Citrus Sinensis ID: 033504


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MARSLSNLIFKGIASYPSARSSRIVSGSLYHNGMKYSTDVPNDPDTHEDFRPTSKVDASGLSLKEVVEQDVKENPVMLYMKGVPEFPQCGFSSLAVRVLGAYSKFSYFCSFSIILHAC
cHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccEEEEEcccccccccccHHHHHHHHHHccccccccEEccccccc
cHHHHHHHHHHHHHHcccccccccccHcHHccccccccEcccccccccccccccccccccHHHHHHHHHHHHcccEEEEEccccccccccHHHHHHHHHHHHcHHHHHcHHHHHHHcc
MARSLSNLIFKGiasypsarssrivsgslyhngmkystdvpndpdthedfrptskvdasglslKEVVEqdvkenpvmlymkgvpefpqcgfssLAVRVLGAYSKFSYFCSFSIILHAC
MARSLSNLIFKgiasypsarssRIVSGSLYHNGMKYSTDVPNDPDTHEDFRPtskvdasglslkEVVEQDVKENPVMLYMKGVPEFPQCGFSSLAVRVLGAYSKFSYFCSFSIILHAC
MARSLSNLIFKGIASYPSARSSRIVSGSLYHNGMKYSTDVPNDPDTHEDFRPTSKVDASGLSLKEVVEQDVKENPVMLYMKGVPEFPQCGFSSLAVRVLGAYSKFSYFCSFSIILHAC
*******LIFKGIA********************************************************VKENPVMLYMKGVPEFPQCGFSSLAVRVLGAYSKFSYFCSFSIILH**
*****************************************************************VVEQDVKENPVMLYMKGVPEFPQCGFSSLAVRVLGAYSKFSYFCSFSIILHAC
MARSLSNLIFKGIASYPSARSSRIVSGSLYHNGMKYSTDVPNDPDTHEDFRPTSKVDASGLSLKEVVEQDVKENPVMLYMKGVPEFPQCGFSSLAVRVLGAYSKFSYFCSFSIILHAC
***********************************************EDFRPTS***ASGLSLKEVVEQDVKENPVMLYMKGVPEFPQCGFSSLAVRVLGAYSKFSYFCSFSIILHAC
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiii
oooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARSLSNLIFKGIASYPSARSSRIVSGSLYHNGMKYSTDVPNDPDTHEDFRPTSKVDASGLSLKEVVEQDVKENPVMLYMKGVPEFPQCGFSSLAVRVLGAYSKFSYFCSFSIILHAC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query118 2.2.26 [Sep-21-2011]
Q8LBK6169 Monothiol glutaredoxin-S1 yes no 0.872 0.609 0.628 1e-30
Q0JM76185 Monothiol glutaredoxin-S4 yes no 0.847 0.540 0.427 2e-18
Q0JQ97185 Monothiol glutaredoxin-S1 no no 0.830 0.529 0.436 4e-18
Q555C8143 Monothiol glutaredoxin-5, yes no 0.406 0.335 0.5 3e-07
P0AC72115 Glutaredoxin-4 OS=Shigell yes no 0.364 0.373 0.477 3e-06
P0AC69115 Glutaredoxin-4 OS=Escheri N/A no 0.364 0.373 0.477 3e-06
P0AC70115 Glutaredoxin-4 OS=Escheri yes no 0.364 0.373 0.477 3e-06
P0AC71115 Glutaredoxin-4 OS=Escheri N/A no 0.364 0.373 0.477 3e-06
Q6YFE4143 Monothiol glutaredoxin-5, N/A no 0.313 0.258 0.513 4e-06
O30824107 Glutaredoxin-4 OS=Haemoph yes no 0.279 0.308 0.545 1e-05
>sp|Q8LBK6|GRS15_ARATH Monothiol glutaredoxin-S15, mitochondrial OS=Arabidopsis thaliana GN=GRXS15 PE=1 SV=2 Back     alignment and function desciption
 Score =  131 bits (330), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 66/105 (62%), Positives = 83/105 (79%), Gaps = 2/105 (1%)

Query: 1   MARSLSNLIFKGIASYPSARSSRIVSGSLYHNGM-KYSTDVPNDPDTHEDFRPTSKVDA- 58
           MA SLS+ + KGIA+  + RSSR+ S S+Y NGM ++S+ VP+D DTH+DF+PT KV   
Sbjct: 1   MAASLSSRLIKGIANLKAVRSSRLTSASVYQNGMMRFSSTVPSDSDTHDDFKPTQKVPPD 60

Query: 59  SGLSLKEVVEQDVKENPVMLYMKGVPEFPQCGFSSLAVRVLGAYS 103
           S  SLK++VE DVK+NPVM+YMKGVPE PQCGFSSLAVRVL  Y+
Sbjct: 61  STDSLKDIVENDVKDNPVMIYMKGVPESPQCGFSSLAVRVLQQYN 105




May only reduce GSH-thiol disulfides, but not protein disulfides.
Arabidopsis thaliana (taxid: 3702)
>sp|Q0JM76|GRXS4_ORYSJ Monothiol glutaredoxin-S4, mitochondrial OS=Oryza sativa subsp. japonica GN=GRXS4 PE=2 SV=1 Back     alignment and function description
>sp|Q0JQ97|GRXS1_ORYSJ Monothiol glutaredoxin-S1, mitochondrial OS=Oryza sativa subsp. japonica GN=GRXS1 PE=2 SV=2 Back     alignment and function description
>sp|Q555C8|GLRX5_DICDI Monothiol glutaredoxin-5, mitochondrial OS=Dictyostelium discoideum GN=grx5 PE=3 SV=1 Back     alignment and function description
>sp|P0AC72|GLRX4_SHIFL Glutaredoxin-4 OS=Shigella flexneri GN=grxD PE=3 SV=1 Back     alignment and function description
>sp|P0AC69|GLRX4_ECOLI Glutaredoxin-4 OS=Escherichia coli (strain K12) GN=grxD PE=1 SV=1 Back     alignment and function description
>sp|P0AC70|GLRX4_ECOL6 Glutaredoxin-4 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=grxD PE=3 SV=1 Back     alignment and function description
>sp|P0AC71|GLRX4_ECO57 Glutaredoxin-4 OS=Escherichia coli O157:H7 GN=grxD PE=3 SV=1 Back     alignment and function description
>sp|Q6YFE4|GLRX5_LACKL Monothiol glutaredoxin-5, mitochondrial OS=Lachancea kluyveri GN=GRX5 PE=3 SV=1 Back     alignment and function description
>sp|O30824|GLRX4_HAEDU Glutaredoxin-4 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=grxD PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query118
255553075169 Monothiol glutaredoxin-4, putative [Rici 0.872 0.609 0.699 1e-37
225442841170 PREDICTED: monothiol glutaredoxin-S15, m 0.872 0.605 0.689 1e-37
449469010171 PREDICTED: monothiol glutaredoxin-S15, m 0.872 0.602 0.673 3e-36
147814938 409 hypothetical protein VITISV_033251 [Viti 0.872 0.251 0.601 2e-34
388494312163 unknown [Lotus japonicus] 0.830 0.601 0.660 6e-31
317106758148 JHL25H03.16 [Jatropha curcas] 0.669 0.533 0.721 3e-29
18400858169 monothiol glutaredoxin-S15 [Arabidopsis 0.872 0.609 0.628 4e-29
297834440169 glutaredoxin family protein [Arabidopsis 0.872 0.609 0.619 4e-29
21592763169 unknown [Arabidopsis thaliana] 0.872 0.609 0.619 5e-29
357455115158 Monothiol glutaredoxin-S15 [Medicago tru 0.796 0.594 0.591 2e-27
>gi|255553075|ref|XP_002517580.1| Monothiol glutaredoxin-4, putative [Ricinus communis] gi|223543212|gb|EEF44744.1| Monothiol glutaredoxin-4, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  160 bits (404), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 72/103 (69%), Positives = 89/103 (86%)

Query: 1   MARSLSNLIFKGIASYPSARSSRIVSGSLYHNGMKYSTDVPNDPDTHEDFRPTSKVDASG 60
           MA++LSN++ K IA   +ARSSR+VSGS  HNGM+YST VP DPDTHEDF+P +K++ SG
Sbjct: 1   MAKTLSNIVLKSIAGLSAARSSRLVSGSYCHNGMRYSTTVPKDPDTHEDFQPNNKLENSG 60

Query: 61  LSLKEVVEQDVKENPVMLYMKGVPEFPQCGFSSLAVRVLGAYS 103
           LSLK+VVEQDVK+NPVM+YMKGVP+ PQCGFS+LAVRVL  Y+
Sbjct: 61  LSLKDVVEQDVKDNPVMIYMKGVPDLPQCGFSALAVRVLKQYN 103




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225442841|ref|XP_002285351.1| PREDICTED: monothiol glutaredoxin-S15, mitochondrial isoform 1 [Vitis vinifera] gi|297743395|emb|CBI36262.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449469010|ref|XP_004152214.1| PREDICTED: monothiol glutaredoxin-S15, mitochondrial-like [Cucumis sativus] gi|449484186|ref|XP_004156810.1| PREDICTED: monothiol glutaredoxin-S15, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|147814938|emb|CAN74745.1| hypothetical protein VITISV_033251 [Vitis vinifera] Back     alignment and taxonomy information
>gi|388494312|gb|AFK35222.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|317106758|dbj|BAJ53252.1| JHL25H03.16 [Jatropha curcas] Back     alignment and taxonomy information
>gi|18400858|ref|NP_566522.1| monothiol glutaredoxin-S15 [Arabidopsis thaliana] gi|79313249|ref|NP_001030704.1| monothiol glutaredoxin-S15 [Arabidopsis thaliana] gi|119370633|sp|Q8LBK6.2|GRS15_ARATH RecName: Full=Monothiol glutaredoxin-S15, mitochondrial; Short=AtGrxS15; Flags: Precursor gi|11994338|dbj|BAB02297.1| unnamed protein product [Arabidopsis thaliana] gi|30102572|gb|AAP21204.1| At3g15660 [Arabidopsis thaliana] gi|110743466|dbj|BAE99619.1| hypothetical protein [Arabidopsis thaliana] gi|222424054|dbj|BAH19988.1| AT3G15660 [Arabidopsis thaliana] gi|332642189|gb|AEE75710.1| monothiol glutaredoxin-S15 [Arabidopsis thaliana] gi|332642190|gb|AEE75711.1| monothiol glutaredoxin-S15 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297834440|ref|XP_002885102.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata] gi|297330942|gb|EFH61361.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|21592763|gb|AAM64712.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357455115|ref|XP_003597838.1| Monothiol glutaredoxin-S15 [Medicago truncatula] gi|355486886|gb|AES68089.1| Monothiol glutaredoxin-S15 [Medicago truncatula] gi|388510724|gb|AFK43428.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query118
TAIR|locus:2093297169 GRX4 "glutaredoxin 4" [Arabido 0.872 0.609 0.619 7.9e-30
UNIPROTKB|Q83DV999 CBU_0583 "Glutaredoxin" [Coxie 0.440 0.525 0.462 1.6e-08
TIGR_CMR|CBU_058399 CBU_0583 "glutaredoxin-related 0.440 0.525 0.462 1.6e-08
DICTYBASE|DDB_G0274657143 DDB_G0274657 "glutaredoxin-rel 0.406 0.335 0.5 3.3e-08
UNIPROTKB|Q606E0110 MCA2078 "Glutaredoxin" [Methyl 0.296 0.318 0.571 8.7e-08
CGD|CAL0004286175 orf19.2782 [Candida albicans ( 0.322 0.217 0.526 1.1e-07
UNIPROTKB|P0AC69115 grxD "glutaredoxin 4" [Escheri 0.364 0.373 0.477 1.4e-07
UNIPROTKB|Q60C52110 MCA0259 "Glutaredoxin" [Methyl 0.389 0.418 0.468 1.8e-07
UNIPROTKB|Q9KQF4110 VC_2044 "Glutaredoxin" [Vibrio 0.347 0.372 0.523 1.8e-07
TIGR_CMR|VC_2044110 VC_2044 "conserved hypothetica 0.347 0.372 0.523 1.8e-07
TAIR|locus:2093297 GRX4 "glutaredoxin 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 330 (121.2 bits), Expect = 7.9e-30, P = 7.9e-30
 Identities = 65/105 (61%), Positives = 82/105 (78%)

