DNA glycosylase; Provisional Back     alignment and domain information
>TIGR00577 fpg formamidopyrimidine-DNA glycosylase (fpg) Back     alignment and domain information
>COG1389 DNA topoisomerase VI, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>PF05833 FbpA: Fibronectin-binding protein A N-terminus (FbpA); InterPro: IPR008616 This family consists of the N-terminal region of the prokaryotic fibronectin-binding protein, the C-terminal region is IPR008532 from INTERPRO Back     alignment and domain information
>COG0266 Nei Formamidopyrimidine-DNA glycosylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PF00633 HHH: Helix-hairpin-helix motif; InterPro: IPR000445 The HhH motif is an around 20 amino acids domain present in prokaryotic and eukaryotic non-sequence-specific DNA binding proteins [, , ] Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF11798 IMS_HHH: IMS family HHH motif; InterPro: IPR024728 This helix-hairpin-helix motif is found in proteins belonging to the type-Y family of DNA polymerases [] Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>PF10391 DNA_pol_lambd_f: Fingers domain of DNA polymerase lambda; InterPro: IPR018944 DNA polymerases catalyse the addition of dNMPs onto the 3-prime ends of DNA chains Back     alignment and domain information
>PF14520 HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU6_A 3AU2_A 3B0X_A 3B0Y_A 1SZP_C 3LDA_A 1WCN_A 2JZB_B 2ZTC_A Back     alignment and domain information
>PRK02515 psbU photosystem II complex extrinsic protein precursor U; Provisional Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>smart00278 HhH1 Helix-hairpin-helix DNA-binding motif class 1 Back     alignment and domain information
>TIGR03252 uncharacterized HhH-GPD family protein Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>PRK14606 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PRK14605 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PRK14601 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PF09883 DUF2110: Uncharacterized protein conserved in archaea (DUF2110); InterPro: IPR016757 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK14603 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PRK14604 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PRK13901 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PRK00116 ruvA Holliday junction DNA helicase RuvA; Reviewed Back     alignment and domain information
>PRK14602 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>COG1293 Predicted RNA-binding protein homologous to eukaryotic snRNP [Transcription] Back     alignment and domain information
>COG3743 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14579 HHH_6: Helix-hairpin-helix motif; PDB: 2HPM_A 2HPI_A 3E0D_A 3F2C_A 3F2B_A 3F2D_A 2HQA_A 2HNH_A Back     alignment and domain information
>COG0632 RuvA Holliday junction resolvasome, DNA-binding subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PF14520 HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU6_A 3AU2_A 3B0X_A 3B0Y_A 1SZP_C 3LDA_A 1WCN_A 2JZB_B 2ZTC_A Back     alignment and domain information
>TIGR00084 ruvA Holliday junction DNA helicase, RuvA subunit Back     alignment and domain information
>cd00080 HhH2_motif Helix-hairpin-helix class 2 (Pol1 family) motif Back     alignment and domain information
>PRK14605 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>TIGR00426 competence protein ComEA helix-hairpin-helix repeat region Back     alignment and domain information
>PRK14602 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PF12836 HHH_3: Helix-hairpin-helix motif; PDB: 2EDU_A 2OCE_A 3BZK_A 3BZC_A 2DUY_A Back     alignment and domain information
>PRK14606 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PRK14600 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PRK14601 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PRK14600 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query118
3iz6_M152 Localization Of The Small Subunit Ribosomal Protein 5e-58
2zkq_m152 Structure Of A Mammalian Ribosomal 40s Subunit With 2e-46
3izb_M146 Localization Of The Small Subunit Ribosomal Protein 7e-40
3zey_M153 High-resolution Cryo-electron Microscopy Structure 7e-37
1s1h_M132 Structure Of The Ribosomal 80s-Eef2-Sordarin Comple 1e-35
3jyv_M130 Structure Of The 40s Rrna And Proteins And PE TRNA 4e-35
2xzm_M155 Crystal Structure Of The Eukaryotic 40s Ribosomal S 2e-29
3j20_O148 Promiscuous Behavior Of Proteins In Archaeal Riboso 1e-20
>pdb|3IZ6|M Chain M, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 152 Back     alignment and structure 
Iteration: 1

 Score =  218 bits (556), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 101/118 (85%), Positives = 112/118 (94%)
Query: 1   MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELS 60
           MSL+A E+FQHILRVLNTNVDGKQKIMFALTSIKG+GRR +NIVCKKAD+DMNKRAGELS
Sbjct: 1   MSLIAGEEFQHILRVLNTNVDGKQKIMFALTSIKGVGRRFSNIVCKKADIDMNKRAGELS 60
Query: 61  AAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIR 118
           A E+D LM VV NPRQFK+PDWFLNR+KDYKDG++SQVVSNA+DMKLRDDLERLKKIR
Sbjct: 61  AEEMDRLMAVVHNPRQFKVPDWFLNRKKDYKDGRFSQVVSNAVDMKLRDDLERLKKIR 118
>pdb|2ZKQ|MM Chain m, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 152 Back     alignment and structure
>pdb|3IZB|M Chain M, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 146 Back     alignment and structure
>pdb|3ZEY|M Chain M, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 153 Back     alignment and structure
>pdb|1S1H|M Chain M, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From Yeast Obtained By Docking Atomic Models For Rna And Protein Components Into A 11.7 A Cryo-Em Map. This File, 1s1h, Contains 40s Subunit. The 60s Ribosomal Subunit Is In File 1s1i Length = 132 Back     alignment and structure
>pdb|3JYV|M Chain M, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 130 Back     alignment and structure
>pdb|2XZM|M Chain M, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 155 Back     alignment and structure
>pdb|3J20|O Chain O, Promiscuous Behavior Of Proteins In Archaeal Ribosomes Revealed By Cryo-em: Implications For Evolution Of Eukaryotic Ribosomes (30s Ribosomal Subunit) Length = 148 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query118
3iz6_M152 40S ribosomal protein S18 (S13P); eukaryotic ribos 1e-61
2xzm_M155 RPS18E; ribosome, translation; 3.93A {Tetrahymena 9e-59
3u5c_S146 40S ribosomal protein S18-A, 40S ribosomal protein 2e-58
3r8n_M114 30S ribosomal protein S13; protein biosynthesis, R 2e-10
2vqe_M126 30S ribosomal protein S13, 30S ribosomal protein S 1e-09
3bbn_M145 Ribosomal protein S13; small ribosomal subunit, sp 6e-08
>3iz6_M 40S ribosomal protein S18 (S13P); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Length = 152 Back     alignment and structure
 Score =  184 bits (469), Expect = 1e-61
 Identities = 101/118 (85%), Positives = 112/118 (94%)

Query: 1   MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELS 60
           MSL+A E+FQHILRVLNTNVDGKQKIMFALTSIKG+GRR +NIVCKKAD+DMNKRAGELS
Sbjct: 1   MSLIAGEEFQHILRVLNTNVDGKQKIMFALTSIKGVGRRFSNIVCKKADIDMNKRAGELS 60

Query: 61  AAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIR 118
           A E+D LM VV NPRQFK+PDWFLNR+KDYKDG++SQVVSNA+DMKLRDDLERLKKIR
Sbjct: 61  AEEMDRLMAVVHNPRQFKVPDWFLNRKKDYKDGRFSQVVSNAVDMKLRDDLERLKKIR 118
>2xzm_M RPS18E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_M Length = 155 Back     alignment and structure
>3u5c_S 40S ribosomal protein S18-A, 40S ribosomal protein S17-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_M 3o30_L 3o2z_L 3u5g_S 1s1h_M 3jyv_M* 2zkq_m Length = 146 Back     alignment and structure
>2vqe_M 30S ribosomal protein S13, 30S ribosomal protein S6; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: a.156.1.1 PDB: 1gix_P* 1hnw_M* 1hnx_M* 1hnz_M* 1hr0_M 1ibk_M* 1ibl_M* 1ibm_M 1j5e_M 1jgo_P* 1jgp_P* 1jgq_P* 1mj1_P* 1ml5_P* 1n32_M* 1n33_M* 1n34_M 1n36_M 1xmo_M* 1xmq_M* ... Length = 126 Back     alignment and structure
>3bbn_M Ribosomal protein S13; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Length = 145 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query118
3iz6_M152 40S ribosomal protein S18 (S13P); eukaryotic ribos 100.0
3u5c_S146 40S ribosomal protein S18-A, 40S ribosomal protein 100.0
2xzm_M155 RPS18E; ribosome, translation; 3.93A {Tetrahymena 100.0
3j20_O148 30S ribosomal protein S13P; archaea, archaeal, KIN 100.0
2vqe_M126 30S ribosomal protein S13, 30S ribosomal protein S 99.96
3r8n_M114 30S ribosomal protein S13; protein biosynthesis, R 99.95
3bbn_M145 Ribosomal protein S13; small ribosomal subunit, sp 99.88
1mu5_A 471 Type II DNA topoisomerase VI subunit B; GHKL ATPas 97.3
3u6p_A273 Formamidopyrimidine-DNA glycosylase; DNA glycosyla 96.38
1k82_A268 Formamidopyrimidine-DNA glycosylase; protein-DNA c 96.31
1k3x_A262 Endonuclease VIII; hydrolase/DNA, hydrolase-DNA co 96.3
1ee8_A266 MUTM (FPG) protein; beta sandwich, zinc finger, he 96.26
2xzf_A271 Formamidopyrimidine-DNA glycosylase; hydrolase-DNA 96.23
3w0f_A287 Endonuclease 8-like 3; helix two turns helix, zinc 96.22
3twl_A310 Formamidopyrimidine-DNA glycosylase 1; helix two t 96.21
3vk8_A295 Probable formamidopyrimidine-DNA glycosylase; DNA 96.08
3fut_A271 Dimethyladenosine transferase; methyltransferase, 94.89
2zbk_B 530 Type 2 DNA topoisomerase 6 subunit B; DNA binding 94.22
1kft_A78 UVRC, excinuclease ABC subunit C; helix-hairpin-he 94.19
1qyr_A252 KSGA, high level kasugamycin resistance protein, S 93.17
2a1j_A63 DNA repair endonuclease XPF; XPF, xeroderma pigmen 92.9
3uzu_A279 Ribosomal RNA small subunit methyltransferase A; s 92.82
1x2i_A75 HEF helicase/nuclease; alpha helix, helix-hairpin- 92.49
3arc_U97 Photosystem II 12 kDa extrinsic protein; PSII, mem 91.59
1z00_A89 DNA excision repair protein ERCC-1; helix-hairpin- 91.23
2a1j_B91 DNA excision repair protein ERCC-1; XPF, xeroderma 91.08
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like 90.62
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 90.58
1s5l_U134 Photosystem II 12 kDa extrinsic protein; photosynt 90.41
2duy_A75 Competence protein comea-related protein; helix-ha 89.98
1tdh_A 364 NEI endonuclease VIII-like 1; helix two turns heli 89.62
1ixr_A191 Holliday junction DNA helicase RUVA; heterooligome 87.6
3gru_A295 Dimethyladenosine transferase; rossman fold, ribos 87.41
1cuk_A203 RUVA protein; DNA repair, SOS response, DNA-bindin 85.8
1z00_B84 DNA repair endonuclease XPF; helix-hairpin-helix, 85.11
2ztd_A212 Holliday junction ATP-dependent DNA helicase RUVA; 85.1
2edu_A98 Kinesin-like protein KIF22; kinesin-like DNA bindi 84.35
3fhg_A207 Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; hel 83.72
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 81.84
2nrt_A220 Uvrabc system protein C; UVRC, endonuclease, RNAse 81.68
2gqf_A401 Hypothetical protein HI0933; structural genomics, 81.52
3fhf_A214 Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; hel 80.48
3n0u_A219 Probable N-glycosylase/DNA lyase; structural genom 80.39
>3iz6_M 40S ribosomal protein S18 (S13P); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
Probab=100.00  E-value=3.9e-48  Score=283.01  Aligned_cols=118  Identities=86%  Similarity=1.306  Sum_probs=115.9

Q ss_pred             CCCCCccccccchhhccccCCCCeehhhhhhhhcccCcchHHHHHHHhCCCCCCcCCCCCHHHHHHHHHHHhCCCCccCC
Q 033487            1 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIP   80 (118)
Q Consensus         1 ~~~~~~~~~~~mvrI~g~~i~~~K~v~~aLt~IyGIG~~~A~~Ic~~lgi~~~~r~~~Ls~~qi~~L~~~i~~~~~~~ip   80 (118)
                      |+++.+|+|+||+||+||+||++|+|.+|||+|||||+++|.+||+++||||++++++||++|+++|+++|++|.+|.+|
T Consensus         1 ~~~~~~~~~~~m~RI~g~~i~~~k~v~~ALt~I~GIG~~~A~~I~~~~gid~~~r~g~Lt~~ei~~l~~~i~~~~~~~ip   80 (152)
T 3iz6_M            1 MSLIAGEEFQHILRVLNTNVDGKQKIMFALTSIKGVGRRFSNIVCKKADIDMNKRAGELSAEEMDRLMAVVHNPRQFKVP   80 (152)
T ss_dssp             CCCCTTCSCCCCCCTTTTCCCCSSBHHHHHTTSTTCCHHHHHHHHHHHTCCSSSBTTTSCHHHHHHHHHHHHSCSSCCCC
T ss_pred             CCcccHHHHHHHHHHcCCcCCCCcEeHhhhhhccCcCHHHHHHHHHHcCCCCCcEeCcCCHHHHHHHHHHHHhhcccCcc
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999998789999


Q ss_pred             cchhccccccCCCccceeehhhHHHHHHHHHHHHHhCC
Q 033487           81 DWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIR  118 (118)
Q Consensus        81 ~w~~nr~kd~~tg~~~h~i~~dL~~~~~~dI~rl~~I~  118 (118)
                      +||+|||||++||++.|+|++||++++++||+||++|+
T Consensus        81 ~w~lNr~kD~~~G~~~~li~~dL~~~~~~dI~RL~~I~  118 (152)
T 3iz6_M           81 DWFLNRKKDYKDGRFSQVVSNAVDMKLRDDLERLKKIR  118 (152)
T ss_dssp             CCSCSCCCSCCCCSCCTTCTHHHHHHHHHHHHHHHHHT
T ss_pred             hhhhhhhcccCCcceeeechhHHHHHHHHhHHHHhhhh
Confidence            99999999999999999999999999999999999985
>3u5c_S 40S ribosomal protein S18-A, 40S ribosomal protein S17-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_M 3o30_L 3o2z_L 3u5g_S 1s1h_M 3jyv_M* 2zkq_m Back     alignment and structure
>2xzm_M RPS18E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_M Back     alignment and structure
>3j20_O 30S ribosomal protein S13P; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>2vqe_M 30S ribosomal protein S13, 30S ribosomal protein S6; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: a.156.1.1 PDB: 1gix_P* 1hnw_M* 1hnx_M* 1hnz_M* 1hr0_M 1ibk_M* 1ibl_M* 1ibm_M 1j5e_M 1jgo_P* 1jgp_P* 1jgq_P* 1mj1_P* 1ml5_P* 1n32_M* 1n33_M* 1n34_M 1n36_M 1xmo_M* 1xmq_M* ... Back     alignment and structure
>3bbn_M Ribosomal protein S13; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
>1mu5_A Type II DNA topoisomerase VI subunit B; GHKL ATPase, helix two-turns helix; 2.00A {Sulfolobus shibatae} SCOP: a.156.1.3 d.14.1.3 d.122.1.2 PDB: 1mx0_A* 1z5b_A* 1z5a_A* 1z59_A* 1z5c_A* 2hkj_A* Back     alignment and structure
>3u6p_A Formamidopyrimidine-DNA glycosylase; DNA glycosylase, DNA repair, sequence context; HET: DNA 08Q; 1.60A {Geobacillus stearothermophilus} PDB: 3u6d_A* 3u6c_A* 3u6l_A* 3u6m_A* 3u6o_A* 3u6e_A* 3u6q_A* 3u6s_A* 3gp1_A* 3sbj_A* 2f5q_A* 2f5s_A* 3gq4_A* 3gpy_A* 2f5n_A 2f5o_A 2f5p_A 3sau_A* 3sar_A* 3sav_A* ... Back     alignment and structure
>1k82_A Formamidopyrimidine-DNA glycosylase; protein-DNA complex, DNA repair, beta sandwich, zinc finger, helix two-turns helix, hydrolase/DNA complex; HET: PED; 2.10A {Escherichia coli} SCOP: a.156.1.2 b.113.1.1 g.39.1.8 Back     alignment and structure
>1k3x_A Endonuclease VIII; hydrolase/DNA, hydrolase-DNA complex; HET: BRU PED; 1.25A {Escherichia coli} SCOP: a.156.1.2 b.113.1.1 g.39.1.8 PDB: 1k3w_A* 1q39_A 2ea0_A* 2oq4_A* 1q3c_A 2opf_A* 1q3b_A* Back     alignment and structure
>1ee8_A MUTM (FPG) protein; beta sandwich, zinc finger, helix two-turns helix, riken STR genomics/proteomics initiative, RSGI, structural genomics; 1.90A {Thermus thermophilus} SCOP: a.156.1.2 b.113.1.1 g.39.1.8 Back     alignment and structure
>2xzf_A Formamidopyrimidine-DNA glycosylase; hydrolase-DNA complex; HET: VET; 1.80A {Lactococcus lactis subsp} PDB: 1pm5_A* 1xc8_A* 1pji_A* 2xzu_A* 3c58_A* 1tdz_A* 1nnj_A 1kfv_A 1pjj_A* Back     alignment and structure
>3w0f_A Endonuclease 8-like 3; helix two turns helix, zinc finger, DNA binding, hydrolase; 2.00A {Mus musculus} Back     alignment and structure
>3twl_A Formamidopyrimidine-DNA glycosylase 1; helix two turns helix, zinc-LESS finger, hydrolase, DNA DAMA repair, DNA-binding, glycosidase, lyase; 1.70A {Arabidopsis thaliana} PDB: 3twm_A* 3twk_A Back     alignment and structure
>3vk8_A Probable formamidopyrimidine-DNA glycosylase; DNA glycosylase, hneil1 ortholog, DNA lesion, thymine glycol zincless finger; HET: DNA CTG; 2.00A {Acanthamoeba polyphaga mimivirus} PDB: 3vk7_A* 3a42_A 3a46_A* 3a45_A* Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>2zbk_B Type 2 DNA topoisomerase 6 subunit B; DNA binding protein, decatenation, ATPase, drug design, DNA-binding, magnesium, metal-binding; HET: RDC; 3.56A {Sulfolobus shibatae} Back     alignment and structure
>1kft_A UVRC, excinuclease ABC subunit C; helix-hairpin-helix, HHH domain, DNA-binding domain, DNA binding protein; NMR {Escherichia coli} SCOP: a.60.2.3 Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>2a1j_A DNA repair endonuclease XPF; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 PDB: 2kn7_A* Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>1x2i_A HEF helicase/nuclease; alpha helix, helix-hairpin-helix DNA binding domain, homodimer, hydrolase; 1.45A {Pyrococcus furiosus} SCOP: a.60.2.5 Back     alignment and structure
>3arc_U Photosystem II 12 kDa extrinsic protein; PSII, membrane-protein complex, transmembrane alpha-helix, E transport, photosynthesis; HET: OEX CLA PHO BCR PL9 SQD LMG UNL LMT HTG DGD LHG HEM; 1.90A {Thermosynechococcus vulcanus} PDB: 3bz1_U* 2axt_U* 3bz2_U* 3kzi_U* 3prq_U* 3prr_U* 3a0b_U* 3a0h_U* Back     alignment and structure
>1z00_A DNA excision repair protein ERCC-1; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 Back     alignment and structure
>2a1j_B DNA excision repair protein ERCC-1; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>1s5l_U Photosystem II 12 kDa extrinsic protein; photosynthesis, oxygen-evolving, tetra- manganese, membrane; HET: CL1 PHO HEM PL9 LMT BCR; 3.50A {Thermosynechococcus elongatus} Back     alignment and structure
>2duy_A Competence protein comea-related protein; helix-hairpin-helix, structural genomics, NPPSFA; 1.75A {Thermus thermophilus} SCOP: a.60.2.7 Back     alignment and structure
>1tdh_A NEI endonuclease VIII-like 1; helix two turns helix, zinc-LESS finger, hydrolase; 2.10A {Homo sapiens} SCOP: a.156.1.2 b.113.1.1 g.39.1.8 Back     alignment and structure
>1ixr_A Holliday junction DNA helicase RUVA; heterooligomeric complex, octameric RUVA, AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ANP; 3.30A {Thermus thermophilus} SCOP: a.60.2.1 b.40.4.2 Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>1cuk_A RUVA protein; DNA repair, SOS response, DNA-binding, DNA recombination; 1.90A {Escherichia coli} SCOP: a.5.1.1 a.60.2.1 b.40.4.2 PDB: 1hjp_A 1bdx_A* 1c7y_A 1d8l_A Back     alignment and structure
>1z00_B DNA repair endonuclease XPF; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 PDB: 2aq0_A* Back     alignment and structure
>2ztd_A Holliday junction ATP-dependent DNA helicase RUVA; recombination, branch migration, DNA BIND oligomerization, acidic PIN; 2.40A {Mycobacterium tuberculosis} PDB: 2ztc_A 2zte_A 2h5x_A 1bvs_A Back     alignment and structure
>2edu_A Kinesin-like protein KIF22; kinesin-like DNA binding domain, helix turn helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.60.2.7 Back     alignment and structure
>3fhg_A Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; helix-hairpin-helix, 8-oxoguanine, 8-OXOG, DNA damage, DNA repair, glycosidase, hydrolase; 1.90A {Sulfolobus solfataricus} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>2nrt_A Uvrabc system protein C; UVRC, endonuclease, RNAse H, helix hairpin helix, NER, hydrolase; 1.50A {Thermotoga maritima} PDB: 2nrv_A 2nrw_A 2nrx_A 2nrz_A Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3fhf_A Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; helix-hairpin-helix, 8-oxoguanine, 8-OXOG, DNA damage, DNA repair, glycosidase; 2.00A {Methanocaldococcus jannaschii} PDB: 3knt_A* Back     alignment and structure
>3n0u_A Probable N-glycosylase/DNA lyase; structural genomics, ISFI, DNA repair, 8-oxoguanine, base EX repair, PSI-2, protein structure initiative; 1.50A {Thermotoga maritima} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 118
d2gy9m1114 a.156.1.1 (M:1-114) Ribosomal protein S13 {Escheri 5e-17
d2uubm1125 a.156.1.1 (M:2-126) Ribosomal protein S13 {Thermus 7e-17
>d2gy9m1 a.156.1.1 (M:1-114) Ribosomal protein S13 {Escherichia coli [TaxId: 562]} Length = 114 Back     information, alignment and structure

class: All alpha proteins
fold: S13-like H2TH domain
superfamily: S13-like H2TH domain
family: Ribosomal protein S13
domain: Ribosomal protein S13
species: Escherichia coli [TaxId: 562]

 Score = 68.7 bits (168), Expect = 5e-17
 Identities = 20/105 (19%), Positives = 39/105 (37%), Gaps = 23/105 (21%)

Query: 14  RVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVAN 73
           R+   N+   +  + ALTSI G+G+  +  +   A +  + +  ELS  ++D        
Sbjct: 2   RIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEGQID-------- 53

Query: 74  PRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIR 118
                            +D     VV   L  ++   ++RL  + 
Sbjct: 54  ---------------TLRDEVAKFVVEGDLRREISMSIKRLMDLG 83
>d2uubm1 a.156.1.1 (M:2-126) Ribosomal protein S13 {Thermus thermophilus [TaxId: 274]} Length = 125 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query118
d2gy9m1114 Ribosomal protein S13 {Escherichia coli [TaxId: 56 99.95
d2uubm1125 Ribosomal protein S13 {Thermus thermophilus [TaxId 99.95
d2hkja178 Topoisomerase VI-B subunit middle domain {Archaeon 98.55
d1k3xa189 Endonuclease VIII {Escherichia coli [TaxId: 562]} 97.89
d1r2za194 DNA repair protein MutM (Fpg) {Bacillus stearother 97.76
d1k82a188 DNA repair protein MutM (Fpg) {Escherichia coli [T 97.72
d1tdza188 DNA repair protein MutM (Fpg) {Lactococcus lactis 97.63
d1ee8a189 DNA repair protein MutM (Fpg) {Thermus thermophilu 97.55
d2bgwa170 DNA repair endonuclease XPF {Aeropyrum pernix [Tax 96.03
d2fmpa257 DNA polymerase beta {Human (Homo sapiens) [TaxId: 95.95
d2bcqa257 DNA polymerase lambda {Human (Homo sapiens) [TaxId 95.9
d1tdha1115 Endonuclease VIII-like 1 (NEIL1) {Human (Homo sapi 95.59
d1jmsa360 Terminal deoxynucleotidyl transferase {Mouse (Mus 95.54
d2a1jb178 DNA excision repair protein ERCC-1 {Human (Homo sa 95.5
d2i0za2169 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 95.15
d1pzna161 DNA repair protein Rad51, N-terminal domain {Archa 95.15
d1x2ia168 ATP-dependent RNA helicase PF2015 {Pyrococcus furi 94.89
d1kfta_56 Excinuclease UvrC C-terminal domain {Escherichia c 94.54
d2i1qa160 DNA repair protein Rad51, N-terminal domain {Archa 94.3
d2gqfa2148 Hypothetical protein HI0933 {Haemophilus influenza 94.07
d1bvsa271 DNA helicase RuvA subunit, middle domain {Mycobact 93.33
d1ixra173 DNA helicase RuvA subunit, middle domain {Thermus 93.21
d2axtu198 Photosystem II 12 kDa extrinsic protein PsbU {Ther 93.01
d1cuka278 DNA helicase RuvA subunit, middle domain {Escheric 92.45
d1bvsa271 DNA helicase RuvA subunit, middle domain {Mycobact 91.23
d1qyra_252 High level kasugamycin resistance protein KsgA {Es 90.92
d1cuka278 DNA helicase RuvA subunit, middle domain {Escheric 90.08
d1ixra173 DNA helicase RuvA subunit, middle domain {Thermus 90.0
d2a1ja162 DNA repair endonuclease XPF {Human (Homo sapiens) 89.69
d1b43a1120 Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Pyr 89.41
d1ul1x1140 Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo 88.62
d1zaka231 Microbial and mitochondrial ADK, insert "zinc fing 85.26
d2duya165 Uncharacterized protein TTHA1967 {Thermus thermoph 84.86
d1rxwa1105 Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Arc 84.04
d2edua191 KIF22, C-terminal domain {Human (Homo sapiens) [Ta 83.11
d1a77a1108 Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Met 82.6
d1xo1a1105 T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726] 82.57
d3bzka190 Transcriptional accessory factor Tex {Pseudomonas 82.53
d1vdda_ 199 Recombination protein RecR {Deinococcus radioduran 82.4
d1kfta_56 Excinuclease UvrC C-terminal domain {Escherichia c 82.25
>d2gy9m1 a.156.1.1 (M:1-114) Ribosomal protein S13 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: S13-like H2TH domain
superfamily: S13-like H2TH domain
family: Ribosomal protein S13
domain: Ribosomal protein S13
species: Escherichia coli [TaxId: 562]

Probab=99.95  E-value=1.5e-28  Score=170.09  Aligned_cols=83  Identities=28%  Similarity=0.438  Sum_probs=80.4

Q ss_pred             hhhccccCCCCeehhhhhhhhcccCcchHHHHHHHhCCCCCCcCCCCCHHHHHHHHHHHhCCCCccCCcchhccccccCC
Q 033487           13 LRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKD   92 (118)
Q Consensus        13 vrI~g~~i~~~K~v~~aLt~IyGIG~~~A~~Ic~~lgi~~~~r~~~Ls~~qi~~L~~~i~~~~~~~ip~w~~nr~kd~~t   92 (118)
                      .||+|+|||++|+|.+|||+|||||+++|.+||+.+||||++++++||++|++.|+++|++   |               
T Consensus         1 aRI~g~dip~~K~v~~ALt~I~GIG~~~A~~Ic~~lgid~~~kv~~Lt~~qi~~l~~~i~~---~---------------   62 (114)
T d2gy9m1           1 ARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEGQIDTLRDEVAK---F---------------   62 (114)
T ss_dssp             CCCSSSCCCCSSBHHHHHTTSSSCCHHHHHHHHHHHTCCTTSBTTSCCHHHHHHHHHHHHS---S---------------
T ss_pred             CcccCccCCCCCEEEEEeeeeeCcCHHHHHHHHHHcCCCcccccCcccHHHHHHHHHHHHh---c---------------
Confidence            4899999999999999999999999999999999999999999999999999999999986   6               


Q ss_pred             CccceeehhhHHHHHHHHHHHHHhCC
Q 033487           93 GKYSQVVSNALDMKLRDDLERLKKIR  118 (118)
Q Consensus        93 g~~~h~i~~dL~~~~~~dI~rl~~I~  118 (118)
                           ++++||++.+++||+||++|+
T Consensus        63 -----~i~~~L~~~~~~dI~rl~~I~   83 (114)
T d2gy9m1          63 -----VVEGDLRREISMSIKRLMDLG   83 (114)
T ss_dssp             -----CCSHHHHHHHHHHHHHTTTTT
T ss_pred             -----ccHHHHHHHHHHHHHHHHHhc
Confidence                 799999999999999999985
>d2uubm1 a.156.1.1 (M:2-126) Ribosomal protein S13 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2hkja1 a.156.1.3 (A:229-306) Topoisomerase VI-B subunit middle domain {Archaeon Sulfolobus shibatae [TaxId: 2286]} Back     information, alignment and structure
>d1k3xa1 a.156.1.2 (A:125-213) Endonuclease VIII {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r2za1 a.156.1.2 (A:135-228) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1k82a1 a.156.1.2 (A:129-216) DNA repair protein MutM (Fpg) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tdza1 a.156.1.2 (A:132-219) DNA repair protein MutM (Fpg) {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1ee8a1 a.156.1.2 (A:122-210) DNA repair protein MutM (Fpg) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bgwa1 a.60.2.5 (A:160-229) DNA repair endonuclease XPF {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2fmpa2 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcqa2 a.60.12.1 (A:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdha1 a.156.1.2 (A:132-246) Endonuclease VIII-like 1 (NEIL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmsa3 a.60.12.1 (A:243-302) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a1jb1 a.60.2.5 (B:219-296) DNA excision repair protein ERCC-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i0za2 e.74.1.1 (A:193-361) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1pzna1 a.60.4.1 (A:35-95) DNA repair protein Rad51, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1x2ia1 a.60.2.5 (A:2-69) ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1kfta_ a.60.2.3 (A:) Excinuclease UvrC C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i1qa1 a.60.4.1 (A:5-64) DNA repair protein Rad51, N-terminal domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2gqfa2 e.74.1.1 (A:195-342) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1bvsa2 a.60.2.1 (A:64-134) DNA helicase RuvA subunit, middle domain {Mycobacterium leprae [TaxId: 1769]} Back     information, alignment and structure
>d1ixra1 a.60.2.1 (A:63-135) DNA helicase RuvA subunit, middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2axtu1 a.60.12.2 (U:37-134) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus elongatus [TaxId: 146786]} Back     information, alignment and structure
>d1cuka2 a.60.2.1 (A:65-142) DNA helicase RuvA subunit, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bvsa2 a.60.2.1 (A:64-134) DNA helicase RuvA subunit, middle domain {Mycobacterium leprae [TaxId: 1769]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cuka2 a.60.2.1 (A:65-142) DNA helicase RuvA subunit, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixra1 a.60.2.1 (A:63-135) DNA helicase RuvA subunit, middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a1ja1 a.60.2.5 (A:837-898) DNA repair endonuclease XPF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b43a1 a.60.7.1 (A:220-339) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ul1x1 a.60.7.1 (X:218-357) Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zaka2 g.41.2.1 (A:128-158) Microbial and mitochondrial ADK, insert "zinc finger" domain {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2duya1 a.60.2.7 (A:11-75) Uncharacterized protein TTHA1967 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rxwa1 a.60.7.1 (A:220-324) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2edua1 a.60.2.7 (A:8-98) KIF22, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a77a1 a.60.7.1 (A:209-316) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1xo1a1 a.60.7.1 (A:186-290) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]} Back     information, alignment and structure
>d3bzka1 a.60.2.6 (A:474-563) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vdda_ e.49.1.1 (A:) Recombination protein RecR {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1kfta_ a.60.2.3 (A:) Excinuclease UvrC C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure