Citrus Sinensis ID: 033504
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 118 | ||||||
| 255553075 | 169 | Monothiol glutaredoxin-4, putative [Rici | 0.872 | 0.609 | 0.699 | 1e-37 | |
| 225442841 | 170 | PREDICTED: monothiol glutaredoxin-S15, m | 0.872 | 0.605 | 0.689 | 1e-37 | |
| 449469010 | 171 | PREDICTED: monothiol glutaredoxin-S15, m | 0.872 | 0.602 | 0.673 | 3e-36 | |
| 147814938 | 409 | hypothetical protein VITISV_033251 [Viti | 0.872 | 0.251 | 0.601 | 2e-34 | |
| 388494312 | 163 | unknown [Lotus japonicus] | 0.830 | 0.601 | 0.660 | 6e-31 | |
| 317106758 | 148 | JHL25H03.16 [Jatropha curcas] | 0.669 | 0.533 | 0.721 | 3e-29 | |
| 18400858 | 169 | monothiol glutaredoxin-S15 [Arabidopsis | 0.872 | 0.609 | 0.628 | 4e-29 | |
| 297834440 | 169 | glutaredoxin family protein [Arabidopsis | 0.872 | 0.609 | 0.619 | 4e-29 | |
| 21592763 | 169 | unknown [Arabidopsis thaliana] | 0.872 | 0.609 | 0.619 | 5e-29 | |
| 357455115 | 158 | Monothiol glutaredoxin-S15 [Medicago tru | 0.796 | 0.594 | 0.591 | 2e-27 |
| >gi|255553075|ref|XP_002517580.1| Monothiol glutaredoxin-4, putative [Ricinus communis] gi|223543212|gb|EEF44744.1| Monothiol glutaredoxin-4, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 160 bits (404), Expect = 1e-37, Method: Compositional matrix adjust.
Identities = 72/103 (69%), Positives = 89/103 (86%)
Query: 1 MARSLSNLIFKGIASYPSARSSRIVSGSLYHNGMKYSTDVPNDPDTHEDFRPTSKVDASG 60
MA++LSN++ K IA +ARSSR+VSGS HNGM+YST VP DPDTHEDF+P +K++ SG
Sbjct: 1 MAKTLSNIVLKSIAGLSAARSSRLVSGSYCHNGMRYSTTVPKDPDTHEDFQPNNKLENSG 60
Query: 61 LSLKEVVEQDVKENPVMLYMKGVPEFPQCGFSSLAVRVLGAYS 103
LSLK+VVEQDVK+NPVM+YMKGVP+ PQCGFS+LAVRVL Y+
Sbjct: 61 LSLKDVVEQDVKDNPVMIYMKGVPDLPQCGFSALAVRVLKQYN 103
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225442841|ref|XP_002285351.1| PREDICTED: monothiol glutaredoxin-S15, mitochondrial isoform 1 [Vitis vinifera] gi|297743395|emb|CBI36262.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449469010|ref|XP_004152214.1| PREDICTED: monothiol glutaredoxin-S15, mitochondrial-like [Cucumis sativus] gi|449484186|ref|XP_004156810.1| PREDICTED: monothiol glutaredoxin-S15, mitochondrial-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|147814938|emb|CAN74745.1| hypothetical protein VITISV_033251 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|388494312|gb|AFK35222.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|317106758|dbj|BAJ53252.1| JHL25H03.16 [Jatropha curcas] | Back alignment and taxonomy information |
|---|
| >gi|18400858|ref|NP_566522.1| monothiol glutaredoxin-S15 [Arabidopsis thaliana] gi|79313249|ref|NP_001030704.1| monothiol glutaredoxin-S15 [Arabidopsis thaliana] gi|119370633|sp|Q8LBK6.2|GRS15_ARATH RecName: Full=Monothiol glutaredoxin-S15, mitochondrial; Short=AtGrxS15; Flags: Precursor gi|11994338|dbj|BAB02297.1| unnamed protein product [Arabidopsis thaliana] gi|30102572|gb|AAP21204.1| At3g15660 [Arabidopsis thaliana] gi|110743466|dbj|BAE99619.1| hypothetical protein [Arabidopsis thaliana] gi|222424054|dbj|BAH19988.1| AT3G15660 [Arabidopsis thaliana] gi|332642189|gb|AEE75710.1| monothiol glutaredoxin-S15 [Arabidopsis thaliana] gi|332642190|gb|AEE75711.1| monothiol glutaredoxin-S15 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297834440|ref|XP_002885102.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata] gi|297330942|gb|EFH61361.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|21592763|gb|AAM64712.1| unknown [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|357455115|ref|XP_003597838.1| Monothiol glutaredoxin-S15 [Medicago truncatula] gi|355486886|gb|AES68089.1| Monothiol glutaredoxin-S15 [Medicago truncatula] gi|388510724|gb|AFK43428.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 118 | ||||||
| TAIR|locus:2093297 | 169 | GRX4 "glutaredoxin 4" [Arabido | 0.872 | 0.609 | 0.619 | 7.9e-30 | |
| UNIPROTKB|Q83DV9 | 99 | CBU_0583 "Glutaredoxin" [Coxie | 0.440 | 0.525 | 0.462 | 1.6e-08 | |
| TIGR_CMR|CBU_0583 | 99 | CBU_0583 "glutaredoxin-related | 0.440 | 0.525 | 0.462 | 1.6e-08 | |
| DICTYBASE|DDB_G0274657 | 143 | DDB_G0274657 "glutaredoxin-rel | 0.406 | 0.335 | 0.5 | 3.3e-08 | |
| UNIPROTKB|Q606E0 | 110 | MCA2078 "Glutaredoxin" [Methyl | 0.296 | 0.318 | 0.571 | 8.7e-08 | |
| CGD|CAL0004286 | 175 | orf19.2782 [Candida albicans ( | 0.322 | 0.217 | 0.526 | 1.1e-07 | |
| UNIPROTKB|P0AC69 | 115 | grxD "glutaredoxin 4" [Escheri | 0.364 | 0.373 | 0.477 | 1.4e-07 | |
| UNIPROTKB|Q60C52 | 110 | MCA0259 "Glutaredoxin" [Methyl | 0.389 | 0.418 | 0.468 | 1.8e-07 | |
| UNIPROTKB|Q9KQF4 | 110 | VC_2044 "Glutaredoxin" [Vibrio | 0.347 | 0.372 | 0.523 | 1.8e-07 | |
| TIGR_CMR|VC_2044 | 110 | VC_2044 "conserved hypothetica | 0.347 | 0.372 | 0.523 | 1.8e-07 |
| TAIR|locus:2093297 GRX4 "glutaredoxin 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 330 (121.2 bits), Expect = 7.9e-30, P = 7.9e-30
Identities = 65/105 (61%), Positives = 82/105 (78%)
Query: 1 MARSLSNLIFKGIASYPSARSSRIVSGSLYHNGM-KYSTDVPNDPDTHEDFRPTSKVDAS 59
MA SLS+ + KGIA+ + RSSR+ S S+Y NGM ++S+ VP+D DTH+DF+PT KV
Sbjct: 1 MAASLSSRLIKGIANLKAVRSSRLTSASVYQNGMMRFSSTVPSDSDTHDDFKPTQKVPPD 60
Query: 60 GL-SLKEVVEQDVKENPVMLYMKGVPEFPQCGFSSLAVRVLGAYS 103
SLK++VE DVK+NPVM+YMKGVPE PQCGFSSLAVRVL Y+
Sbjct: 61 STDSLKDIVENDVKDNPVMIYMKGVPESPQCGFSSLAVRVLQQYN 105
|
|
| UNIPROTKB|Q83DV9 CBU_0583 "Glutaredoxin" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CBU_0583 CBU_0583 "glutaredoxin-related protein" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0274657 DDB_G0274657 "glutaredoxin-related family protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q606E0 MCA2078 "Glutaredoxin" [Methylococcus capsulatus str. Bath (taxid:243233)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0004286 orf19.2782 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0AC69 grxD "glutaredoxin 4" [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q60C52 MCA0259 "Glutaredoxin" [Methylococcus capsulatus str. Bath (taxid:243233)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KQF4 VC_2044 "Glutaredoxin" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_2044 VC_2044 "conserved hypothetical protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00034560001 | SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (170 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00020703001 | • | • | 0.470 | ||||||||
| GSVIVG00034899001 | • | • | 0.458 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 118 | |||
| TIGR00365 | 97 | TIGR00365, TIGR00365, monothiol glutaredoxin, Grx4 | 4e-17 | |
| cd03028 | 90 | cd03028, GRX_PICOT_like, Glutaredoxin (GRX) family | 7e-16 | |
| COG0278 | 105 | COG0278, COG0278, Glutaredoxin-related protein [Po | 1e-15 | |
| PRK10824 | 115 | PRK10824, PRK10824, glutaredoxin-4; Provisional | 1e-11 | |
| PTZ00062 | 204 | PTZ00062, PTZ00062, glutaredoxin; Provisional | 1e-04 |
| >gnl|CDD|188046 TIGR00365, TIGR00365, monothiol glutaredoxin, Grx4 family | Back alignment and domain information |
|---|
Score = 70.2 bits (173), Expect = 4e-17
Identities = 24/46 (52%), Positives = 34/46 (73%), Gaps = 1/46 (2%)
Query: 64 KEVVEQDVKENPVMLYMKGVPEFPQCGFSSLAVRVLGAYS-KFSYF 108
E +++ + ENPV+LYMKG P+FPQCGFS+ AV++L A F+Y
Sbjct: 2 IERIKEQIAENPVVLYMKGTPQFPQCGFSARAVQILNACGVPFAYV 47
|
The gene for the member of this glutaredoxin family in E. coli, originally designated ydhD, is now designated grxD. Its protein, Grx4, is a monothiol glutaredoxin similar to Grx5 of yeast, which is involved in iron-sulfur cluster formation [Energy metabolism, Electron transport]. Length = 97 |
| >gnl|CDD|239326 cd03028, GRX_PICOT_like, Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223355 COG0278, COG0278, Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|182759 PRK10824, PRK10824, glutaredoxin-4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240250 PTZ00062, PTZ00062, glutaredoxin; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 118 | |||
| COG0278 | 105 | Glutaredoxin-related protein [Posttranslational mo | 99.96 | |
| KOG0911 | 227 | consensus Glutaredoxin-related protein [Posttransl | 99.91 | |
| COG0278 | 105 | Glutaredoxin-related protein [Posttranslational mo | 99.82 | |
| KOG0911 | 227 | consensus Glutaredoxin-related protein [Posttransl | 99.68 | |
| PRK10824 | 115 | glutaredoxin-4; Provisional | 99.68 | |
| PTZ00062 | 204 | glutaredoxin; Provisional | 99.54 | |
| PRK10824 | 115 | glutaredoxin-4; Provisional | 99.45 | |
| PTZ00062 | 204 | glutaredoxin; Provisional | 99.38 | |
| TIGR00365 | 97 | monothiol glutaredoxin, Grx4 family. The gene for | 99.24 | |
| TIGR00365 | 97 | monothiol glutaredoxin, Grx4 family. The gene for | 99.17 | |
| cd03028 | 90 | GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte | 99.14 | |
| cd03028 | 90 | GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte | 99.07 | |
| TIGR02189 | 99 | GlrX-like_plant Glutaredoxin-like family. This fam | 98.28 | |
| TIGR02189 | 99 | GlrX-like_plant Glutaredoxin-like family. This fam | 97.7 | |
| PF00462 | 60 | Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl | 97.66 | |
| cd03027 | 73 | GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg | 97.66 | |
| PHA03050 | 108 | glutaredoxin; Provisional | 97.46 | |
| cd02066 | 72 | GRX_family Glutaredoxin (GRX) family; composed of | 97.43 | |
| TIGR02181 | 79 | GRX_bact Glutaredoxin, GrxC family. This family of | 97.38 | |
| cd03418 | 75 | GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b | 97.34 | |
| PRK10638 | 83 | glutaredoxin 3; Provisional | 97.22 | |
| TIGR02190 | 79 | GlrX-dom Glutaredoxin-family domain. This C-termin | 97.02 | |
| cd03029 | 72 | GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb | 96.86 | |
| PHA03050 | 108 | glutaredoxin; Provisional | 96.63 | |
| cd03419 | 82 | GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h | 96.55 | |
| TIGR02194 | 72 | GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red | 96.48 | |
| cd03036 | 111 | ArsC_like Arsenate Reductase (ArsC) family, unknow | 96.38 | |
| PRK01655 | 131 | spxA transcriptional regulator Spx; Reviewed | 96.01 | |
| PRK10329 | 81 | glutaredoxin-like protein; Provisional | 95.77 | |
| TIGR02190 | 79 | GlrX-dom Glutaredoxin-family domain. This C-termin | 95.77 | |
| cd03032 | 115 | ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub | 95.76 | |
| cd02977 | 105 | ArsC_family Arsenate Reductase (ArsC) family; comp | 95.7 | |
| TIGR01617 | 117 | arsC_related transcriptional regulator, Spx/MgsR f | 95.49 | |
| cd03035 | 105 | ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s | 95.46 | |
| cd03031 | 147 | GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d | 95.45 | |
| PRK11200 | 85 | grxA glutaredoxin 1; Provisional | 95.42 | |
| cd03027 | 73 | GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg | 95.12 | |
| TIGR02180 | 84 | GRX_euk Glutaredoxin. This model represents eukary | 95.1 | |
| PF00462 | 60 | Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl | 95.06 | |
| PRK12559 | 131 | transcriptional regulator Spx; Provisional | 95.05 | |
| cd03418 | 75 | GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b | 95.05 | |
| TIGR02196 | 74 | GlrX_YruB Glutaredoxin-like protein, YruB-family. | 95.04 | |
| cd03033 | 113 | ArsC_15kD Arsenate Reductase (ArsC) family, 15kD p | 94.97 | |
| TIGR01616 | 126 | nitro_assoc nitrogenase-associated protein. This m | 94.84 | |
| PRK13344 | 132 | spxA transcriptional regulator Spx; Reviewed | 94.84 | |
| PRK10026 | 141 | arsenate reductase; Provisional | 94.79 | |
| COG1393 | 117 | ArsC Arsenate reductase and related proteins, glut | 94.76 | |
| KOG1752 | 104 | consensus Glutaredoxin and related proteins [Postt | 94.74 | |
| cd02066 | 72 | GRX_family Glutaredoxin (GRX) family; composed of | 94.67 | |
| cd03030 | 92 | GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 | 94.59 | |
| COG0695 | 80 | GrxC Glutaredoxin and related proteins [Posttransl | 94.35 | |
| PRK10853 | 118 | putative reductase; Provisional | 94.02 | |
| cd03419 | 82 | GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h | 94.0 | |
| cd03029 | 72 | GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb | 93.86 | |
| PRK10638 | 83 | glutaredoxin 3; Provisional | 93.83 | |
| cd02976 | 73 | NrdH NrdH-redoxin (NrdH) family; NrdH is a small m | 93.66 | |
| cd03034 | 112 | ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC s | 93.63 | |
| cd03036 | 111 | ArsC_like Arsenate Reductase (ArsC) family, unknow | 92.86 | |
| TIGR02200 | 77 | GlrX_actino Glutaredoxin-like protein. This family | 92.74 | |
| TIGR00014 | 114 | arsC arsenate reductase (glutaredoxin). composed o | 92.73 | |
| TIGR02183 | 86 | GRXA Glutaredoxin, GrxA family. This model include | 92.49 | |
| TIGR02181 | 79 | GRX_bact Glutaredoxin, GrxC family. This family of | 92.35 | |
| PF04908 | 99 | SH3BGR: SH3-binding, glutamic acid-rich protein; I | 91.9 | |
| cd03032 | 115 | ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub | 91.71 | |
| KOG1752 | 104 | consensus Glutaredoxin and related proteins [Postt | 91.69 | |
| cd02977 | 105 | ArsC_family Arsenate Reductase (ArsC) family; comp | 91.56 | |
| PF03960 | 110 | ArsC: ArsC family; InterPro: IPR006660 Several bac | 91.45 | |
| cd03041 | 77 | GST_N_2GST_N GST_N family, 2 repeats of the N-term | 90.98 | |
| cd03035 | 105 | ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s | 90.87 | |
| TIGR02194 | 72 | GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red | 90.67 | |
| cd03061 | 91 | GST_N_CLIC GST_N family, Chloride Intracellular Ch | 90.42 | |
| cd00570 | 71 | GST_N_family Glutathione S-transferase (GST) famil | 89.2 | |
| PRK10329 | 81 | glutaredoxin-like protein; Provisional | 88.66 | |
| PRK12759 | 410 | bifunctional gluaredoxin/ribonucleoside-diphosphat | 88.12 | |
| TIGR02180 | 84 | GRX_euk Glutaredoxin. This model represents eukary | 86.84 | |
| TIGR01616 | 126 | nitro_assoc nitrogenase-associated protein. This m | 86.41 | |
| cd03033 | 113 | ArsC_15kD Arsenate Reductase (ArsC) family, 15kD p | 86.15 | |
| PRK10026 | 141 | arsenate reductase; Provisional | 84.88 | |
| COG1393 | 117 | ArsC Arsenate reductase and related proteins, glut | 84.01 | |
| cd03045 | 74 | GST_N_Delta_Epsilon GST_N family, Class Delta and | 83.37 | |
| cd03034 | 112 | ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC s | 83.28 | |
| PRK11200 | 85 | grxA glutaredoxin 1; Provisional | 82.75 | |
| cd03040 | 77 | GST_N_mPGES2 GST_N family; microsomal Prostaglandi | 82.62 | |
| cd03060 | 71 | GST_N_Omega_like GST_N family, Omega-like subfamil | 81.99 | |
| COG0695 | 80 | GrxC Glutaredoxin and related proteins [Posttransl | 81.66 | |
| cd02976 | 73 | NrdH NrdH-redoxin (NrdH) family; NrdH is a small m | 81.11 | |
| TIGR02200 | 77 | GlrX_actino Glutaredoxin-like protein. This family | 81.03 | |
| TIGR02196 | 74 | GlrX_YruB Glutaredoxin-like protein, YruB-family. | 80.45 |
| >COG0278 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.96 E-value=6e-31 Score=182.47 Aligned_cols=85 Identities=21% Similarity=0.224 Sum_probs=76.5
Q ss_pred eeEeeecCCCCCCCCchHHHHHHHHHcC-CCCcc-CCCCCcccccccCCCcccCCChhhHHHHHH-HHhhcCCeeeeecC
Q 033504 6 SNLIFKGIASYPSARSSRIVSGSLYHNG-MKYST-DVPNDPDTHEDFRPTSKVDASGLSLKEVVE-QDVKENPVMLYMKG 82 (118)
Q Consensus 6 ~~lfmKG~~~~P~CgfS~~~v~~l~~~~-~~~~~-dVl~d~d~r~dlK~ys~wpT~p~~l~~~Ik-~li~~~~vvlfmKG 82 (118)
+||||||||++|+||||++++++|..+| ++|.+ |||+|+++|+++|.||+|||+| ++ .|+ ++|++++|+.-|--
T Consensus 17 VvLFMKGtp~~P~CGFS~~~vqiL~~~g~v~~~~vnVL~d~eiR~~lk~~s~WPT~P-QL--yi~GEfvGG~DIv~Em~q 93 (105)
T COG0278 17 VVLFMKGTPEFPQCGFSAQAVQILSACGVVDFAYVDVLQDPEIRQGLKEYSNWPTFP-QL--YVNGEFVGGCDIVREMYQ 93 (105)
T ss_pred eEEEecCCCCCCCCCccHHHHHHHHHcCCcceeEEeeccCHHHHhccHhhcCCCCCc-ee--eECCEEeccHHHHHHHHH
Confidence 7999999999999999999999999999 89999 9999999999999999999999 46 554 89999999988877
Q ss_pred CCCCCCCcchHHHHHHHHhc
Q 033504 83 VPEFPQCGFSSLAVRVLGAY 102 (118)
Q Consensus 83 tp~~P~CgFS~~~v~iL~~~ 102 (118)
|+++-++|++.
T Consensus 94 ---------~GELq~~l~~~ 104 (105)
T COG0278 94 ---------SGELQTLLKEA 104 (105)
T ss_pred ---------cchHHHHHHhc
Confidence 66777777654
|
|
| >KOG0911 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0278 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0911 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10824 glutaredoxin-4; Provisional | Back alignment and domain information |
|---|
| >PTZ00062 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >PRK10824 glutaredoxin-4; Provisional | Back alignment and domain information |
|---|
| >PTZ00062 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >TIGR00365 monothiol glutaredoxin, Grx4 family | Back alignment and domain information |
|---|
| >TIGR00365 monothiol glutaredoxin, Grx4 family | Back alignment and domain information |
|---|
| >cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins | Back alignment and domain information |
|---|
| >cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins | Back alignment and domain information |
|---|
| >TIGR02189 GlrX-like_plant Glutaredoxin-like family | Back alignment and domain information |
|---|
| >TIGR02189 GlrX-like_plant Glutaredoxin-like family | Back alignment and domain information |
|---|
| >PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions | Back alignment and domain information |
|---|
| >PHA03050 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >TIGR02181 GRX_bact Glutaredoxin, GrxC family | Back alignment and domain information |
|---|
| >cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >PRK10638 glutaredoxin 3; Provisional | Back alignment and domain information |
|---|
| >TIGR02190 GlrX-dom Glutaredoxin-family domain | Back alignment and domain information |
|---|
| >cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria | Back alignment and domain information |
|---|
| >PHA03050 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH | Back alignment and domain information |
|---|
| >cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >PRK01655 spxA transcriptional regulator Spx; Reviewed | Back alignment and domain information |
|---|
| >PRK10329 glutaredoxin-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02190 GlrX-dom Glutaredoxin-family domain | Back alignment and domain information |
|---|
| >cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes | Back alignment and domain information |
|---|
| >cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx | Back alignment and domain information |
|---|
| >TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family | Back alignment and domain information |
|---|
| >cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs | Back alignment and domain information |
|---|
| >PRK11200 grxA glutaredoxin 1; Provisional | Back alignment and domain information |
|---|
| >cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions | Back alignment and domain information |
|---|
| >TIGR02180 GRX_euk Glutaredoxin | Back alignment and domain information |
|---|
| >PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >PRK12559 transcriptional regulator Spx; Provisional | Back alignment and domain information |
|---|
| >cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family | Back alignment and domain information |
|---|
| >cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >TIGR01616 nitro_assoc nitrogenase-associated protein | Back alignment and domain information |
|---|
| >PRK13344 spxA transcriptional regulator Spx; Reviewed | Back alignment and domain information |
|---|
| >PRK10026 arsenate reductase; Provisional | Back alignment and domain information |
|---|
| >COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1752 consensus Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >cd03030 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 domain binding glutamic acid-rich protein) subfamily; a recently-identified subfamily composed of SH3BGR and similar proteins possessing significant sequence similarity to GRX, but without a redox active CXXC motif | Back alignment and domain information |
|---|
| >COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10853 putative reductase; Provisional | Back alignment and domain information |
|---|
| >cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria | Back alignment and domain information |
|---|
| >PRK10638 glutaredoxin 3; Provisional | Back alignment and domain information |
|---|
| >cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile | Back alignment and domain information |
|---|
| >cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli | Back alignment and domain information |
|---|
| >cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >TIGR02200 GlrX_actino Glutaredoxin-like protein | Back alignment and domain information |
|---|
| >TIGR00014 arsC arsenate reductase (glutaredoxin) | Back alignment and domain information |
|---|
| >TIGR02183 GRXA Glutaredoxin, GrxA family | Back alignment and domain information |
|---|
| >TIGR02181 GRX_bact Glutaredoxin, GrxC family | Back alignment and domain information |
|---|
| >PF04908 SH3BGR: SH3-binding, glutamic acid-rich protein; InterPro: IPR006993 This family of proteins, which contains SH3BGRL3, is functionally uncharacterised | Back alignment and domain information |
|---|
| >cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes | Back alignment and domain information |
|---|
| >KOG1752 consensus Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx | Back alignment and domain information |
|---|
| >PF03960 ArsC: ArsC family; InterPro: IPR006660 Several bacterial taxon have a chromosomal resistance system, encoded by the ars operon, for the detoxification of arsenate, arsenite, and antimonite [] | Back alignment and domain information |
|---|
| >cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins | Back alignment and domain information |
|---|
| >cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH | Back alignment and domain information |
|---|
| >cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins | Back alignment and domain information |
|---|
| >cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >PRK10329 glutaredoxin-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional | Back alignment and domain information |
|---|
| >TIGR02180 GRX_euk Glutaredoxin | Back alignment and domain information |
|---|
| >TIGR01616 nitro_assoc nitrogenase-associated protein | Back alignment and domain information |
|---|
| >cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >PRK10026 arsenate reductase; Provisional | Back alignment and domain information |
|---|
| >COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli | Back alignment and domain information |
|---|
| >PRK11200 grxA glutaredoxin 1; Provisional | Back alignment and domain information |
|---|
| >cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 | Back alignment and domain information |
|---|
| >cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs | Back alignment and domain information |
|---|
| >COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile | Back alignment and domain information |
|---|
| >TIGR02200 GlrX_actino Glutaredoxin-like protein | Back alignment and domain information |
|---|
| >TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 118 | ||||
| 1yka_A | 115 | Solution Structure Of Grx4, A Monothiol Glutaredoxi | 2e-07 | ||
| 2wci_A | 135 | Structure Of E. Coli Monothiol Glutaredoxin Grx4 Ho | 2e-07 | ||
| 3gx8_A | 121 | Structural And Biochemical Characterization Of Yeas | 3e-06 | ||
| 2lku_A | 109 | Solution Structure Of Reduced Poplar Apo Grxs14 Len | 1e-04 | ||
| 3ipz_A | 109 | Crystal Structure Of Arabidopsis Monothiol Glutared | 2e-04 | ||
| 2wul_A | 118 | Crystal Structure Of The Human Glutaredoxin 5 With | 3e-04 | ||
| 3zyw_A | 111 | Crystal Structure Of The First Glutaredoxin Domain | 3e-04 |
| >pdb|1YKA|A Chain A, Solution Structure Of Grx4, A Monothiol Glutaredoxin From E. Coli Length = 115 | Back alignment and structure |
|
| >pdb|2WCI|A Chain A, Structure Of E. Coli Monothiol Glutaredoxin Grx4 Homodimer Length = 135 | Back alignment and structure |
| >pdb|3GX8|A Chain A, Structural And Biochemical Characterization Of Yeast Monothiol Glutaredoxin Grx5 Length = 121 | Back alignment and structure |
| >pdb|2LKU|A Chain A, Solution Structure Of Reduced Poplar Apo Grxs14 Length = 109 | Back alignment and structure |
| >pdb|3IPZ|A Chain A, Crystal Structure Of Arabidopsis Monothiol Glutaredoxin Atgr Length = 109 | Back alignment and structure |
| >pdb|2WUL|A Chain A, Crystal Structure Of The Human Glutaredoxin 5 With Bound Glutathione In An Fes Cluster Length = 118 | Back alignment and structure |
| >pdb|3ZYW|A Chain A, Crystal Structure Of The First Glutaredoxin Domain Of Human Glutaredoxin 3 (Glrx3) Length = 111 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 118 | |||
| 3zyw_A | 111 | Glutaredoxin-3; metal binding protein; 1.84A {Homo | 2e-17 | |
| 2wci_A | 135 | Glutaredoxin-4; redox-active center, iron-sulfur c | 2e-17 | |
| 1wik_A | 109 | Thioredoxin-like protein 2; picot homology 2 domai | 3e-17 | |
| 2yan_A | 105 | Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H | 3e-17 | |
| 3ipz_A | 109 | Monothiol glutaredoxin-S14, chloroplastic; electro | 4e-17 | |
| 2wem_A | 118 | Glutaredoxin-related protein 5; chromosome 14 open | 5e-17 | |
| 3gx8_A | 121 | Monothiol glutaredoxin-5, mitochondrial; TRX fold, | 5e-17 | |
| 2e7p_A | 116 | Glutaredoxin; thioredoxin fold, poplar, electron t | 6e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-05 |
| >3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
Score = 70.7 bits (174), Expect = 2e-17
Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 1/48 (2%)
Query: 62 SLKEVVEQDVKENPVMLYMKGVPEFPQCGFSSLAVRVLGAYS-KFSYF 108
L +++ P ML+MKG P+ P+CGFS V +L ++ +FS F
Sbjct: 4 DLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSF 51
|
| >2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A Length = 135 | Back alignment and structure |
|---|
| >1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Length = 109 | Back alignment and structure |
|---|
| >2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} Length = 109 | Back alignment and structure |
|---|
| >3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} Length = 121 | Back alignment and structure |
|---|
| >2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Length = 116 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 118 | |||
| 2wul_A | 118 | Glutaredoxin related protein 5; chromosome 14 open | 99.75 | |
| 2wul_A | 118 | Glutaredoxin related protein 5; chromosome 14 open | 99.51 | |
| 3gx8_A | 121 | Monothiol glutaredoxin-5, mitochondrial; TRX fold, | 99.31 | |
| 3zyw_A | 111 | Glutaredoxin-3; metal binding protein; 1.84A {Homo | 99.26 | |
| 2wem_A | 118 | Glutaredoxin-related protein 5; chromosome 14 open | 99.26 | |
| 3zyw_A | 111 | Glutaredoxin-3; metal binding protein; 1.84A {Homo | 99.24 | |
| 3ipz_A | 109 | Monothiol glutaredoxin-S14, chloroplastic; electro | 99.14 | |
| 3gx8_A | 121 | Monothiol glutaredoxin-5, mitochondrial; TRX fold, | 99.13 | |
| 3ipz_A | 109 | Monothiol glutaredoxin-S14, chloroplastic; electro | 99.1 | |
| 2wem_A | 118 | Glutaredoxin-related protein 5; chromosome 14 open | 99.01 | |
| 2wci_A | 135 | Glutaredoxin-4; redox-active center, iron-sulfur c | 98.9 | |
| 1wik_A | 109 | Thioredoxin-like protein 2; picot homology 2 domai | 98.87 | |
| 2yan_A | 105 | Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H | 98.78 | |
| 2yan_A | 105 | Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H | 98.76 | |
| 2wci_A | 135 | Glutaredoxin-4; redox-active center, iron-sulfur c | 98.74 | |
| 1wik_A | 109 | Thioredoxin-like protein 2; picot homology 2 domai | 98.73 | |
| 1aba_A | 87 | Glutaredoxin; electron transport; HET: MES; 1.45A | 98.22 | |
| 1t1v_A | 93 | SH3BGRL3, SH3 domain-binding glutamic acid-rich pr | 97.97 | |
| 2ct6_A | 111 | SH3 domain-binding glutamic acid-rich-like protein | 97.97 | |
| 3h8q_A | 114 | Thioredoxin reductase 3; oxidoreductase, structura | 97.92 | |
| 3rhb_A | 113 | ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox | 97.83 | |
| 2lqo_A | 92 | Putative glutaredoxin RV3198.1/MT3292; TRX fold, o | 97.66 | |
| 2jad_A | 362 | Yellow fluorescent protein glutaredoxin fusion pro | 97.64 | |
| 1u6t_A | 121 | SH3 domain-binding glutamic acid-rich-like protein | 97.56 | |
| 3l4n_A | 127 | Monothiol glutaredoxin-6; C-terminal domain of GRX | 97.55 | |
| 3h8q_A | 114 | Thioredoxin reductase 3; oxidoreductase, structura | 97.54 | |
| 3qmx_A | 99 | Glutaredoxin A, glutaredoxin 3; electron transport | 97.53 | |
| 3l4n_A | 127 | Monothiol glutaredoxin-6; C-terminal domain of GRX | 97.52 | |
| 3rhb_A | 113 | ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox | 97.45 | |
| 2hyx_A | 352 | Protein DIPZ; thioredoxin fold, jelly-roll, struct | 97.38 | |
| 2jad_A | 362 | Yellow fluorescent protein glutaredoxin fusion pro | 97.24 | |
| 1aba_A | 87 | Glutaredoxin; electron transport; HET: MES; 1.45A | 97.02 | |
| 1kte_A | 105 | Thioltransferase; redox-active center, electron tr | 97.02 | |
| 3ctg_A | 129 | Glutaredoxin-2; reduced form, electron transport, | 96.83 | |
| 2cq9_A | 130 | GLRX2 protein, glutaredoxin 2; glutathione-S-trans | 96.8 | |
| 3ctg_A | 129 | Glutaredoxin-2; reduced form, electron transport, | 96.76 | |
| 2ht9_A | 146 | Glutaredoxin-2; thioredoxin fold, iron-sulfur clus | 96.65 | |
| 3c1r_A | 118 | Glutaredoxin-1; oxidized form, oxidoreductase, cyt | 96.58 | |
| 2khp_A | 92 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 96.55 | |
| 3c1r_A | 118 | Glutaredoxin-1; oxidized form, oxidoreductase, cyt | 96.5 | |
| 2hze_A | 114 | Glutaredoxin-1; thioredoxin fold, arsenic, dimethy | 96.41 | |
| 1fov_A | 82 | Glutaredoxin 3, GRX3; active site disulfide, CIS P | 96.31 | |
| 2cq9_A | 130 | GLRX2 protein, glutaredoxin 2; glutathione-S-trans | 96.3 | |
| 3rdw_A | 121 | Putative arsenate reductase; structural genomics, | 96.26 | |
| 3gkx_A | 120 | Putative ARSC family related protein; ARSC family | 96.25 | |
| 1kte_A | 105 | Thioltransferase; redox-active center, electron tr | 96.22 | |
| 3l78_A | 120 | Regulatory protein SPX; transcription, transcripti | 95.99 | |
| 3fz4_A | 120 | Putative arsenate reductase; APC61768, structural | 95.95 | |
| 1s3c_A | 141 | Arsenate reductase; ARSC, arsenite, oxidoreductase | 95.9 | |
| 3msz_A | 89 | Glutaredoxin 1; alpha-beta sandwich, center for st | 95.88 | |
| 2ht9_A | 146 | Glutaredoxin-2; thioredoxin fold, iron-sulfur clus | 95.81 | |
| 2e7p_A | 116 | Glutaredoxin; thioredoxin fold, poplar, electron t | 95.8 | |
| 1nm3_A | 241 | Protein HI0572; hybrid, peroxiredoxin, glutaredoxi | 95.72 | |
| 2x8g_A | 598 | Thioredoxin glutathione reductase; redox-active ce | 95.68 | |
| 1h75_A | 81 | Glutaredoxin-like protein NRDH; electron transport | 95.58 | |
| 1t1v_A | 93 | SH3BGRL3, SH3 domain-binding glutamic acid-rich pr | 95.56 | |
| 2hze_A | 114 | Glutaredoxin-1; thioredoxin fold, arsenic, dimethy | 95.53 | |
| 1r7h_A | 75 | NRDH-redoxin; thioredoxin, glutaredoxin, redox pro | 95.5 | |
| 3f0i_A | 119 | Arsenate reductase; structural genomics, IDP01300, | 95.39 | |
| 2x8g_A | 598 | Thioredoxin glutathione reductase; redox-active ce | 95.24 | |
| 1z3e_A | 132 | Regulatory protein SPX; bacterial transcription re | 95.16 | |
| 2ct6_A | 111 | SH3 domain-binding glutamic acid-rich-like protein | 95.07 | |
| 2klx_A | 89 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 94.67 | |
| 1rw1_A | 114 | Conserved hypothetical protein YFFB; thioredoxin f | 94.58 | |
| 3ic4_A | 92 | Glutaredoxin (GRX-1); structural genomics, PSI, MC | 94.51 | |
| 2lqo_A | 92 | Putative glutaredoxin RV3198.1/MT3292; TRX fold, o | 94.42 | |
| 1nm3_A | 241 | Protein HI0572; hybrid, peroxiredoxin, glutaredoxi | 94.07 | |
| 2kok_A | 120 | Arsenate reductase; brucellosis, zoonotic, oxidore | 93.67 | |
| 3qmx_A | 99 | Glutaredoxin A, glutaredoxin 3; electron transport | 92.97 | |
| 3nzn_A | 103 | Glutaredoxin; structural genomics, PSI2, MCSG, pro | 92.94 | |
| 3nzn_A | 103 | Glutaredoxin; structural genomics, PSI2, MCSG, pro | 92.88 | |
| 1ego_A | 85 | Glutaredoxin; electron transport; NMR {Escherichia | 92.78 | |
| 2khp_A | 92 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 92.74 | |
| 1fov_A | 82 | Glutaredoxin 3, GRX3; active site disulfide, CIS P | 92.66 | |
| 2fgx_A | 107 | Putative thioredoxin; NET3, NESG, GFT-glutaredoxin | 92.48 | |
| 3gkx_A | 120 | Putative ARSC family related protein; ARSC family | 92.25 | |
| 2klx_A | 89 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 92.24 | |
| 3rdw_A | 121 | Putative arsenate reductase; structural genomics, | 91.96 | |
| 3f0i_A | 119 | Arsenate reductase; structural genomics, IDP01300, | 91.8 | |
| 1rw1_A | 114 | Conserved hypothetical protein YFFB; thioredoxin f | 91.42 | |
| 1s3c_A | 141 | Arsenate reductase; ARSC, arsenite, oxidoreductase | 91.22 | |
| 3fz4_A | 120 | Putative arsenate reductase; APC61768, structural | 90.96 | |
| 3ic4_A | 92 | Glutaredoxin (GRX-1); structural genomics, PSI, MC | 90.68 | |
| 1r7h_A | 75 | NRDH-redoxin; thioredoxin, glutaredoxin, redox pro | 89.4 | |
| 3msz_A | 89 | Glutaredoxin 1; alpha-beta sandwich, center for st | 89.35 | |
| 2kok_A | 120 | Arsenate reductase; brucellosis, zoonotic, oxidore | 89.03 | |
| 1z3e_A | 132 | Regulatory protein SPX; bacterial transcription re | 88.74 | |
| 1h75_A | 81 | Glutaredoxin-like protein NRDH; electron transport | 88.36 | |
| 1ttz_A | 87 | Conserved hypothetical protein; structural genomic | 88.3 | |
| 2hls_A | 243 | Protein disulfide oxidoreductase; thioredoxin fold | 85.61 | |
| 2hyx_A | 352 | Protein DIPZ; thioredoxin fold, jelly-roll, struct | 85.29 | |
| 2e7p_A | 116 | Glutaredoxin; thioredoxin fold, poplar, electron t | 82.07 |
| >2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.75 E-value=7.2e-21 Score=134.08 Aligned_cols=87 Identities=20% Similarity=0.239 Sum_probs=75.0
Q ss_pred eeeEeeecCCCCCCCCchHHHHHHHHHcCC-CCcc-CCCCCcccccccCCCcccCCChhhHHHHH-HHHhhcCCeeeeec
Q 033504 5 LSNLIFKGIASYPSARSSRIVSGSLYHNGM-KYST-DVPNDPDTHEDFRPTSKVDASGLSLKEVV-EQDVKENPVMLYMK 81 (118)
Q Consensus 5 ~~~lfmKG~~~~P~CgfS~~~v~~l~~~~~-~~~~-dVl~d~d~r~dlK~ys~wpT~p~~l~~~I-k~li~~~~vvlfmK 81 (118)
=|||||||||+.|+|+||++++++|.+.|+ +|.+ ||++|++.|+.++.+++|||.|+ + .| .++|++++.+.-|.
T Consensus 21 ~VvvF~Kgt~~~P~C~fc~~ak~lL~~~gv~~~~~~~v~~~~~~r~~l~~~sg~~TvPq-I--FI~g~~IGG~Ddl~~l~ 97 (118)
T 2wul_A 21 KVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQ-V--YLNGEFVGGCDILLQMH 97 (118)
T ss_dssp SEEEEESBCSSSBSSHHHHHHHHHHHHTTCCSCEEEETTSCHHHHHHHHHHHTCCSSCE-E--EETTEEEECHHHHHHHH
T ss_pred CEEEEEcCCCCCCCCHHHHHHHHHHHHhCCcCeEeecccCCHHHHHHHHHhccCCCCCe-E--eECCEEECCHHHHHHHH
Confidence 379999999999999999999999999999 6999 99999999999999999999993 4 33 25666666666666
Q ss_pred CCCCCCCCcchHHHHHHHHhcC
Q 033504 82 GVPEFPQCGFSSLAVRVLGAYS 103 (118)
Q Consensus 82 Gtp~~P~CgFS~~~v~iL~~~~ 103 (118)
- |+++.++|++.|
T Consensus 98 ~---------~GeL~~lL~~~G 110 (118)
T 2wul_A 98 Q---------NGDLVEELKKLG 110 (118)
T ss_dssp H---------HTHHHHHHHHTT
T ss_pred H---------CCCHHHHHHHcC
Confidence 6 778888998888
|
| >2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} | Back alignment and structure |
|---|
| >3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A | Back alignment and structure |
|---|
| >3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A | Back alignment and structure |
|---|
| >2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A | Back alignment and structure |
|---|
| >1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A | Back alignment and structure |
|---|
| >1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A | Back alignment and structure |
|---|
| >1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A | Back alignment and structure |
|---|
| >2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* | Back alignment and structure |
|---|
| >2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} | Back alignment and structure |
|---|
| >1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A | Back alignment and structure |
|---|
| >3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* | Back alignment and structure |
|---|
| >2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} | Back alignment and structure |
|---|
| >1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A | Back alignment and structure |
|---|
| >1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* | Back alignment and structure |
|---|
| >3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* | Back alignment and structure |
|---|
| >2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* | Back alignment and structure |
|---|
| >2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* | Back alignment and structure |
|---|
| >3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* | Back alignment and structure |
|---|
| >2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} | Back alignment and structure |
|---|
| >3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* | Back alignment and structure |
|---|
| >2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B | Back alignment and structure |
|---|
| >1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* | Back alignment and structure |
|---|
| >2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rdw_A Putative arsenate reductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 2.20A {Yersinia pestis} | Back alignment and structure |
|---|
| >3gkx_A Putative ARSC family related protein; ARSC family protein, structural genomi 2, protein structure initiative; 2.20A {Bacteroides fragilis} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* | Back alignment and structure |
|---|
| >3l78_A Regulatory protein SPX; transcription, transcriptional factor, disulfide bond, redox-active center, transcription regulati; 1.90A {Streptococcus mutans} SCOP: c.47.1.12 | Back alignment and structure |
|---|
| >3fz4_A Putative arsenate reductase; APC61768, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.38A {Streptococcus mutans UA159} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1s3c_A Arsenate reductase; ARSC, arsenite, oxidoreductase; 1.25A {Escherichia coli} PDB: 1sd9_A 1i9d_A 1j9b_A 1sd8_A 1jzw_A* 1sk1_A* 1sjz_A* 1sk0_A* 1sk2_A 1s3d_A | Back alignment and structure |
|---|
| >3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* | Back alignment and structure |
|---|
| >2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* | Back alignment and structure |
|---|
| >2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A | Back alignment and structure |
|---|
| >1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 | Back alignment and structure |
|---|
| >2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* | Back alignment and structure |
|---|
| >1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A | Back alignment and structure |
|---|
| >2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B | Back alignment and structure |
|---|
| >1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3f0i_A Arsenate reductase; structural genomics, IDP01300, vibrio CH center for structural genomics of infectious diseases, CSGI oxidoreductase; HET: MSE; 1.88A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* | Back alignment and structure |
|---|
| >1z3e_A Regulatory protein SPX; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: c.47.1.12 PDB: 3gfk_A 3ihq_A | Back alignment and structure |
|---|
| >2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} | Back alignment and structure |
|---|
| >1rw1_A Conserved hypothetical protein YFFB; thioredoxin fold, structure 2 function project, S2F, structu genomics, unknown function; HET: MSE IPA; 1.02A {Pseudomonas aeruginosa} SCOP: c.47.1.12 | Back alignment and structure |
|---|
| >3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 | Back alignment and structure |
|---|
| >2kok_A Arsenate reductase; brucellosis, zoonotic, oxidoreductase, S genomics, seattle structural genomics center for infectious ssgcid; NMR {Brucella abortus} | Back alignment and structure |
|---|
| >3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A | Back alignment and structure |
|---|
| >2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} | Back alignment and structure |
|---|
| >1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* | Back alignment and structure |
|---|
| >2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >3gkx_A Putative ARSC family related protein; ARSC family protein, structural genomi 2, protein structure initiative; 2.20A {Bacteroides fragilis} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} | Back alignment and structure |
|---|
| >3rdw_A Putative arsenate reductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 2.20A {Yersinia pestis} | Back alignment and structure |
|---|
| >3f0i_A Arsenate reductase; structural genomics, IDP01300, vibrio CH center for structural genomics of infectious diseases, CSGI oxidoreductase; HET: MSE; 1.88A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1rw1_A Conserved hypothetical protein YFFB; thioredoxin fold, structure 2 function project, S2F, structu genomics, unknown function; HET: MSE IPA; 1.02A {Pseudomonas aeruginosa} SCOP: c.47.1.12 | Back alignment and structure |
|---|
| >1s3c_A Arsenate reductase; ARSC, arsenite, oxidoreductase; 1.25A {Escherichia coli} PDB: 1sd9_A 1i9d_A 1j9b_A 1sd8_A 1jzw_A* 1sk1_A* 1sjz_A* 1sk0_A* 1sk2_A 1s3d_A | Back alignment and structure |
|---|
| >3fz4_A Putative arsenate reductase; APC61768, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.38A {Streptococcus mutans UA159} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* | Back alignment and structure |
|---|
| >2kok_A Arsenate reductase; brucellosis, zoonotic, oxidoreductase, S genomics, seattle structural genomics center for infectious ssgcid; NMR {Brucella abortus} | Back alignment and structure |
|---|
| >1z3e_A Regulatory protein SPX; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: c.47.1.12 PDB: 3gfk_A 3ihq_A | Back alignment and structure |
|---|
| >1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A | Back alignment and structure |
|---|
| >2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 118 | ||||
| d1wika_ | 109 | c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (M | 3e-10 | |
| d1ktea_ | 105 | c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) | 2e-04 |
| >d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: Thioltransferase domain: Thioredoxin-like protein 2 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 51.2 bits (122), Expect = 3e-10
Identities = 13/40 (32%), Positives = 21/40 (52%)
Query: 60 GLSLKEVVEQDVKENPVMLYMKGVPEFPQCGFSSLAVRVL 99
G S ++ + VML+MKG + +CGFS + +L
Sbjct: 1 GSSGSSGLKVLTNKASVMLFMKGNKQEAKCGFSKQILEIL 40
|
| >d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 105 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 118 | |||
| d1wika_ | 109 | Thioredoxin-like protein 2 {Mouse (Mus musculus) [ | 99.58 | |
| d1wika_ | 109 | Thioredoxin-like protein 2 {Mouse (Mus musculus) [ | 99.41 | |
| d1fova_ | 82 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 98.15 | |
| d1ktea_ | 105 | Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr | 97.8 | |
| d1nm3a1 | 74 | C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus | 97.67 | |
| d1ktea_ | 105 | Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr | 97.48 | |
| d1abaa_ | 87 | Glutaredoxin (Grx, thioltransferase) {Bacteriophag | 97.47 | |
| d1r7ha_ | 74 | Glutaredoxin-like NRDH-redoxin {Corynebacterium am | 97.45 | |
| d1h75a_ | 76 | Glutaredoxin-like NRDH-redoxin {Escherichia coli [ | 97.28 | |
| d1t1va_ | 93 | SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} | 97.03 | |
| d1egoa_ | 85 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 96.21 | |
| d1nm3a1 | 74 | C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus | 96.07 | |
| d1fova_ | 82 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 96.07 | |
| d1abaa_ | 87 | Glutaredoxin (Grx, thioltransferase) {Bacteriophag | 95.98 | |
| d1r7ha_ | 74 | Glutaredoxin-like NRDH-redoxin {Corynebacterium am | 95.33 | |
| d1h75a_ | 76 | Glutaredoxin-like NRDH-redoxin {Escherichia coli [ | 95.0 | |
| d1z3ea1 | 114 | Regulatory protein Spx {Bacillus subtilis [TaxId: | 94.81 | |
| d1rw1a_ | 114 | Hypothetical protein PA3664 (YffB) {Pseudomonas ae | 94.6 | |
| d1j9ba_ | 138 | Arsenate reductase ArsC {Escherichia coli [TaxId: | 93.89 | |
| d1rw1a_ | 114 | Hypothetical protein PA3664 (YffB) {Pseudomonas ae | 92.61 | |
| d1egoa_ | 85 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 91.46 | |
| d1z3ea1 | 114 | Regulatory protein Spx {Bacillus subtilis [TaxId: | 91.12 | |
| d1aw9a2 | 81 | Class phi GST {Maize (Zea mays), type III [TaxId: | 86.67 | |
| d1t1va_ | 93 | SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} | 86.6 | |
| d1g7oa2 | 75 | Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | 85.15 | |
| d1ljra2 | 79 | Class theta GST {Human (Homo sapiens) [TaxId: 9606 | 84.26 | |
| d1k0ma2 | 86 | Chloride intracellular channel 1 (clic1) {Human (H | 82.77 | |
| d1k0da2 | 92 | Yeast prion protein ure2p, nitrogen regulation fra | 81.56 | |
| d1eema2 | 98 | Class omega GST {Human (Homo sapiens) [TaxId: 9606 | 80.62 | |
| d1gnwa2 | 84 | Class phi GST {Mouse-ear cress (Arabidopsis thalia | 80.09 |
| >d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: Thioltransferase domain: Thioredoxin-like protein 2 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.58 E-value=4.8e-18 Score=115.92 Aligned_cols=58 Identities=19% Similarity=0.239 Sum_probs=55.1
Q ss_pred eeeeEeeecCCCCCCCCchHHHHHHHHHcCCCCcc-CCCCCcccccccCCCcccCCChh
Q 033504 4 SLSNLIFKGIASYPSARSSRIVSGSLYHNGMKYST-DVPNDPDTHEDFRPTSKVDASGL 61 (118)
Q Consensus 4 ~~~~lfmKG~~~~P~CgfS~~~v~~l~~~~~~~~~-dVl~d~d~r~dlK~ys~wpT~p~ 61 (118)
.=+||||||||+.|+|+|++++.++|+++|++|.. |+.++++.++.++.+++|+|.|+
T Consensus 15 ~~VvvF~Kgt~~~p~Cp~c~~ak~lL~~~~i~~~~~~v~~~~~~~~~l~~~t~~~TvPq 73 (109)
T d1wika_ 15 ASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKTFSNWPTYPQ 73 (109)
T ss_dssp SSEEEEESSTTTCCCSSTHHHHHHHHHHTCSCEEEEESSSCHHHHHHHHHHHSCCSSCE
T ss_pred CCEEEEeCCCCCCCCChHHHHHHHHHHhcCCCceEEEecccHHHHHHHHHhcCCCCCCe
Confidence 34899999999999999999999999999999999 99999999999999999999993
|
| >d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} | Back information, alignment and structure |
|---|
| >d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} | Back information, alignment and structure |
|---|
| >d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z3ea1 c.47.1.12 (A:1-114) Regulatory protein Spx {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1rw1a_ c.47.1.12 (A:) Hypothetical protein PA3664 (YffB) {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1j9ba_ c.47.1.12 (A:) Arsenate reductase ArsC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rw1a_ c.47.1.12 (A:) Hypothetical protein PA3664 (YffB) {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z3ea1 c.47.1.12 (A:1-114) Regulatory protein Spx {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|