Query:     1 MARSLSNLIFKGIASYPSARSSRIVSGSLYHNGM-KYSTDVPNDPDTHEDFRPTSKVDAS 59
             MA SLS+ + KGIA+  + RSSR+ S S+Y NGM ++S+ VP+D DTH+DF+PT KV   
Sbjct:     1 MAASLSSRLIKGIANLKAVRSSRLTSASVYQNGMMRFSSTVPSDSDTHDDFKPTQKVPPD 60

Query:    60 GL-SLKEVVEQDVKENPVMLYMKGVPEFPQCGFSSLAVRVLGAYS 103
                SLK++VE DVK+NPVM+YMKGVPE PQCGFSSLAVRVL  Y+
Sbjct:    61 STDSLKDIVENDVKDNPVMIYMKGVPESPQCGFSSLAVRVLQQYN 105




GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0015035 "protein disulfide oxidoreductase activity" evidence=IEA
GO:0045454 "cell redox homeostasis" evidence=IEA
GO:0046872 "metal ion binding" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0048653 "anther development" evidence=RCA
UNIPROTKB|Q83DV9 CBU_0583 "Glutaredoxin" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_0583 CBU_0583 "glutaredoxin-related protein" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0274657 DDB_G0274657 "glutaredoxin-related family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q606E0 MCA2078 "Glutaredoxin" [Methylococcus capsulatus str. Bath (taxid:243233)] Back     alignment and assigned GO terms
CGD|CAL0004286 orf19.2782 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|P0AC69 grxD "glutaredoxin 4" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|Q60C52 MCA0259 "Glutaredoxin" [Methylococcus capsulatus str. Bath (taxid:243233)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KQF4 VC_2044 "Glutaredoxin" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_2044 VC_2044 "conserved hypothetical protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8LBK6GRS15_ARATHNo assigned EC number0.62850.87280.6094yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00034560001
SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (170 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00020703001
SubName- Full=Putative uncharacterized protein (Chromosome chr14 scaffold_21, whole genome shot [...] (114 aa)
      0.470
GSVIVG00034899001
SubName- Full=Chromosome chr4 scaffold_73, whole genome shotgun sequence; (93 aa)
      0.458

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query118
TIGR0036597 TIGR00365, TIGR00365, monothiol glutaredoxin, Grx4 4e-17
cd0302890 cd03028, GRX_PICOT_like, Glutaredoxin (GRX) family 7e-16
COG0278105 COG0278, COG0278, Glutaredoxin-related protein [Po 1e-15
PRK10824115 PRK10824, PRK10824, glutaredoxin-4; Provisional 1e-11
PTZ00062204 PTZ00062, PTZ00062, glutaredoxin; Provisional 1e-04
>gnl|CDD|188046 TIGR00365, TIGR00365, monothiol glutaredoxin, Grx4 family Back     alignment and domain information
 Score = 70.2 bits (173), Expect = 4e-17
 Identities = 24/46 (52%), Positives = 34/46 (73%), Gaps = 1/46 (2%)

Query: 64  KEVVEQDVKENPVMLYMKGVPEFPQCGFSSLAVRVLGAYS-KFSYF 108
            E +++ + ENPV+LYMKG P+FPQCGFS+ AV++L A    F+Y 
Sbjct: 2   IERIKEQIAENPVVLYMKGTPQFPQCGFSARAVQILNACGVPFAYV 47


The gene for the member of this glutaredoxin family in E. coli, originally designated ydhD, is now designated grxD. Its protein, Grx4, is a monothiol glutaredoxin similar to Grx5 of yeast, which is involved in iron-sulfur cluster formation [Energy metabolism, Electron transport]. Length = 97

>gnl|CDD|239326 cd03028, GRX_PICOT_like, Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>gnl|CDD|223355 COG0278, COG0278, Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|182759 PRK10824, PRK10824, glutaredoxin-4; Provisional Back     alignment and domain information
>gnl|CDD|240250 PTZ00062, PTZ00062, glutaredoxin; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 118
COG0278105 Glutaredoxin-related protein [Posttranslational mo 99.96
KOG0911227 consensus Glutaredoxin-related protein [Posttransl 99.91
COG0278105 Glutaredoxin-related protein [Posttranslational mo 99.82
KOG0911227 consensus Glutaredoxin-related protein [Posttransl 99.68
PRK10824115 glutaredoxin-4; Provisional 99.68
PTZ00062204 glutaredoxin; Provisional 99.54
PRK10824115 glutaredoxin-4; Provisional 99.45
PTZ00062204 glutaredoxin; Provisional 99.38
TIGR0036597 monothiol glutaredoxin, Grx4 family. The gene for 99.24
TIGR0036597 monothiol glutaredoxin, Grx4 family. The gene for 99.17
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte 99.14
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte 99.07
TIGR0218999 GlrX-like_plant Glutaredoxin-like family. This fam 98.28
TIGR0218999 GlrX-like_plant Glutaredoxin-like family. This fam 97.7
PF0046260 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl 97.66
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg 97.66
PHA03050108 glutaredoxin; Provisional 97.46
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of 97.43
TIGR0218179 GRX_bact Glutaredoxin, GrxC family. This family of 97.38
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 97.34
PRK1063883 glutaredoxin 3; Provisional 97.22
TIGR0219079 GlrX-dom Glutaredoxin-family domain. This C-termin 97.02
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb 96.86
PHA03050108 glutaredoxin; Provisional 96.63
cd0341982 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h 96.55
TIGR0219472 GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red 96.48
cd03036111 ArsC_like Arsenate Reductase (ArsC) family, unknow 96.38
PRK01655131 spxA transcriptional regulator Spx; Reviewed 96.01
PRK1032981 glutaredoxin-like protein; Provisional 95.77
TIGR0219079 GlrX-dom Glutaredoxin-family domain. This C-termin 95.77
cd03032115 ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub 95.76
cd02977105 ArsC_family Arsenate Reductase (ArsC) family; comp 95.7
TIGR01617117 arsC_related transcriptional regulator, Spx/MgsR f 95.49
cd03035105 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s 95.46
cd03031147 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d 95.45
PRK1120085 grxA glutaredoxin 1; Provisional 95.42
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg 95.12
TIGR0218084 GRX_euk Glutaredoxin. This model represents eukary 95.1
PF0046260 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl 95.06
PRK12559131 transcriptional regulator Spx; Provisional 95.05
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 95.05
TIGR0219674 GlrX_YruB Glutaredoxin-like protein, YruB-family. 95.04
cd03033113 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD p 94.97
TIGR01616126 nitro_assoc nitrogenase-associated protein. This m 94.84
PRK13344132 spxA transcriptional regulator Spx; Reviewed 94.84
PRK10026141 arsenate reductase; Provisional 94.79
COG1393117 ArsC Arsenate reductase and related proteins, glut 94.76
KOG1752104 consensus Glutaredoxin and related proteins [Postt 94.74
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of 94.67
cd0303092 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 94.59
COG069580 GrxC Glutaredoxin and related proteins [Posttransl 94.35
PRK10853118 putative reductase; Provisional 94.02
cd0341982 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h 94.0
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb 93.86
PRK1063883 glutaredoxin 3; Provisional 93.83
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small m 93.66
cd03034112 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC s 93.63
cd03036111 ArsC_like Arsenate Reductase (ArsC) family, unknow 92.86
TIGR0220077 GlrX_actino Glutaredoxin-like protein. This family 92.74
TIGR00014114 arsC arsenate reductase (glutaredoxin). composed o 92.73
TIGR0218386 GRXA Glutaredoxin, GrxA family. This model include 92.49
TIGR0218179 GRX_bact Glutaredoxin, GrxC family. This family of 92.35
PF0490899 SH3BGR: SH3-binding, glutamic acid-rich protein; I 91.9
cd03032115 ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub 91.71
KOG1752104 consensus Glutaredoxin and related proteins [Postt 91.69
cd02977105 ArsC_family Arsenate Reductase (ArsC) family; comp 91.56
PF03960110 ArsC: ArsC family; InterPro: IPR006660 Several bac 91.45
cd0304177 GST_N_2GST_N GST_N family, 2 repeats of the N-term 90.98
cd03035105 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s 90.87
TIGR0219472 GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red 90.67
cd0306191 GST_N_CLIC GST_N family, Chloride Intracellular Ch 90.42
cd0057071 GST_N_family Glutathione S-transferase (GST) famil 89.2
PRK1032981 glutaredoxin-like protein; Provisional 88.66
PRK12759 410 bifunctional gluaredoxin/ribonucleoside-diphosphat 88.12
TIGR0218084 GRX_euk Glutaredoxin. This model represents eukary 86.84
TIGR01616126 nitro_assoc nitrogenase-associated protein. This m 86.41
cd03033113 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD p 86.15
PRK10026141 arsenate reductase; Provisional 84.88
COG1393117 ArsC Arsenate reductase and related proteins, glut 84.01
cd0304574 GST_N_Delta_Epsilon GST_N family, Class Delta and 83.37
cd03034112 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC s 83.28
PRK1120085 grxA glutaredoxin 1; Provisional 82.75
cd0304077 GST_N_mPGES2 GST_N family; microsomal Prostaglandi 82.62
cd0306071 GST_N_Omega_like GST_N family, Omega-like subfamil 81.99
COG069580 GrxC Glutaredoxin and related proteins [Posttransl 81.66
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small m 81.11
TIGR0220077 GlrX_actino Glutaredoxin-like protein. This family 81.03
TIGR0219674 GlrX_YruB Glutaredoxin-like protein, YruB-family. 80.45
>COG0278 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.96  E-value=6e-31  Score=182.47  Aligned_cols=85  Identities=21%  Similarity=0.224  Sum_probs=76.5

Q ss_pred             eeEeeecCCCCCCCCchHHHHHHHHHcC-CCCcc-CCCCCcccccccCCCcccCCChhhHHHHHH-HHhhcCCeeeeecC
Q 033504            6 SNLIFKGIASYPSARSSRIVSGSLYHNG-MKYST-DVPNDPDTHEDFRPTSKVDASGLSLKEVVE-QDVKENPVMLYMKG   82 (118)
Q Consensus         6 ~~lfmKG~~~~P~CgfS~~~v~~l~~~~-~~~~~-dVl~d~d~r~dlK~ys~wpT~p~~l~~~Ik-~li~~~~vvlfmKG   82 (118)
                      +||||||||++|+||||++++++|..+| ++|.+ |||+|+++|+++|.||+|||+| ++  .|+ ++|++++|+.-|--
T Consensus        17 VvLFMKGtp~~P~CGFS~~~vqiL~~~g~v~~~~vnVL~d~eiR~~lk~~s~WPT~P-QL--yi~GEfvGG~DIv~Em~q   93 (105)
T COG0278          17 VVLFMKGTPEFPQCGFSAQAVQILSACGVVDFAYVDVLQDPEIRQGLKEYSNWPTFP-QL--YVNGEFVGGCDIVREMYQ   93 (105)
T ss_pred             eEEEecCCCCCCCCCccHHHHHHHHHcCCcceeEEeeccCHHHHhccHhhcCCCCCc-ee--eECCEEeccHHHHHHHHH
Confidence            7999999999999999999999999999 89999 9999999999999999999999 46  554 89999999988877


Q ss_pred             CCCCCCCcchHHHHHHHHhc
Q 033504           83 VPEFPQCGFSSLAVRVLGAY  102 (118)
Q Consensus        83 tp~~P~CgFS~~~v~iL~~~  102 (118)
                               |+++-++|++.
T Consensus        94 ---------~GELq~~l~~~  104 (105)
T COG0278          94 ---------SGELQTLLKEA  104 (105)
T ss_pred             ---------cchHHHHHHhc
Confidence                     66777777654



>KOG0911 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0278 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0911 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10824 glutaredoxin-4; Provisional Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>PRK10824 glutaredoxin-4; Provisional Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>TIGR00365 monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>TIGR00365 monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>TIGR02189 GlrX-like_plant Glutaredoxin-like family Back     alignment and domain information
>TIGR02189 GlrX-like_plant Glutaredoxin-like family Back     alignment and domain information
>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>PHA03050 glutaredoxin; Provisional Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>TIGR02181 GRX_bact Glutaredoxin, GrxC family Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>PRK10638 glutaredoxin 3; Provisional Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>PHA03050 glutaredoxin; Provisional Back     alignment and domain information
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH Back     alignment and domain information
>cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC Back     alignment and domain information
>PRK01655 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>PRK10329 glutaredoxin-like protein; Provisional Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain Back     alignment and domain information
>cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes Back     alignment and domain information
>cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx Back     alignment and domain information
>TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family Back     alignment and domain information
>cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs Back     alignment and domain information
>PRK11200 grxA glutaredoxin 1; Provisional Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin Back     alignment and domain information
>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>PRK12559 transcriptional regulator Spx; Provisional Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>TIGR01616 nitro_assoc nitrogenase-associated protein Back     alignment and domain information
>PRK13344 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>PRK10026 arsenate reductase; Provisional Back     alignment and domain information
>COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1752 consensus Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>cd03030 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 domain binding glutamic acid-rich protein) subfamily; a recently-identified subfamily composed of SH3BGR and similar proteins possessing significant sequence similarity to GRX, but without a redox active CXXC motif Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10853 putative reductase; Provisional Back     alignment and domain information
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>PRK10638 glutaredoxin 3; Provisional Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli Back     alignment and domain information
>cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein Back     alignment and domain information
>TIGR00014 arsC arsenate reductase (glutaredoxin) Back     alignment and domain information
>TIGR02183 GRXA Glutaredoxin, GrxA family Back     alignment and domain information
>TIGR02181 GRX_bact Glutaredoxin, GrxC family Back     alignment and domain information
>PF04908 SH3BGR: SH3-binding, glutamic acid-rich protein; InterPro: IPR006993 This family of proteins, which contains SH3BGRL3, is functionally uncharacterised Back     alignment and domain information
>cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes Back     alignment and domain information
>KOG1752 consensus Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx Back     alignment and domain information
>PF03960 ArsC: ArsC family; InterPro: IPR006660 Several bacterial taxon have a chromosomal resistance system, encoded by the ars operon, for the detoxification of arsenate, arsenite, and antimonite [] Back     alignment and domain information
>cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins Back     alignment and domain information
>cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH Back     alignment and domain information
>cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins Back     alignment and domain information
>cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PRK10329 glutaredoxin-like protein; Provisional Back     alignment and domain information
>PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin Back     alignment and domain information
>TIGR01616 nitro_assoc nitrogenase-associated protein Back     alignment and domain information
>cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>PRK10026 arsenate reductase; Provisional Back     alignment and domain information
>COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli Back     alignment and domain information
>PRK11200 grxA glutaredoxin 1; Provisional Back     alignment and domain information
>cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query118
1yka_A115 Solution Structure Of Grx4, A Monothiol Glutaredoxi 2e-07
2wci_A135 Structure Of E. Coli Monothiol Glutaredoxin Grx4 Ho 2e-07
3gx8_A121 Structural And Biochemical Characterization Of Yeas 3e-06
2lku_A109 Solution Structure Of Reduced Poplar Apo Grxs14 Len 1e-04
3ipz_A109 Crystal Structure Of Arabidopsis Monothiol Glutared 2e-04
2wul_A118 Crystal Structure Of The Human Glutaredoxin 5 With 3e-04
3zyw_A111 Crystal Structure Of The First Glutaredoxin Domain 3e-04
>pdb|1YKA|A Chain A, Solution Structure Of Grx4, A Monothiol Glutaredoxin From E. Coli Length = 115 Back     alignment and structure

Iteration: 1

Score = 50.8 bits (120), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 21/44 (47%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Query: 65 EVVEQDVKENPVMLYMKGVPEFPQCGFSSLAVRVLGAY-SKFSY 107 E +++ + ENP++LYMKG P+ P CGFS+ AV+ L A +F+Y Sbjct: 6 EKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAY 49
>pdb|2WCI|A Chain A, Structure Of E. Coli Monothiol Glutaredoxin Grx4 Homodimer Length = 135 Back     alignment and structure
>pdb|3GX8|A Chain A, Structural And Biochemical Characterization Of Yeast Monothiol Glutaredoxin Grx5 Length = 121 Back     alignment and structure
>pdb|2LKU|A Chain A, Solution Structure Of Reduced Poplar Apo Grxs14 Length = 109 Back     alignment and structure
>pdb|3IPZ|A Chain A, Crystal Structure Of Arabidopsis Monothiol Glutaredoxin Atgr Length = 109 Back     alignment and structure
>pdb|2WUL|A Chain A, Crystal Structure Of The Human Glutaredoxin 5 With Bound Glutathione In An Fes Cluster Length = 118 Back     alignment and structure
>pdb|3ZYW|A Chain A, Crystal Structure Of The First Glutaredoxin Domain Of Human Glutaredoxin 3 (Glrx3) Length = 111 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query118
3zyw_A111 Glutaredoxin-3; metal binding protein; 1.84A {Homo 2e-17
2wci_A135 Glutaredoxin-4; redox-active center, iron-sulfur c 2e-17
1wik_A109 Thioredoxin-like protein 2; picot homology 2 domai 3e-17
2yan_A105 Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H 3e-17
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electro 4e-17
2wem_A118 Glutaredoxin-related protein 5; chromosome 14 open 5e-17
3gx8_A121 Monothiol glutaredoxin-5, mitochondrial; TRX fold, 5e-17
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 6e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Length = 111 Back     alignment and structure
 Score = 70.7 bits (174), Expect = 2e-17
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 62  SLKEVVEQDVKENPVMLYMKGVPEFPQCGFSSLAVRVLGAYS-KFSYF 108
            L   +++     P ML+MKG P+ P+CGFS   V +L  ++ +FS F
Sbjct: 4   DLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSF 51


>2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A Length = 135 Back     alignment and structure
>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Length = 109 Back     alignment and structure
>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Length = 105 Back     alignment and structure
>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} Length = 109 Back     alignment and structure
>3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} Length = 121 Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Length = 116 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query118
2wul_A118 Glutaredoxin related protein 5; chromosome 14 open 99.75
2wul_A118 Glutaredoxin related protein 5; chromosome 14 open 99.51
3gx8_A121 Monothiol glutaredoxin-5, mitochondrial; TRX fold, 99.31
3zyw_A111 Glutaredoxin-3; metal binding protein; 1.84A {Homo 99.26
2wem_A118 Glutaredoxin-related protein 5; chromosome 14 open 99.26
3zyw_A111 Glutaredoxin-3; metal binding protein; 1.84A {Homo 99.24
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electro 99.14
3gx8_A121 Monothiol glutaredoxin-5, mitochondrial; TRX fold, 99.13
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electro 99.1
2wem_A118 Glutaredoxin-related protein 5; chromosome 14 open 99.01
2wci_A135 Glutaredoxin-4; redox-active center, iron-sulfur c 98.9
1wik_A109 Thioredoxin-like protein 2; picot homology 2 domai 98.87
2yan_A105 Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H 98.78
2yan_A105 Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H 98.76
2wci_A135 Glutaredoxin-4; redox-active center, iron-sulfur c 98.74
1wik_A109 Thioredoxin-like protein 2; picot homology 2 domai 98.73
1aba_A87 Glutaredoxin; electron transport; HET: MES; 1.45A 98.22
1t1v_A93 SH3BGRL3, SH3 domain-binding glutamic acid-rich pr 97.97
2ct6_A111 SH3 domain-binding glutamic acid-rich-like protein 97.97
3h8q_A114 Thioredoxin reductase 3; oxidoreductase, structura 97.92
3rhb_A113 ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox 97.83
2lqo_A92 Putative glutaredoxin RV3198.1/MT3292; TRX fold, o 97.66
2jad_A362 Yellow fluorescent protein glutaredoxin fusion pro 97.64
1u6t_A121 SH3 domain-binding glutamic acid-rich-like protein 97.56
3l4n_A127 Monothiol glutaredoxin-6; C-terminal domain of GRX 97.55
3h8q_A114 Thioredoxin reductase 3; oxidoreductase, structura 97.54
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 97.53
3l4n_A127 Monothiol glutaredoxin-6; C-terminal domain of GRX 97.52
3rhb_A113 ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox 97.45
2hyx_A352 Protein DIPZ; thioredoxin fold, jelly-roll, struct 97.38
2jad_A362 Yellow fluorescent protein glutaredoxin fusion pro 97.24
1aba_A87 Glutaredoxin; electron transport; HET: MES; 1.45A 97.02
1kte_A105 Thioltransferase; redox-active center, electron tr 97.02
3ctg_A129 Glutaredoxin-2; reduced form, electron transport, 96.83
2cq9_A130 GLRX2 protein, glutaredoxin 2; glutathione-S-trans 96.8
3ctg_A129 Glutaredoxin-2; reduced form, electron transport, 96.76
2ht9_A146 Glutaredoxin-2; thioredoxin fold, iron-sulfur clus 96.65
3c1r_A118 Glutaredoxin-1; oxidized form, oxidoreductase, cyt 96.58
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 96.55
3c1r_A118 Glutaredoxin-1; oxidized form, oxidoreductase, cyt 96.5
2hze_A114 Glutaredoxin-1; thioredoxin fold, arsenic, dimethy 96.41
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 96.31
2cq9_A130 GLRX2 protein, glutaredoxin 2; glutathione-S-trans 96.3
3rdw_A121 Putative arsenate reductase; structural genomics, 96.26
3gkx_A120 Putative ARSC family related protein; ARSC family 96.25
1kte_A105 Thioltransferase; redox-active center, electron tr 96.22
3l78_A120 Regulatory protein SPX; transcription, transcripti 95.99
3fz4_A120 Putative arsenate reductase; APC61768, structural 95.95
1s3c_A141 Arsenate reductase; ARSC, arsenite, oxidoreductase 95.9
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 95.88
2ht9_A146 Glutaredoxin-2; thioredoxin fold, iron-sulfur clus 95.81
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 95.8
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 95.72
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 95.68
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 95.58
1t1v_A93 SH3BGRL3, SH3 domain-binding glutamic acid-rich pr 95.56
2hze_A114 Glutaredoxin-1; thioredoxin fold, arsenic, dimethy 95.53
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox pro 95.5
3f0i_A119 Arsenate reductase; structural genomics, IDP01300, 95.39
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 95.24
1z3e_A132 Regulatory protein SPX; bacterial transcription re 95.16
2ct6_A111 SH3 domain-binding glutamic acid-rich-like protein 95.07
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 94.67
1rw1_A114 Conserved hypothetical protein YFFB; thioredoxin f 94.58
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MC 94.51
2lqo_A92 Putative glutaredoxin RV3198.1/MT3292; TRX fold, o 94.42
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 94.07
2kok_A120 Arsenate reductase; brucellosis, zoonotic, oxidore 93.67
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 92.97
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, pro 92.94
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, pro 92.88
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia 92.78
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 92.74
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 92.66
2fgx_A107 Putative thioredoxin; NET3, NESG, GFT-glutaredoxin 92.48
3gkx_A120 Putative ARSC family related protein; ARSC family 92.25
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 92.24
3rdw_A121 Putative arsenate reductase; structural genomics, 91.96
3f0i_A119 Arsenate reductase; structural genomics, IDP01300, 91.8
1rw1_A114 Conserved hypothetical protein YFFB; thioredoxin f 91.42
1s3c_A141 Arsenate reductase; ARSC, arsenite, oxidoreductase 91.22
3fz4_A120 Putative arsenate reductase; APC61768, structural 90.96
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MC 90.68
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox pro 89.4
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 89.35
2kok_A120 Arsenate reductase; brucellosis, zoonotic, oxidore 89.03
1z3e_A132 Regulatory protein SPX; bacterial transcription re 88.74
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 88.36
1ttz_A87 Conserved hypothetical protein; structural genomic 88.3
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 85.61
2hyx_A352 Protein DIPZ; thioredoxin fold, jelly-roll, struct 85.29
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 82.07
>2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} Back     alignment and structure
Probab=99.75  E-value=7.2e-21  Score=134.08  Aligned_cols=87  Identities=20%  Similarity=0.239  Sum_probs=75.0

Q ss_pred             eeeEeeecCCCCCCCCchHHHHHHHHHcCC-CCcc-CCCCCcccccccCCCcccCCChhhHHHHH-HHHhhcCCeeeeec
Q 033504            5 LSNLIFKGIASYPSARSSRIVSGSLYHNGM-KYST-DVPNDPDTHEDFRPTSKVDASGLSLKEVV-EQDVKENPVMLYMK   81 (118)
Q Consensus         5 ~~~lfmKG~~~~P~CgfS~~~v~~l~~~~~-~~~~-dVl~d~d~r~dlK~ys~wpT~p~~l~~~I-k~li~~~~vvlfmK   81 (118)
                      =|||||||||+.|+|+||++++++|.+.|+ +|.+ ||++|++.|+.++.+++|||.|+ +  .| .++|++++.+.-|.
T Consensus        21 ~VvvF~Kgt~~~P~C~fc~~ak~lL~~~gv~~~~~~~v~~~~~~r~~l~~~sg~~TvPq-I--FI~g~~IGG~Ddl~~l~   97 (118)
T 2wul_A           21 KVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQ-V--YLNGEFVGGCDILLQMH   97 (118)
T ss_dssp             SEEEEESBCSSSBSSHHHHHHHHHHHHTTCCSCEEEETTSCHHHHHHHHHHHTCCSSCE-E--EETTEEEECHHHHHHHH
T ss_pred             CEEEEEcCCCCCCCCHHHHHHHHHHHHhCCcCeEeecccCCHHHHHHHHHhccCCCCCe-E--eECCEEECCHHHHHHHH
Confidence            379999999999999999999999999999 6999 99999999999999999999993 4  33 25666666666666


Q ss_pred             CCCCCCCCcchHHHHHHHHhcC
Q 033504           82 GVPEFPQCGFSSLAVRVLGAYS  103 (118)
Q Consensus        82 Gtp~~P~CgFS~~~v~iL~~~~  103 (118)
                      -         |+++.++|++.|
T Consensus        98 ~---------~GeL~~lL~~~G  110 (118)
T 2wul_A           98 Q---------NGDLVEELKKLG  110 (118)
T ss_dssp             H---------HTHHHHHHHHTT
T ss_pred             H---------CCCHHHHHHHcC
Confidence            6         778888998888



>2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} Back     alignment and structure
>3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Back     alignment and structure
>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Back     alignment and structure
>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A Back     alignment and structure
>3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A Back     alignment and structure
>2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A Back     alignment and structure
>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Back     alignment and structure
>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Back     alignment and structure
>2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A Back     alignment and structure
>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Back     alignment and structure
>1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Back     alignment and structure
>2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 Back     alignment and structure
>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Back     alignment and structure
>2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} Back     alignment and structure
>1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A Back     alignment and structure
>3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 Back     alignment and structure
>3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Back     alignment and structure
>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} Back     alignment and structure
>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Back     alignment and structure
>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Back     alignment and structure
>3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* Back     alignment and structure
>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* Back     alignment and structure
>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Back     alignment and structure
>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Back     alignment and structure
>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* Back     alignment and structure
>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Back     alignment and structure
>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3rdw_A Putative arsenate reductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 2.20A {Yersinia pestis} Back     alignment and structure
>3gkx_A Putative ARSC family related protein; ARSC family protein, structural genomi 2, protein structure initiative; 2.20A {Bacteroides fragilis} SCOP: c.47.1.0 Back     alignment and structure
>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Back     alignment and structure
>3l78_A Regulatory protein SPX; transcription, transcriptional factor, disulfide bond, redox-active center, transcription regulati; 1.90A {Streptococcus mutans} SCOP: c.47.1.12 Back     alignment and structure
>3fz4_A Putative arsenate reductase; APC61768, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.38A {Streptococcus mutans UA159} SCOP: c.47.1.0 Back     alignment and structure
>1s3c_A Arsenate reductase; ARSC, arsenite, oxidoreductase; 1.25A {Escherichia coli} PDB: 1sd9_A 1i9d_A 1j9b_A 1sd8_A 1jzw_A* 1sk1_A* 1sjz_A* 1sk0_A* 1sk2_A 1s3d_A Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Back     alignment and structure
>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Back     alignment and structure
>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Back     alignment and structure
>3f0i_A Arsenate reductase; structural genomics, IDP01300, vibrio CH center for structural genomics of infectious diseases, CSGI oxidoreductase; HET: MSE; 1.88A {Vibrio cholerae} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>1z3e_A Regulatory protein SPX; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: c.47.1.12 PDB: 3gfk_A 3ihq_A Back     alignment and structure
>2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Back     alignment and structure
>1rw1_A Conserved hypothetical protein YFFB; thioredoxin fold, structure 2 function project, S2F, structu genomics, unknown function; HET: MSE IPA; 1.02A {Pseudomonas aeruginosa} SCOP: c.47.1.12 Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>2kok_A Arsenate reductase; brucellosis, zoonotic, oxidoreductase, S genomics, seattle structural genomics center for infectious ssgcid; NMR {Brucella abortus} Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Back     alignment and structure
>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Back     alignment and structure
>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} Back     alignment and structure
>3gkx_A Putative ARSC family related protein; ARSC family protein, structural genomi 2, protein structure initiative; 2.20A {Bacteroides fragilis} SCOP: c.47.1.0 Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Back     alignment and structure
>3rdw_A Putative arsenate reductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 2.20A {Yersinia pestis} Back     alignment and structure
>3f0i_A Arsenate reductase; structural genomics, IDP01300, vibrio CH center for structural genomics of infectious diseases, CSGI oxidoreductase; HET: MSE; 1.88A {Vibrio cholerae} Back     alignment and structure
>1rw1_A Conserved hypothetical protein YFFB; thioredoxin fold, structure 2 function project, S2F, structu genomics, unknown function; HET: MSE IPA; 1.02A {Pseudomonas aeruginosa} SCOP: c.47.1.12 Back     alignment and structure
>1s3c_A Arsenate reductase; ARSC, arsenite, oxidoreductase; 1.25A {Escherichia coli} PDB: 1sd9_A 1i9d_A 1j9b_A 1sd8_A 1jzw_A* 1sk1_A* 1sjz_A* 1sk0_A* 1sk2_A 1s3d_A Back     alignment and structure
>3fz4_A Putative arsenate reductase; APC61768, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.38A {Streptococcus mutans UA159} SCOP: c.47.1.0 Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
>2kok_A Arsenate reductase; brucellosis, zoonotic, oxidoreductase, S genomics, seattle structural genomics center for infectious ssgcid; NMR {Brucella abortus} Back     alignment and structure
>1z3e_A Regulatory protein SPX; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: c.47.1.12 PDB: 3gfk_A 3ihq_A Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 118
d1wika_109 c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (M 3e-10
d1ktea_105 c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) 2e-04
>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Thioltransferase
domain: Thioredoxin-like protein 2
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 51.2 bits (122), Expect = 3e-10
 Identities = 13/40 (32%), Positives = 21/40 (52%)

Query: 60 GLSLKEVVEQDVKENPVMLYMKGVPEFPQCGFSSLAVRVL 99
          G S    ++    +  VML+MKG  +  +CGFS   + +L
Sbjct: 1  GSSGSSGLKVLTNKASVMLFMKGNKQEAKCGFSKQILEIL 40


>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 105 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query118
d1wika_109 Thioredoxin-like protein 2 {Mouse (Mus musculus) [ 99.58
d1wika_109 Thioredoxin-like protein 2 {Mouse (Mus musculus) [ 99.41
d1fova_82 Glutaredoxin (Grx, thioltransferase) {Escherichia 98.15
d1ktea_105 Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr 97.8
d1nm3a174 C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus 97.67
d1ktea_105 Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr 97.48
d1abaa_87 Glutaredoxin (Grx, thioltransferase) {Bacteriophag 97.47
d1r7ha_74 Glutaredoxin-like NRDH-redoxin {Corynebacterium am 97.45
d1h75a_76 Glutaredoxin-like NRDH-redoxin {Escherichia coli [ 97.28
d1t1va_93 SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} 97.03
d1egoa_85 Glutaredoxin (Grx, thioltransferase) {Escherichia 96.21
d1nm3a174 C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus 96.07
d1fova_82 Glutaredoxin (Grx, thioltransferase) {Escherichia 96.07
d1abaa_87 Glutaredoxin (Grx, thioltransferase) {Bacteriophag 95.98
d1r7ha_74 Glutaredoxin-like NRDH-redoxin {Corynebacterium am 95.33
d1h75a_76 Glutaredoxin-like NRDH-redoxin {Escherichia coli [ 95.0
d1z3ea1114 Regulatory protein Spx {Bacillus subtilis [TaxId: 94.81
d1rw1a_114 Hypothetical protein PA3664 (YffB) {Pseudomonas ae 94.6
d1j9ba_138 Arsenate reductase ArsC {Escherichia coli [TaxId: 93.89
d1rw1a_114 Hypothetical protein PA3664 (YffB) {Pseudomonas ae 92.61
d1egoa_85 Glutaredoxin (Grx, thioltransferase) {Escherichia 91.46
d1z3ea1114 Regulatory protein Spx {Bacillus subtilis [TaxId: 91.12
d1aw9a281 Class phi GST {Maize (Zea mays), type III [TaxId: 86.67
d1t1va_93 SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} 86.6
d1g7oa275 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 85.15
d1ljra279 Class theta GST {Human (Homo sapiens) [TaxId: 9606 84.26
d1k0ma286 Chloride intracellular channel 1 (clic1) {Human (H 82.77
d1k0da292 Yeast prion protein ure2p, nitrogen regulation fra 81.56
d1eema298 Class omega GST {Human (Homo sapiens) [TaxId: 9606 80.62
d1gnwa284 Class phi GST {Mouse-ear cress (Arabidopsis thalia 80.09
>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Thioltransferase
domain: Thioredoxin-like protein 2
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.58  E-value=4.8e-18  Score=115.92  Aligned_cols=58  Identities=19%  Similarity=0.239  Sum_probs=55.1

Q ss_pred             eeeeEeeecCCCCCCCCchHHHHHHHHHcCCCCcc-CCCCCcccccccCCCcccCCChh
Q 033504            4 SLSNLIFKGIASYPSARSSRIVSGSLYHNGMKYST-DVPNDPDTHEDFRPTSKVDASGL   61 (118)
Q Consensus         4 ~~~~lfmKG~~~~P~CgfS~~~v~~l~~~~~~~~~-dVl~d~d~r~dlK~ys~wpT~p~   61 (118)
                      .=+||||||||+.|+|+|++++.++|+++|++|.. |+.++++.++.++.+++|+|.|+
T Consensus        15 ~~VvvF~Kgt~~~p~Cp~c~~ak~lL~~~~i~~~~~~v~~~~~~~~~l~~~t~~~TvPq   73 (109)
T d1wika_          15 ASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKTFSNWPTYPQ   73 (109)
T ss_dssp             SSEEEEESSTTTCCCSSTHHHHHHHHHHTCSCEEEEESSSCHHHHHHHHHHHSCCSSCE
T ss_pred             CCEEEEeCCCCCCCCChHHHHHHHHHHhcCCCceEEEecccHHHHHHHHHhcCCCCCCe
Confidence            34899999999999999999999999999999999 99999999999999999999993



>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Back     information, alignment and structure
>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Back     information, alignment and structure
>d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z3ea1 c.47.1.12 (A:1-114) Regulatory protein Spx {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rw1a_ c.47.1.12 (A:) Hypothetical protein PA3664 (YffB) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1j9ba_ c.47.1.12 (A:) Arsenate reductase ArsC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rw1a_ c.47.1.12 (A:) Hypothetical protein PA3664 (YffB) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z3ea1 c.47.1.12 (A:1-114) Regulatory protein Spx {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure