Citrus Sinensis ID: 033489
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 118 | ||||||
| 356561967 | 180 | PREDICTED: signal peptidase complex cata | 0.864 | 0.566 | 0.960 | 5e-49 | |
| 449468994 | 180 | PREDICTED: signal peptidase complex cata | 0.864 | 0.566 | 0.941 | 5e-48 | |
| 363808256 | 180 | uncharacterized protein LOC100807064 [Gl | 0.864 | 0.566 | 0.931 | 5e-48 | |
| 225443007 | 180 | PREDICTED: signal peptidase complex cata | 0.864 | 0.566 | 0.931 | 5e-48 | |
| 255637768 | 180 | unknown [Glycine max] | 0.864 | 0.566 | 0.931 | 7e-48 | |
| 317106733 | 180 | JHL06P13.9 [Jatropha curcas] | 0.864 | 0.566 | 0.921 | 1e-47 | |
| 224070829 | 180 | predicted protein [Populus trichocarpa] | 0.864 | 0.566 | 0.911 | 1e-47 | |
| 255553143 | 180 | Microsomal signal peptidase 18 kDa subun | 0.864 | 0.566 | 0.921 | 1e-47 | |
| 224054124 | 180 | predicted protein [Populus trichocarpa] | 0.864 | 0.566 | 0.911 | 3e-47 | |
| 15219044 | 180 | signal peptidase, endoplasmic reticulum- | 0.864 | 0.566 | 0.892 | 6e-47 |
| >gi|356561967|ref|XP_003549247.1| PREDICTED: signal peptidase complex catalytic subunit SEC11C-like [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 197 bits (502), Expect = 5e-49, Method: Compositional matrix adjust.
Identities = 98/102 (96%), Positives = 101/102 (99%)
Query: 1 MGWIGESIESIKSLQIRQVLTQGVSLGMIVTSALIIWKALMCITGSESPVVVVLSGSMEP 60
MGWIGES++SIKSLQIRQVLTQ VSLGMIVTSALIIWKALMCITGSESPVVVVLSGSMEP
Sbjct: 1 MGWIGESVDSIKSLQIRQVLTQAVSLGMIVTSALIIWKALMCITGSESPVVVVLSGSMEP 60
Query: 61 GFKRGDILFLHMSKDPIRAGEIVVFNVDGREIPIVHRVIKVN 102
GFKRGDILFLHMSKDPIRAGEIVVFNVDGREIPIVHRVIKV+
Sbjct: 61 GFKRGDILFLHMSKDPIRAGEIVVFNVDGREIPIVHRVIKVH 102
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449468994|ref|XP_004152206.1| PREDICTED: signal peptidase complex catalytic subunit SEC11C-like [Cucumis sativus] gi|449484166|ref|XP_004156804.1| PREDICTED: signal peptidase complex catalytic subunit SEC11C-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|363808256|ref|NP_001242493.1| uncharacterized protein LOC100807064 [Glycine max] gi|255635143|gb|ACU17928.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225443007|ref|XP_002269449.1| PREDICTED: signal peptidase complex catalytic subunit SEC11C [Vitis vinifera] gi|297743433|emb|CBI36300.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255637768|gb|ACU19206.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|317106733|dbj|BAJ53229.1| JHL06P13.9 [Jatropha curcas] | Back alignment and taxonomy information |
|---|
| >gi|224070829|ref|XP_002303254.1| predicted protein [Populus trichocarpa] gi|222840686|gb|EEE78233.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255553143|ref|XP_002517614.1| Microsomal signal peptidase 18 kDa subunit, putative [Ricinus communis] gi|223543246|gb|EEF44778.1| Microsomal signal peptidase 18 kDa subunit, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224054124|ref|XP_002298104.1| predicted protein [Populus trichocarpa] gi|222845362|gb|EEE82909.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|15219044|ref|NP_175669.1| signal peptidase, endoplasmic reticulum-type [Arabidopsis thaliana] gi|297847646|ref|XP_002891704.1| hypothetical protein ARALYDRAFT_474386 [Arabidopsis lyrata subsp. lyrata] gi|5903045|gb|AAD55604.1|AC008016_14 Similar to gb|AF108945 signal peptidase 18 kDa subunit from Homo sapiens. ESTs gb|H76629, gb|H76949 and gb|H76216 come from this gene [Arabidopsis thaliana] gi|17381152|gb|AAL36388.1| putative signal peptidase subunit [Arabidopsis thaliana] gi|20465737|gb|AAM20337.1| putative signal peptidase subunit [Arabidopsis thaliana] gi|21536563|gb|AAM60895.1| signal peptidase subunit, putative [Arabidopsis thaliana] gi|297337546|gb|EFH67963.1| hypothetical protein ARALYDRAFT_474386 [Arabidopsis lyrata subsp. lyrata] gi|332194707|gb|AEE32828.1| signal peptidase, endoplasmic reticulum-type [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 118 | ||||||
| TAIR|locus:2035139 | 180 | AT1G52600 [Arabidopsis thalian | 0.864 | 0.566 | 0.892 | 1.6e-45 | |
| TAIR|locus:2093202 | 180 | AT3G15710 [Arabidopsis thalian | 0.864 | 0.566 | 0.803 | 6.8e-40 | |
| UNIPROTKB|P67810 | 179 | SEC11A "Signal peptidase compl | 0.805 | 0.530 | 0.625 | 6.4e-28 | |
| UNIPROTKB|P67811 | 179 | SEC11A "Signal peptidase compl | 0.805 | 0.530 | 0.625 | 6.4e-28 | |
| UNIPROTKB|H0YK72 | 164 | SEC11A "Signal peptidase compl | 0.805 | 0.579 | 0.625 | 6.4e-28 | |
| UNIPROTKB|H0YK83 | 185 | SEC11A "Signal peptidase compl | 0.805 | 0.513 | 0.625 | 6.4e-28 | |
| UNIPROTKB|H0YNA5 | 135 | SEC11A "Signal peptidase compl | 0.805 | 0.703 | 0.625 | 6.4e-28 | |
| UNIPROTKB|H0YNG3 | 163 | SEC11A "Signal peptidase compl | 0.805 | 0.582 | 0.625 | 6.4e-28 | |
| UNIPROTKB|P67812 | 179 | SEC11A "Signal peptidase compl | 0.805 | 0.530 | 0.625 | 6.4e-28 | |
| MGI|MGI:1929464 | 179 | Sec11a "SEC11 homolog A (S. ce | 0.805 | 0.530 | 0.625 | 6.4e-28 |
| TAIR|locus:2035139 AT1G52600 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 478 (173.3 bits), Expect = 1.6e-45, P = 1.6e-45
Identities = 91/102 (89%), Positives = 100/102 (98%)
Query: 1 MGWIGESIESIKSLQIRQVLTQGVSLGMIVTSALIIWKALMCITGSESPVVVVLSGSMEP 60
MGWIGE+++SIKS+QIRQ+ TQ +SLGMIVTSALIIWKALMC+TGSESPVVVVLSGSMEP
Sbjct: 1 MGWIGETVDSIKSIQIRQLFTQAISLGMIVTSALIIWKALMCVTGSESPVVVVLSGSMEP 60
Query: 61 GFKRGDILFLHMSKDPIRAGEIVVFNVDGREIPIVHRVIKVN 102
GFKRGDILFLHMSKDPIRAGEIVVFNVDGR+IPIVHRVIKV+
Sbjct: 61 GFKRGDILFLHMSKDPIRAGEIVVFNVDGRDIPIVHRVIKVH 102
|
|
| TAIR|locus:2093202 AT3G15710 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P67810 SEC11A "Signal peptidase complex catalytic subunit SEC11A" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P67811 SEC11A "Signal peptidase complex catalytic subunit SEC11A" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H0YK72 SEC11A "Signal peptidase complex catalytic subunit SEC11A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H0YK83 SEC11A "Signal peptidase complex catalytic subunit SEC11A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H0YNA5 SEC11A "Signal peptidase complex catalytic subunit SEC11A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H0YNG3 SEC11A "Signal peptidase complex catalytic subunit SEC11A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P67812 SEC11A "Signal peptidase complex catalytic subunit SEC11A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1929464 Sec11a "SEC11 homolog A (S. cerevisiae)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00000365001 | SubName- Full=Chromosome chr9 scaffold_104, whole genome shotgun sequence; (180 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00037864001 | • | • | • | 0.613 | |||||||
| GSVIVG00022861001 | • | • | • | • | 0.487 | ||||||
| GSVIVG00019695001 | • | • | 0.460 | ||||||||
| GSVIVG00019911001 | • | • | • | • | 0.450 | ||||||
| GSVIVG00002547001 | • | 0.438 | |||||||||
| GSVIVG00023864001 | • | • | 0.437 | ||||||||
| GSVIVG00000296001 | • | • | 0.422 | ||||||||
| GSVIVG00036059001 | • | 0.416 | |||||||||
| GSVIVG00025575001 | • | 0.413 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 118 | |||
| cd06530 | 85 | cd06530, S26_SPase_I, The S26 Type I signal peptid | 1e-13 | |
| cd06462 | 84 | cd06462, Peptidase_S24_S26, The S24, S26 LexA/sign | 3e-13 | |
| TIGR02228 | 158 | TIGR02228, sigpep_I_arch, signal peptidase I, arch | 2e-12 | |
| pfam00717 | 69 | pfam00717, Peptidase_S24, Peptidase S24-like | 2e-10 | |
| cd06529 | 81 | cd06529, S24_LexA-like, Peptidase S24 LexA-like pr | 4e-04 | |
| COG0681 | 166 | COG0681, LepB, Signal peptidase I [Intracellular t | 0.002 |
| >gnl|CDD|119398 cd06530, S26_SPase_I, The S26 Type I signal peptidase (SPase; LepB; leader peptidase B; leader peptidase I; EC 3 | Back alignment and domain information |
|---|
Score = 60.7 bits (148), Expect = 1e-13
Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 4/57 (7%)
Query: 49 PVVVVLSGSMEPGFKRGDILFLHM---SKDPIRAGEIVVFNVDGR-EIPIVHRVIKV 101
VVV GSMEP + GD++ ++ + G++VVF G PI+ RVI
Sbjct: 1 EPVVVPGGSMEPTLQPGDLVLVNKLSYGFREPKRGDVVVFKSPGDPGKPIIKRVIGY 57
|
4.21.89) family members are essential membrane-bound serine proteases that function to cleave the amino-terminal signal peptide extension from proteins that are translocated across biological membranes. The bacterial signal peptidase I, which is the most intensively studied, has two N-terminal transmembrane segments inserted in the plasma membrane and a hydrophilic, C-terminal catalytic region that is located in the periplasmic space. Although the bacterial signal peptidase I is monomeric, signal peptidases of eukaryotic cells commonly function as oligomeric complexes containing two divergent copies of the catalytic monomer. These are the IMP1 and IMP2 signal peptidases of the mitochondrial inner membrane that remove leader peptides from nuclear- and mitochondrial-encoded proteins. Also, two components of the endoplasmic reticulum signal peptidase in mammals (18-kDa and 21-kDa) belong to this family and they process many proteins that enter the ER for retention or for export to the Golgi apparatus, secretory vesicles, plasma membranes or vacuole. An atypical member of the S26 SPase type I family is the TraF peptidase which has the remarkable activity of producing a cyclic protein of the Pseudomonas pilin system. The type I signal peptidases are unique serine proteases that utilize a serine/lysine catalytic dyad mechanism in place of the classical serine/histidine/aspartic acid catalytic triad mechanism. Length = 85 |
| >gnl|CDD|119396 cd06462, Peptidase_S24_S26, The S24, S26 LexA/signal peptidase superfamily contains LexA-related and type I signal peptidase families | Back alignment and domain information |
|---|
| >gnl|CDD|131283 TIGR02228, sigpep_I_arch, signal peptidase I, archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|216079 pfam00717, Peptidase_S24, Peptidase S24-like | Back alignment and domain information |
|---|
| >gnl|CDD|119397 cd06529, S24_LexA-like, Peptidase S24 LexA-like proteins are involved in the SOS response leading to the repair of single-stranded DNA within the bacterial cell | Back alignment and domain information |
|---|
| >gnl|CDD|223753 COG0681, LepB, Signal peptidase I [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 118 | |||
| PRK10861 | 324 | signal peptidase I; Provisional | 99.81 | |
| KOG3342 | 180 | consensus Signal peptidase I [Intracellular traffi | 99.79 | |
| TIGR02227 | 163 | sigpep_I_bact signal peptidase I, bacterial type. | 99.77 | |
| TIGR02228 | 158 | sigpep_I_arch signal peptidase I, archaeal type. T | 99.75 | |
| PF00717 | 70 | Peptidase_S24: Peptidase S24-like peptidase classi | 99.46 | |
| cd06530 | 85 | S26_SPase_I The S26 Type I signal peptidase (SPase | 99.42 | |
| TIGR02754 | 90 | sod_Ni_protease nickel-type superoxide dismutase m | 99.42 | |
| COG0681 | 166 | LepB Signal peptidase I [Intracellular trafficking | 99.41 | |
| KOG0171 | 176 | consensus Mitochondrial inner membrane protease, s | 99.36 | |
| cd06462 | 84 | Peptidase_S24_S26 The S24, S26 LexA/signal peptida | 99.16 | |
| KOG1568 | 174 | consensus Mitochondrial inner membrane protease, s | 99.07 | |
| cd06529 | 81 | S24_LexA-like Peptidase S24 LexA-like proteins are | 99.02 | |
| COG2932 | 214 | Predicted transcriptional regulator [Transcription | 98.82 | |
| PRK00215 | 205 | LexA repressor; Validated | 98.42 | |
| PRK10276 | 139 | DNA polymerase V subunit UmuD; Provisional | 98.41 | |
| PRK13838 | 176 | conjugal transfer pilin processing protease TraF; | 98.35 | |
| PRK12423 | 202 | LexA repressor; Provisional | 98.3 | |
| TIGR02771 | 171 | TraF_Ti conjugative transfer signal peptidase TraF | 98.23 | |
| TIGR00498 | 199 | lexA SOS regulatory protein LexA. LexA acts as a h | 98.2 | |
| PRK13884 | 178 | conjugal transfer peptidase TraF; Provisional | 97.7 | |
| COG1974 | 201 | LexA SOS-response transcriptional repressors (RecA | 97.69 | |
| PF10502 | 138 | Peptidase_S26: Signal peptidase, peptidase S26 ; I | 96.06 | |
| COG0361 | 75 | InfA Translation initiation factor 1 (IF-1) [Trans | 87.65 | |
| TIGR00008 | 68 | infA translation initiation factor IF-1. This fami | 87.18 | |
| PF01176 | 65 | eIF-1a: Translation initiation factor 1A / IF-1; I | 83.53 | |
| cd05793 | 77 | S1_IF1A S1_IF1A: Translation initiation factor IF1 | 81.22 |
| >PRK10861 signal peptidase I; Provisional | Back alignment and domain information |
|---|
Probab=99.81 E-value=1.5e-19 Score=144.45 Aligned_cols=90 Identities=26% Similarity=0.328 Sum_probs=76.6
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHhhCCCCCeEEEeCCCccccCcCCCEEEEecc---------------CCCCCCCcE
Q 033489 18 QVLTQGVSLGMIVTSALIIWKALMCITGSESPVVVVLSGSMEPGFKRGDILFLHMS---------------KDPIRAGEI 82 (118)
Q Consensus 18 ~i~~~i~~i~~~~~i~~li~~~~~~~~g~~~~~~~V~g~SM~Ptl~~GD~vlv~k~---------------~~~~~~GDI 82 (118)
.+++++..++.+++++++++.|++. ++.|+|+||+|||++||.++++|. ..+|+||||
T Consensus 59 ~~~~~~~~~~~~l~i~~~ir~fv~~-------~~~Ips~SM~PTL~~GD~IlVnK~~yg~~~p~~~~~~~~~~~p~RGDI 131 (324)
T PRK10861 59 GWLETGASVFPVLAIVLIVRSFIYE-------PFQIPSGSMMPTLLIGDFILVEKFAYGIKDPITQTTLIETGHPKRGDI 131 (324)
T ss_pred hHHHHHHHHHHHHhHHHHHHhhEEE-------EEEECCCcCcCcccCCCEEEEEEeecCccCccccccccccCCCCCCCE
Confidence 3678888888888889999999887 599999999999999999999992 146899999
Q ss_pred EEEEeCCC-CcCEEEEEEEECCCceEEE----EEEee
Q 033489 83 VVFNVDGR-EIPIVHRVIKVNILLTLFF----ELTIQ 114 (118)
Q Consensus 83 Vvf~~~~~-~~~~ikRVI~~~g~~~~~~----~~~~~ 114 (118)
|+|+.|.+ +..+||||||+|||..++- +|.|.
T Consensus 132 VVF~~P~~~~~~yIKRVIGlPGD~I~~~~~~~~l~iN 168 (324)
T PRK10861 132 VVFKYPEDPKLDYIKRVVGLPGDKVTYDPVSKEVTIQ 168 (324)
T ss_pred EEEecCCCCCCcEEEEeeecCCcEEEEEeCCCEEEEc
Confidence 99998764 4579999999999999884 55554
|
|
| >KOG3342 consensus Signal peptidase I [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR02227 sigpep_I_bact signal peptidase I, bacterial type | Back alignment and domain information |
|---|
| >TIGR02228 sigpep_I_arch signal peptidase I, archaeal type | Back alignment and domain information |
|---|
| >PF00717 Peptidase_S24: Peptidase S24-like peptidase classification | Back alignment and domain information |
|---|
| >cd06530 S26_SPase_I The S26 Type I signal peptidase (SPase; LepB; leader peptidase B; leader peptidase I; EC 3 | Back alignment and domain information |
|---|
| >TIGR02754 sod_Ni_protease nickel-type superoxide dismutase maturation protease | Back alignment and domain information |
|---|
| >COG0681 LepB Signal peptidase I [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG0171 consensus Mitochondrial inner membrane protease, subunit IMP1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd06462 Peptidase_S24_S26 The S24, S26 LexA/signal peptidase superfamily contains LexA-related and type I signal peptidase families | Back alignment and domain information |
|---|
| >KOG1568 consensus Mitochondrial inner membrane protease, subunit IMP2 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd06529 S24_LexA-like Peptidase S24 LexA-like proteins are involved in the SOS response leading to the repair of single-stranded DNA within the bacterial cell | Back alignment and domain information |
|---|
| >COG2932 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PRK00215 LexA repressor; Validated | Back alignment and domain information |
|---|
| >PRK10276 DNA polymerase V subunit UmuD; Provisional | Back alignment and domain information |
|---|
| >PRK13838 conjugal transfer pilin processing protease TraF; Provisional | Back alignment and domain information |
|---|
| >PRK12423 LexA repressor; Provisional | Back alignment and domain information |
|---|
| >TIGR02771 TraF_Ti conjugative transfer signal peptidase TraF | Back alignment and domain information |
|---|
| >TIGR00498 lexA SOS regulatory protein LexA | Back alignment and domain information |
|---|
| >PRK13884 conjugal transfer peptidase TraF; Provisional | Back alignment and domain information |
|---|
| >COG1974 LexA SOS-response transcriptional repressors (RecA-mediated autopeptidases) [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF10502 Peptidase_S26: Signal peptidase, peptidase S26 ; InterPro: IPR019533 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >COG0361 InfA Translation initiation factor 1 (IF-1) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00008 infA translation initiation factor IF-1 | Back alignment and domain information |
|---|
| >PF01176 eIF-1a: Translation initiation factor 1A / IF-1; InterPro: IPR006196 The S1 domain of around 70 amino acids, originally identified in ribosomal protein S1, is found in a large number of RNA-associated proteins | Back alignment and domain information |
|---|
| >cd05793 S1_IF1A S1_IF1A: Translation initiation factor IF1A, also referred to as eIF1A in eukaryotes and aIF1A in archaea, S1-like RNA-binding domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 118 | |||
| 1b12_A | 248 | Signal peptidase I; serine proteinase, serine-depe | 99.62 | |
| 1kca_A | 109 | Repressor protein CI; gene regulation, DNA-binding | 99.04 | |
| 1umu_A | 116 | UMUD'; induced mutagenesis, SOS mutagenesis, DNA r | 99.04 | |
| 2hnf_A | 133 | Repressor protein CI101-229DM-K192A; viral protein | 98.93 | |
| 1jhf_A | 202 | LEXA repressor; LEXA SOS repressor, hydrolase; 1.8 | 98.76 | |
| 3k2z_A | 196 | LEXA repressor; winged helix-turn-helix, SOS syste | 98.6 | |
| 3bdn_A | 236 | Lambda repressor; repressor, allostery; HET: DNA; | 98.52 | |
| 2fjr_A | 189 | Repressor protein CI; genetic switch, regulation, | 95.21 |
| >1b12_A Signal peptidase I; serine proteinase, serine-dependant hydrolase, signal peptid processing, protein translocation; HET: 1PN; 1.95A {Escherichia coli} SCOP: b.87.1.2 PDB: 3s04_A* 1t7d_A* 3iiq_A* 1kn9_A* | Back alignment and structure |
|---|
Probab=99.62 E-value=1.8e-16 Score=120.61 Aligned_cols=59 Identities=22% Similarity=0.345 Sum_probs=51.6
Q ss_pred eEEEeCCCccccCcCCCEEEEecc---------------CCCCCCCcEEEEEeCCC-CcCEEEEEEEECCCceEE
Q 033489 50 VVVVLSGSMEPGFKRGDILFLHMS---------------KDPIRAGEIVVFNVDGR-EIPIVHRVIKVNILLTLF 108 (118)
Q Consensus 50 ~~~V~g~SM~Ptl~~GD~vlv~k~---------------~~~~~~GDIVvf~~~~~-~~~~ikRVI~~~g~~~~~ 108 (118)
++.|+|+||+|||++||+|+++|. ..++++||||+|+.|.+ +..++|||+|+|||...+
T Consensus 8 ~~~v~g~SM~Ptl~~GD~vlv~k~~yg~r~P~~~~~l~~~~~~~rGDIvvf~~p~~~~~~~iKRViglpGD~v~i 82 (248)
T 1b12_A 8 PFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKVTY 82 (248)
T ss_dssp EEECCSCTTTTTSCTTEEEEEEESEEEEECGGGSCEEEEECCCCTTCEEEEECTTCTTSEEEEEEEECTTCEEEE
T ss_pred EEEeccccccccccCCCEEEEEecccCcccccccccccccCCCCCCcEEEEEeCCCCCceEEEEEEeeCCCEEEE
Confidence 699999999999999999999983 25799999999998754 457999999999987654
|
| >1kca_A Repressor protein CI; gene regulation, DNA-binding, lambda repressor, protein oligomerization, DNA-looping; 2.91A {Enterobacteria phage lambda} SCOP: b.87.1.1 | Back alignment and structure |
|---|
| >1umu_A UMUD'; induced mutagenesis, SOS mutagenesis, DNA repair, beta- lactamase cleavage reaction, LEXA repressor, lambda CI; 2.50A {Escherichia coli} SCOP: b.87.1.1 PDB: 1i4v_A 1ay9_A | Back alignment and structure |
|---|
| >2hnf_A Repressor protein CI101-229DM-K192A; viral protein; 1.80A {Escherichia coli} PDB: 2ho0_A 1f39_A | Back alignment and structure |
|---|
| >1jhf_A LEXA repressor; LEXA SOS repressor, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.2 b.87.1.1 PDB: 1jhh_A 3jso_A* 3jsp_A* 3k3r_E* 1jhc_A 1jhe_A 1lea_A 1leb_A | Back alignment and structure |
|---|
| >3k2z_A LEXA repressor; winged helix-turn-helix, SOS system, autoca cleavage, DNA damage, DNA repair, DNA replication, DNA-BIND hydrolase; 1.37A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3bdn_A Lambda repressor; repressor, allostery; HET: DNA; 3.91A {Enterobacteria phage lambda} | Back alignment and structure |
|---|
| >2fjr_A Repressor protein CI; genetic switch, regulation, cooperativity, transcription regulator; 1.95A {Enterobacteria phage 186} PDB: 2fkd_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 118 | |||
| d1b12a_ | 247 | Type 1 signal peptidase {Escherichia coli [TaxId: | 99.56 | |
| d1jhfa2 | 126 | LexA C-terminal domain {Escherichia coli [TaxId: 5 | 98.75 | |
| d1f39a_ | 101 | lambda repressor C-terminal domain {Bacteriophage | 98.75 | |
| d1umua_ | 105 | UmuD' {Escherichia coli [TaxId: 562]} | 98.5 | |
| d1hr0w_ | 71 | Translational initiation factor 1, IF1 {Escherichi | 84.85 |
| >d1b12a_ b.87.1.2 (A:) Type 1 signal peptidase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: LexA/Signal peptidase superfamily: LexA/Signal peptidase family: Type 1 signal peptidase domain: Type 1 signal peptidase species: Escherichia coli [TaxId: 562]
Probab=99.56 E-value=2.2e-15 Score=111.43 Aligned_cols=61 Identities=21% Similarity=0.306 Sum_probs=52.3
Q ss_pred CeEEEeCCCccccCcCCCEEEEecc---------------CCCCCCCcEEEEEeCCC-CcCEEEEEEEECCCceEEE
Q 033489 49 PVVVVLSGSMEPGFKRGDILFLHMS---------------KDPIRAGEIVVFNVDGR-EIPIVHRVIKVNILLTLFF 109 (118)
Q Consensus 49 ~~~~V~g~SM~Ptl~~GD~vlv~k~---------------~~~~~~GDIVvf~~~~~-~~~~ikRVI~~~g~~~~~~ 109 (118)
+++.|+|+||+|||+.||+++|+|. ...+++||+|+|+.+.+ ...++|||+|+|||...+.
T Consensus 6 ~~f~IPs~SMePTL~~GD~l~V~K~~Yg~r~P~~~~~~~~~~~~~rgdivvf~~p~~~~~~~ikR~ig~pGD~i~~~ 82 (247)
T d1b12a_ 6 EPFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKVTYD 82 (247)
T ss_dssp EEEECCSCTTTTTSCTTEEEEEEESEEEEECGGGSCEEEEECCCCTTCEEEEECTTCTTSEEEEEEEECTTCEEEEE
T ss_pred EEEEeCcccccchhccCCEEEEEccccCccCCccCcccccccCcccCceeeecCCCCCCccccccccCCCCCeEEEe
Confidence 3799999999999999999999982 13579999999998765 3469999999999987754
|
| >d1jhfa2 b.87.1.1 (A:73-198) LexA C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f39a_ b.87.1.1 (A:) lambda repressor C-terminal domain {Bacteriophage lambda [TaxId: 10710]} | Back information, alignment and structure |
|---|
| >d1umua_ b.87.1.1 (A:) UmuD' {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hr0w_ b.40.4.5 (W:) Translational initiation factor 1, IF1 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|