Citrus Sinensis ID: 033555
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 117 | ||||||
| 296082984 | 117 | unnamed protein product [Vitis vinifera] | 1.0 | 1.0 | 0.914 | 7e-57 | |
| 224141467 | 117 | predicted protein [Populus trichocarpa] | 1.0 | 1.0 | 0.880 | 2e-54 | |
| 224077714 | 117 | predicted protein [Populus trichocarpa] | 1.0 | 1.0 | 0.863 | 3e-54 | |
| 449447408 | 117 | PREDICTED: membrane-anchored ubiquitin-f | 1.0 | 1.0 | 0.846 | 4e-52 | |
| 388511339 | 117 | unknown [Lotus japonicus] | 1.0 | 1.0 | 0.820 | 2e-51 | |
| 356526475 | 117 | PREDICTED: membrane-anchored ubiquitin-f | 1.0 | 1.0 | 0.829 | 2e-51 | |
| 351734482 | 117 | uncharacterized protein LOC100306015 [Gl | 1.0 | 1.0 | 0.811 | 2e-50 | |
| 358248372 | 117 | uncharacterized protein LOC100802048 [Gl | 1.0 | 1.0 | 0.811 | 3e-50 | |
| 356551104 | 117 | PREDICTED: membrane-anchored ubiquitin-f | 1.0 | 1.0 | 0.777 | 2e-49 | |
| 359488963 | 132 | PREDICTED: membrane-anchored ubiquitin-f | 1.0 | 0.886 | 0.789 | 5e-48 |
| >gi|296082984|emb|CBI22285.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 224 bits (570), Expect = 7e-57, Method: Compositional matrix adjust.
Identities = 107/117 (91%), Positives = 114/117 (97%)
Query: 1 MASVQDQLEIKFRLTDGSDIGPKSFPAATSVATLKESVLSQWPKEKENGPRTVKDVKLIS 60
M+ VQDQLEIKFRLTDGSDIGPKSF AATSVATLKE+VL+QWPKEKENGP+TVKDVKLIS
Sbjct: 1 MSGVQDQLEIKFRLTDGSDIGPKSFSAATSVATLKENVLAQWPKEKENGPKTVKDVKLIS 60
Query: 61 AGKILENNRTLGECRSPLCDIPGGVTTMHVVVQPPSTEKEKKAASQPKQNKCVCVIL 117
AGKILENNRT+GECRSPLCDIPGGVTTMHVVVQPPS++KEKK ASQPKQNKCVCVIL
Sbjct: 61 AGKILENNRTIGECRSPLCDIPGGVTTMHVVVQPPSSDKEKKVASQPKQNKCVCVIL 117
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224141467|ref|XP_002324093.1| predicted protein [Populus trichocarpa] gi|222867095|gb|EEF04226.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224077714|ref|XP_002305375.1| predicted protein [Populus trichocarpa] gi|118489660|gb|ABK96631.1| unknown [Populus trichocarpa x Populus deltoides] gi|222848339|gb|EEE85886.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449447408|ref|XP_004141460.1| PREDICTED: membrane-anchored ubiquitin-fold protein 1-like isoform 1 [Cucumis sativus] gi|449447410|ref|XP_004141461.1| PREDICTED: membrane-anchored ubiquitin-fold protein 1-like isoform 2 [Cucumis sativus] gi|449521944|ref|XP_004167989.1| PREDICTED: membrane-anchored ubiquitin-fold protein 1-like isoform 1 [Cucumis sativus] gi|449521946|ref|XP_004167990.1| PREDICTED: membrane-anchored ubiquitin-fold protein 1-like isoform 2 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|388511339|gb|AFK43731.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|356526475|ref|XP_003531843.1| PREDICTED: membrane-anchored ubiquitin-fold protein 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|351734482|ref|NP_001236306.1| uncharacterized protein LOC100306015 [Glycine max] gi|255627285|gb|ACU13987.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|358248372|ref|NP_001239615.1| uncharacterized protein LOC100802048 [Glycine max] gi|255647353|gb|ACU24143.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356551104|ref|XP_003543918.1| PREDICTED: membrane-anchored ubiquitin-fold protein 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|359488963|ref|XP_002284262.2| PREDICTED: membrane-anchored ubiquitin-fold protein 2 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 117 | ||||||
| TAIR|locus:2102172 | 117 | MUB1 "AT3G01050" [Arabidopsis | 1.0 | 1.0 | 0.666 | 7.5e-41 | |
| TAIR|locus:2180937 | 124 | MUB2 "AT5G15460" [Arabidopsis | 0.982 | 0.927 | 0.694 | 2e-40 | |
| TAIR|locus:2030616 | 119 | MUB6 "AT1G22050" [Arabidopsis | 1.0 | 0.983 | 0.546 | 6.7e-33 | |
| TAIR|locus:2029466 | 120 | MUB5 "AT1G77870" [Arabidopsis | 0.965 | 0.941 | 0.521 | 1.6e-29 | |
| TAIR|locus:2117383 | 118 | ATGP4 "AT4G24990" [Arabidopsis | 0.965 | 0.957 | 0.530 | 1e-27 | |
| TAIR|locus:2091975 | 120 | MUB4 "AT3G26980" [Arabidopsis | 0.965 | 0.941 | 0.461 | 8.4e-26 | |
| ZFIN|ZDB-GENE-030131-3431 | 117 | ubl3a "ubiquitin-like 3a" [Dan | 0.905 | 0.905 | 0.275 | 6.3e-05 | |
| ASPGD|ASPL0000076025 | 253 | AN4732 [Emericella nidulans (t | 0.692 | 0.320 | 0.313 | 0.0003 | |
| UNIPROTKB|F1P389 | 109 | UBL3 "Uncharacterized protein" | 0.752 | 0.807 | 0.278 | 0.00035 | |
| UNIPROTKB|Q2TA46 | 117 | UBL3 "Ubiquitin-like protein 3 | 0.905 | 0.905 | 0.25 | 0.00057 |
| TAIR|locus:2102172 MUB1 "AT3G01050" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 434 (157.8 bits), Expect = 7.5e-41, P = 7.5e-41
Identities = 78/117 (66%), Positives = 100/117 (85%)
Query: 1 MASVQDQLEIKFRLTDGSDIGPKSFPAATSVATLKESVLSQWPKEKENGPRTVKDVKLIS 60
MA V +QLEIKFRLTDGSDIGPK+FP AT+V+ LKE+V+S+WP+EKENGP+TVK+VKLIS
Sbjct: 1 MAEVHNQLEIKFRLTDGSDIGPKAFPDATTVSALKETVISEWPREKENGPKTVKEVKLIS 60
Query: 61 AGKILENNRTLGECRSPLCDIPGGVTTMHVVVQPPSTEKEKKAASQPKQNKCVCVIL 117
AGK+LEN++T+ + RSP+ ++ G VTTMHV++Q P TEKEKK PK NKCVC ++
Sbjct: 61 AGKVLENSKTVKDYRSPVSNLAGAVTTMHVIIQAPVTEKEKKPKGDPKMNKCVCSVM 117
|
|
| TAIR|locus:2180937 MUB2 "AT5G15460" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2030616 MUB6 "AT1G22050" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2029466 MUB5 "AT1G77870" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2117383 ATGP4 "AT4G24990" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2091975 MUB4 "AT3G26980" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-3431 ubl3a "ubiquitin-like 3a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000076025 AN4732 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P389 UBL3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2TA46 UBL3 "Ubiquitin-like protein 3" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh4_pm.C_LG_XVII000155 | hypothetical protein (117 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 117 | |||
| pfam13881 | 111 | pfam13881, Rad60-SLD_2, Ubiquitin-2 like Rad60 SUM | 3e-60 | |
| cd01814 | 113 | cd01814, NTGP5, Ubiquitin-like NTGP5 and ATGP4 | 5e-60 | |
| cd01769 | 69 | cd01769, UBL, Ubiquitin-like domain of UBL | 0.002 | |
| pfam00240 | 69 | pfam00240, ubiquitin, Ubiquitin family | 0.003 |
| >gnl|CDD|206052 pfam13881, Rad60-SLD_2, Ubiquitin-2 like Rad60 SUMO-like | Back alignment and domain information |
|---|
Score = 179 bits (457), Expect = 3e-60
Identities = 68/111 (61%), Positives = 82/111 (73%), Gaps = 1/111 (0%)
Query: 6 DQLEIKFRLTDGSDIGPKSFPAATSVATLKESVLSQWPKEKENGPRTVKDVKLISAGKIL 65
+ +E+KFRL DGSDIGP F AT+VA LKE VL+QWPK+KE GP++ DVKLI+AGKIL
Sbjct: 1 ELIELKFRLVDGSDIGPFRFSPATTVADLKEKVLAQWPKDKEEGPKSPNDVKLINAGKIL 60
Query: 66 ENNRTLGECRSPLCDIPGGVTTMHVVVQPPSTEKEK-KAASQPKQNKCVCV 115
ENN+TLGECR P + PGGV MHVVV+PP E K ++PKQ C C
Sbjct: 61 ENNKTLGECRLPAGETPGGVIVMHVVVRPPLPEPNSEKKRNKPKQTGCGCC 111
|
Length = 111 |
| >gnl|CDD|176409 cd01814, NTGP5, Ubiquitin-like NTGP5 and ATGP4 | Back alignment and domain information |
|---|
| >gnl|CDD|176364 cd01769, UBL, Ubiquitin-like domain of UBL | Back alignment and domain information |
|---|
| >gnl|CDD|215813 pfam00240, ubiquitin, Ubiquitin family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 117 | |||
| PF13881 | 111 | Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB | 99.97 | |
| cd01814 | 113 | NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT | 99.97 | |
| cd01807 | 74 | GDX_N ubiquitin-like domain of GDX. GDX contains a | 99.79 | |
| cd01793 | 74 | Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui | 99.78 | |
| cd01794 | 70 | DC_UbP_C dendritic cell derived ubiquitin-like pro | 99.77 | |
| cd01790 | 79 | Herp_N Homocysteine-responsive endoplasmic reticul | 99.77 | |
| cd01802 | 103 | AN1_N ubiquitin-like domain of AN1. AN1 (also know | 99.76 | |
| cd01797 | 78 | NIRF_N amino-terminal ubiquitin-like domain of Np9 | 99.76 | |
| cd01810 | 74 | ISG15_repeat2 ISG15 ubiquitin-like protein, second | 99.74 | |
| PTZ00044 | 76 | ubiquitin; Provisional | 99.74 | |
| cd01791 | 73 | Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know | 99.74 | |
| cd01798 | 70 | parkin_N amino-terminal ubiquitin-like of parkin p | 99.74 | |
| cd01806 | 76 | Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn | 99.71 | |
| cd01804 | 78 | midnolin_N Ubiquitin-like domain of midnolin. midn | 99.7 | |
| cd01803 | 76 | Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 | 99.69 | |
| cd01805 | 77 | RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo | 99.69 | |
| cd01808 | 71 | hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC | 99.68 | |
| KOG0005 | 70 | consensus Ubiquitin-like protein [Cell cycle contr | 99.68 | |
| cd01792 | 80 | ISG15_repeat1 ISG15 ubiquitin-like protein, first | 99.68 | |
| cd01809 | 72 | Scythe_N Ubiquitin-like domain of Scythe protein. | 99.67 | |
| PF00240 | 69 | ubiquitin: Ubiquitin family; InterPro: IPR000626 U | 99.67 | |
| cd01796 | 71 | DDI1_N DNA damage inducible protein 1 ubiquitin-li | 99.66 | |
| KOG0003 | 128 | consensus Ubiquitin/60s ribosomal protein L40 fusi | 99.64 | |
| cd01800 | 76 | SF3a120_C Ubiquitin-like domain of Mammalian splic | 99.62 | |
| KOG0004 | 156 | consensus Ubiquitin/40S ribosomal protein S27a fus | 99.59 | |
| cd01812 | 71 | BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter | 99.58 | |
| cd01763 | 87 | Sumo Small ubiquitin-related modifier (SUMO). Smal | 99.57 | |
| cd01815 | 75 | BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC | 99.56 | |
| TIGR00601 | 378 | rad23 UV excision repair protein Rad23. All protei | 99.51 | |
| cd01813 | 74 | UBP_N UBP ubiquitin processing protease. The UBP ( | 99.5 | |
| KOG0010 | 493 | consensus Ubiquitin-like protein [Posttranslationa | 99.48 | |
| smart00213 | 64 | UBQ Ubiquitin homologues. Ubiquitin-mediated prote | 99.45 | |
| cd01799 | 75 | Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO | 99.41 | |
| KOG0011 | 340 | consensus Nucleotide excision repair factor NEF2, | 99.4 | |
| cd01769 | 69 | UBL Ubiquitin-like domain of UBL. UBLs function by | 99.26 | |
| PF11976 | 72 | Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter | 99.12 | |
| KOG4248 | 1143 | consensus Ubiquitin-like protein, regulator of apo | 99.04 | |
| cd01795 | 107 | USP48_C USP ubiquitin-specific protease. The USP ( | 98.95 | |
| cd01789 | 84 | Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol | 98.93 | |
| KOG0001 | 75 | consensus Ubiquitin and ubiquitin-like proteins [P | 98.85 | |
| PLN02560 | 308 | enoyl-CoA reductase | 98.77 | |
| PF10302 | 97 | DUF2407: DUF2407 ubiquitin-like domain; InterPro: | 98.77 | |
| cd01788 | 119 | ElonginB Ubiquitin-like domain of Elongin B. Elong | 98.66 | |
| cd01801 | 77 | Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N- | 98.53 | |
| PF14560 | 87 | Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K | 98.47 | |
| cd00196 | 69 | UBQ Ubiquitin-like proteins. Ubiquitin homologs; I | 98.26 | |
| KOG0006 | 446 | consensus E3 ubiquitin-protein ligase (Parkin prot | 98.11 | |
| PF00789 | 82 | UBX: UBX domain; InterPro: IPR001012 The UBX domai | 98.0 | |
| cd01811 | 80 | OASL_repeat1 2'-5' oligoadenylate synthetase-like | 97.84 | |
| cd01770 | 79 | p47_UBX p47-like ubiquitin domain. p47_UBX p47 is | 97.82 | |
| PF11543 | 80 | UN_NPL4: Nuclear pore localisation protein NPL4; I | 97.8 | |
| KOG4495 | 110 | consensus RNA polymerase II transcription elongati | 97.62 | |
| PF08817 | 79 | YukD: WXG100 protein secretion system (Wss), prote | 97.27 | |
| cd01774 | 85 | Faf1_like2_UBX Faf1 ike-2 UBX domain. Faf1_like2 i | 97.26 | |
| cd01767 | 77 | UBX UBX (ubiquitin regulatory X) domain. The UBX ( | 97.09 | |
| smart00166 | 80 | UBX Domain present in ubiquitin-regulatory protein | 97.05 | |
| KOG1769 | 99 | consensus Ubiquitin-like proteins [Posttranslation | 97.03 | |
| cd01772 | 79 | SAKS1_UBX SAKS1-like UBX domain. SAKS1 (SAPK-subst | 97.0 | |
| KOG4583 | 391 | consensus Membrane-associated ER protein involved | 96.86 | |
| KOG1872 | 473 | consensus Ubiquitin-specific protease [Posttransla | 96.65 | |
| KOG0013 | 231 | consensus Uncharacterized conserved protein [Funct | 96.62 | |
| PF13019 | 162 | Telomere_Sde2: Telomere stability and silencing | 96.55 | |
| COG5417 | 81 | Uncharacterized small protein [Function unknown] | 96.02 | |
| cd01771 | 80 | Faf1_UBX Faf1 UBX domain. Faf1 (fas-associated fac | 96.01 | |
| cd01773 | 82 | Faf1_like1_UBX Faf1 ike-1 UBX domain. Faf1_like1 i | 95.14 | |
| COG5227 | 103 | SMT3 Ubiquitin-like protein (sentrin) [Posttransla | 94.99 | |
| PF15044 | 76 | CLU_N: Mitochondrial function, CLU-N-term | 94.16 | |
| KOG3493 | 73 | consensus Ubiquitin-like protein [Posttranslationa | 93.31 | |
| KOG2086 | 380 | consensus Protein tyrosine phosphatase SHP1/Cofact | 92.92 | |
| TIGR01682 | 80 | moaD molybdopterin converting factor, subunit 1, n | 91.49 | |
| PLN02799 | 82 | Molybdopterin synthase sulfur carrier subunit | 90.87 | |
| PF09379 | 80 | FERM_N: FERM N-terminal domain ; InterPro: IPR0189 | 90.58 | |
| KOG1639 | 297 | consensus Steroid reductase required for elongatio | 89.62 | |
| KOG3206 | 234 | consensus Alpha-tubulin folding cofactor B [Posttr | 89.4 | |
| PRK08364 | 70 | sulfur carrier protein ThiS; Provisional | 89.39 | |
| PRK06437 | 67 | hypothetical protein; Provisional | 88.28 | |
| TIGR01687 | 88 | moaD_arch MoaD family protein, archaeal. Members o | 87.83 | |
| cd00754 | 80 | MoaD Ubiquitin domain of MoaD-like proteins. MoaD | 87.72 | |
| PF11470 | 65 | TUG-UBL1: GLUT4 regulating protein TUG; InterPro: | 86.96 | |
| PF02597 | 77 | ThiS: ThiS family; InterPro: IPR003749 ThiS (thiam | 86.26 | |
| cd06409 | 86 | PB1_MUG70 The MUG70 protein is a product of the me | 83.32 | |
| PF10790 | 76 | DUF2604: Protein of Unknown function (DUF2604); In | 83.12 | |
| cd06406 | 80 | PB1_P67 A PB1 domain is present in p67 proteins wh | 82.69 | |
| smart00295 | 207 | B41 Band 4.1 homologues. Also known as ezrin/radix | 82.64 | |
| PF06234 | 85 | TmoB: Toluene-4-monooxygenase system protein B (Tm | 81.82 | |
| PF00564 | 84 | PB1: PB1 domain; InterPro: IPR000270 The Phox and | 80.88 |
| >PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A | Back alignment and domain information |
|---|
Probab=99.97 E-value=1.3e-31 Score=185.33 Aligned_cols=110 Identities=48% Similarity=0.925 Sum_probs=84.2
Q ss_pred ceeEEEEEeCCCceeeeeecCCCCcHHHHHHHhhhcCCCcccCCCCCCCceeEEecCeecCCCCcccccCCCCCCCCCCe
Q 033555 6 DQLEIKFRLTDGSDIGPKSFPAATSVATLKESVLSQWPKEKENGPRTVKDVKLISAGKILENNRTLGECRSPLCDIPGGV 85 (117)
Q Consensus 6 ~~~~i~~~~~~G~~~~~l~~~~~~TV~~lK~~I~~~wp~~~~~~p~~~~~qrLI~~Gk~L~D~~tL~~~~i~~g~~~~~~ 85 (117)
+.|+|+|++.+|.++.++.+++++||++||+.|+++||+||+..|.+++.+||||+||+|+|+.||++|+++.++.++.+
T Consensus 1 ~~i~lkf~l~~G~d~~~~~~~~~~TV~~lKe~i~~~WP~d~~~~p~s~~~lRLI~~GriL~d~~tL~~~~~~~~~~~~~~ 80 (111)
T PF13881_consen 1 DKIELKFRLADGKDIGPFRFDPSTTVADLKERIWAEWPEDWEERPKSPSDLRLIYAGRILEDNKTLSDCRLPSGETPGGP 80 (111)
T ss_dssp TSEEEEEEETTS-EEEEEEE-TTSBHHHHHHHHHHSSSTTSSSTT-SGGGEEEEETTEEE-SSSBTGGGT--TTSETT--
T ss_pred CeEEEEEEEeCCCcccccccCccChHHHHHHHHHHHCccccccCCCChhhEEEEeCCeecCCcCcHHHhCCCCCCCCCCC
Confidence 47999999999996667999999999999999999999999988889999999999999999999999999988766667
Q ss_pred EEEEEEeCCCCchhhh-hhccCCCCCCeeEe
Q 033555 86 TTMHVVVQPPSTEKEK-KAASQPKQNKCVCV 115 (117)
Q Consensus 86 ~tmhlv~~~~~~~~~~-~~~~~~~~~~c~c~ 115 (117)
++|||+++++.++++. +..+..++.+|+|+
T Consensus 81 ~vmHlvvrp~~~~~~~~~~~~~~k~~~C~C~ 111 (111)
T PF13881_consen 81 TVMHLVVRPNAPEPNEEKKRKKPKQSGCSCC 111 (111)
T ss_dssp EEEEEEE-SSSSSSSSSS-----STT-----
T ss_pred EEEEEEecCCCCCccccccccCcCCCCCCCC
Confidence 9999999999988876 45556789999995
|
|
| >cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4 | Back alignment and domain information |
|---|
| >cd01807 GDX_N ubiquitin-like domain of GDX | Back alignment and domain information |
|---|
| >cd01793 Fubi Fubi ubiquitin-like protein | Back alignment and domain information |
|---|
| >cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein | Back alignment and domain information |
|---|
| >cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein | Back alignment and domain information |
|---|
| >cd01802 AN1_N ubiquitin-like domain of AN1 | Back alignment and domain information |
|---|
| >cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF | Back alignment and domain information |
|---|
| >cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 | Back alignment and domain information |
|---|
| >PTZ00044 ubiquitin; Provisional | Back alignment and domain information |
|---|
| >cd01791 Ubl5 UBL5 ubiquitin-like modifier | Back alignment and domain information |
|---|
| >cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein | Back alignment and domain information |
|---|
| >cd01806 Nedd8 Nebb8-like ubiquitin protein | Back alignment and domain information |
|---|
| >cd01804 midnolin_N Ubiquitin-like domain of midnolin | Back alignment and domain information |
|---|
| >cd01803 Ubiquitin Ubiquitin | Back alignment and domain information |
|---|
| >cd01805 RAD23_N Ubiquitin-like domain of RAD23 | Back alignment and domain information |
|---|
| >cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 | Back alignment and domain information |
|---|
| >KOG0005 consensus Ubiquitin-like protein [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 | Back alignment and domain information |
|---|
| >cd01809 Scythe_N Ubiquitin-like domain of Scythe protein | Back alignment and domain information |
|---|
| >PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade | Back alignment and domain information |
|---|
| >cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain | Back alignment and domain information |
|---|
| >KOG0003 consensus Ubiquitin/60s ribosomal protein L40 fusion [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 | Back alignment and domain information |
|---|
| >KOG0004 consensus Ubiquitin/40S ribosomal protein S27a fusion [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd01812 BAG1_N Ubiquitin-like domain of BAG1 | Back alignment and domain information |
|---|
| >cd01763 Sumo Small ubiquitin-related modifier (SUMO) | Back alignment and domain information |
|---|
| >cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP | Back alignment and domain information |
|---|
| >TIGR00601 rad23 UV excision repair protein Rad23 | Back alignment and domain information |
|---|
| >cd01813 UBP_N UBP ubiquitin processing protease | Back alignment and domain information |
|---|
| >KOG0010 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones; General function prediction only] | Back alignment and domain information |
|---|
| >smart00213 UBQ Ubiquitin homologues | Back alignment and domain information |
|---|
| >cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 | Back alignment and domain information |
|---|
| >KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd01769 UBL Ubiquitin-like domain of UBL | Back alignment and domain information |
|---|
| >PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins | Back alignment and domain information |
|---|
| >KOG4248 consensus Ubiquitin-like protein, regulator of apoptosis [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01795 USP48_C USP ubiquitin-specific protease | Back alignment and domain information |
|---|
| >cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B | Back alignment and domain information |
|---|
| >KOG0001 consensus Ubiquitin and ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones; General function prediction only] | Back alignment and domain information |
|---|
| >PLN02560 enoyl-CoA reductase | Back alignment and domain information |
|---|
| >PF10302 DUF2407: DUF2407 ubiquitin-like domain; InterPro: IPR019413 This entry represents a family of proteins of unknown function found in fungi | Back alignment and domain information |
|---|
| >cd01788 ElonginB Ubiquitin-like domain of Elongin B | Back alignment and domain information |
|---|
| >cd01801 Tsc13_N Ubiquitin-like domain of Tsc13 | Back alignment and domain information |
|---|
| >PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A | Back alignment and domain information |
|---|
| >cd00196 UBQ Ubiquitin-like proteins | Back alignment and domain information |
|---|
| >KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast | Back alignment and domain information |
|---|
| >cd01811 OASL_repeat1 2'-5' oligoadenylate synthetase-like protein, repeat 1 of 2 | Back alignment and domain information |
|---|
| >cd01770 p47_UBX p47-like ubiquitin domain | Back alignment and domain information |
|---|
| >PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway | Back alignment and domain information |
|---|
| >KOG4495 consensus RNA polymerase II transcription elongation factor Elongin/SIII, subunit elongin B [Transcription] | Back alignment and domain information |
|---|
| >PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold [] | Back alignment and domain information |
|---|
| >cd01774 Faf1_like2_UBX Faf1 ike-2 UBX domain | Back alignment and domain information |
|---|
| >cd01767 UBX UBX (ubiquitin regulatory X) domain | Back alignment and domain information |
|---|
| >smart00166 UBX Domain present in ubiquitin-regulatory proteins | Back alignment and domain information |
|---|
| >KOG1769 consensus Ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01772 SAKS1_UBX SAKS1-like UBX domain | Back alignment and domain information |
|---|
| >KOG4583 consensus Membrane-associated ER protein involved in stress response (contains ubiquitin-like domain) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1872 consensus Ubiquitin-specific protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0013 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13019 Telomere_Sde2: Telomere stability and silencing | Back alignment and domain information |
|---|
| >COG5417 Uncharacterized small protein [Function unknown] | Back alignment and domain information |
|---|
| >cd01771 Faf1_UBX Faf1 UBX domain | Back alignment and domain information |
|---|
| >cd01773 Faf1_like1_UBX Faf1 ike-1 UBX domain | Back alignment and domain information |
|---|
| >COG5227 SMT3 Ubiquitin-like protein (sentrin) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF15044 CLU_N: Mitochondrial function, CLU-N-term | Back alignment and domain information |
|---|
| >KOG3493 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2086 consensus Protein tyrosine phosphatase SHP1/Cofactor for p97 ATPase-mediated vesicle membrane fusion [Nuclear structure] | Back alignment and domain information |
|---|
| >TIGR01682 moaD molybdopterin converting factor, subunit 1, non-archaeal | Back alignment and domain information |
|---|
| >PLN02799 Molybdopterin synthase sulfur carrier subunit | Back alignment and domain information |
|---|
| >PF09379 FERM_N: FERM N-terminal domain ; InterPro: IPR018979 This domain is the N-terminal ubiquitin-like structural domain of the FERM domain | Back alignment and domain information |
|---|
| >KOG1639 consensus Steroid reductase required for elongation of the very long chain fatty acids [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3206 consensus Alpha-tubulin folding cofactor B [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08364 sulfur carrier protein ThiS; Provisional | Back alignment and domain information |
|---|
| >PRK06437 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01687 moaD_arch MoaD family protein, archaeal | Back alignment and domain information |
|---|
| >cd00754 MoaD Ubiquitin domain of MoaD-like proteins | Back alignment and domain information |
|---|
| >PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly | Back alignment and domain information |
|---|
| >PF02597 ThiS: ThiS family; InterPro: IPR003749 ThiS (thiaminS) is a 66 aa protein involved in sulphur transfer | Back alignment and domain information |
|---|
| >cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain | Back alignment and domain information |
|---|
| >PF10790 DUF2604: Protein of Unknown function (DUF2604); InterPro: IPR019726 This entry represents bacterial proteins with undetermined function | Back alignment and domain information |
|---|
| >cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of NADPH oxidase during phagocytosis | Back alignment and domain information |
|---|
| >smart00295 B41 Band 4 | Back alignment and domain information |
|---|
| >PF06234 TmoB: Toluene-4-monooxygenase system protein B (TmoB); InterPro: IPR009355 This family consists of several Toluene-4-monooxygenase system protein B (TmoB) sequences | Back alignment and domain information |
|---|
| >PF00564 PB1: PB1 domain; InterPro: IPR000270 The Phox and Bem1p domain, is present in many eukaryotic cytoplasmic signalling proteins | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 117 | ||||
| 1se9_A | 126 | Structure Of At3g01050, A Ubiquitin-Fold Protein Fr | 1e-43 |
| >pdb|1SE9|A Chain A, Structure Of At3g01050, A Ubiquitin-Fold Protein From Arabidopsis Thaliana Length = 126 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 117 | |||
| 1se9_A | 126 | Ubiquitin family; ubiquitin-like, cell-free, wheat | 1e-56 | |
| 2gow_A | 125 | HCG-1 protein, ubiquitin-like protein 3; BC059385, | 7e-35 | |
| 1wgh_A | 116 | Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo | 2e-27 | |
| 1uel_A | 95 | HHR23B, UV excision repair protein RAD23 homolog B | 2e-04 | |
| 3m63_B | 101 | Ubiquitin domain-containing protein DSK2; armadill | 3e-04 | |
| 2bwf_A | 77 | Ubiquitin-like protein DSK2; signaling protein, UB | 5e-04 | |
| 4dwf_A | 90 | HLA-B-associated transcript 3; ubiquitin-like doma | 6e-04 | |
| 1wgd_A | 93 | Homocysteine-responsive endoplasmic reticulum- res | 7e-04 | |
| 1yqb_A | 100 | Ubiquilin 3; structural genomics consortium, ubiqu | 7e-04 |
| >1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Length = 126 | Back alignment and structure |
|---|
Score = 170 bits (432), Expect = 1e-56
Identities = 77/116 (66%), Positives = 99/116 (85%)
Query: 2 ASVQDQLEIKFRLTDGSDIGPKSFPAATSVATLKESVLSQWPKEKENGPRTVKDVKLISA 61
A V +QLEIKFRLTDGSDIGPK+FP AT+V+ LKE+V+S+WP+EKENGP+TVK+VKLISA
Sbjct: 11 AEVHNQLEIKFRLTDGSDIGPKAFPDATTVSALKETVISEWPREKENGPKTVKEVKLISA 70
Query: 62 GKILENNRTLGECRSPLCDIPGGVTTMHVVVQPPSTEKEKKAASQPKQNKCVCVIL 117
GK+LEN++T+ + RSP+ ++ G VTTMHV++Q P TEKEKK PK NKCVC ++
Sbjct: 71 GKVLENSKTVKDYRSPVSNLAGAVTTMHVIIQAPVTEKEKKPKGDPKMNKCVCSVM 126
|
| >2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Length = 116 | Back alignment and structure |
|---|
| >1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 95 | Back alignment and structure |
|---|
| >3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 101 | Back alignment and structure |
|---|
| >2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Length = 77 | Back alignment and structure |
|---|
| >4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Length = 90 | Back alignment and structure |
|---|
| >1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 93 | Back alignment and structure |
|---|
| >1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Length = 100 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 117 | |||
| 1se9_A | 126 | Ubiquitin family; ubiquitin-like, cell-free, wheat | 100.0 | |
| 2gow_A | 125 | HCG-1 protein, ubiquitin-like protein 3; BC059385, | 99.97 | |
| 1wgh_A | 116 | Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo | 99.94 | |
| 3phx_B | 79 | Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu | 99.81 | |
| 3plu_A | 93 | Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- | 99.81 | |
| 1wgd_A | 93 | Homocysteine-responsive endoplasmic reticulum- res | 99.8 | |
| 4eew_A | 88 | Large proline-rich protein BAG6; ubiquitin-like fo | 99.79 | |
| 4dwf_A | 90 | HLA-B-associated transcript 3; ubiquitin-like doma | 99.79 | |
| 1uh6_A | 100 | Ubiquitin-like 5; beta-grAsp fold, structural geno | 99.79 | |
| 2lxa_A | 87 | Ubiquitin-like protein MDY2; ubiquitin-like domain | 99.78 | |
| 3dbh_I | 88 | NEDD8; cell cycle, activating enzyme, apoptosis, m | 99.78 | |
| 4fbj_B | 88 | NEDD8; effector-HOST target complex, glutamine dea | 99.78 | |
| 2uyz_B | 79 | Small ubiquitin-related modifier 1; sumoylation, c | 99.78 | |
| 1wh3_A | 87 | 59 kDa 2'-5'-oligoadenylate synthetase like protei | 99.78 | |
| 2kdb_A | 99 | Homocysteine-responsive endoplasmic reticulum- res | 99.78 | |
| 2dzi_A | 81 | Ubiquitin-like protein 4A; GDX, structural genomic | 99.77 | |
| 3v6c_B | 91 | Ubiquitin; structural genomics, structural genomic | 99.77 | |
| 1wy8_A | 89 | NP95-like ring finger protein, isoform A; ubiquiti | 99.77 | |
| 4a20_A | 98 | Ubiquitin-like protein MDY2; protein binding, GET- | 99.77 | |
| 2wyq_A | 85 | HHR23A, UV excision repair protein RAD23 homolog A | 99.77 | |
| 2kk8_A | 84 | Uncharacterized protein AT4G05270; solution arabid | 99.76 | |
| 1wju_A | 100 | NEDD8 ultimate buster-1; ubiquitin-like domain, st | 99.76 | |
| 2faz_A | 78 | Ubiquitin-like containing PHD and ring finger DOM | 99.76 | |
| 4hcn_B | 98 | Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas | 99.76 | |
| 1ndd_A | 76 | NEDD8, protein (ubiquitin-like protein NEDD8); pro | 99.75 | |
| 3m62_B | 106 | UV excision repair protein RAD23; armadillo-like r | 99.75 | |
| 3n3k_B | 85 | Ubiquitin; hydrolase, protease, thiol protease, DU | 99.75 | |
| 3k9o_B | 96 | Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b | 99.75 | |
| 2hj8_A | 88 | Interferon-induced 17 kDa protein; HR2873B, human | 99.75 | |
| 1wia_A | 95 | Hypothetical ubiquitin-like protein (riken cDNA 20 | 99.75 | |
| 1wyw_B | 97 | Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho | 99.75 | |
| 3mtn_B | 85 | UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit | 99.75 | |
| 2daf_A | 118 | FLJ35834 protein; hypothetical protein FLJ35834, u | 99.75 | |
| 2kan_A | 94 | Uncharacterized protein AR3433A; ubiquitin fold, a | 99.75 | |
| 1v2y_A | 105 | 3300001G02RIK protein; hypothetical protein, ubiqu | 99.74 | |
| 1uel_A | 95 | HHR23B, UV excision repair protein RAD23 homolog B | 99.74 | |
| 3a9j_A | 76 | Ubiquitin; protein complex, cytoplasm, isopeptide | 99.74 | |
| 1j8c_A | 125 | Ubiquitin-like protein hplic-2; ubiquitin-like dom | 99.74 | |
| 4ajy_B | 118 | Transcription elongation factor B polypeptide 2; E | 99.74 | |
| 1sif_A | 88 | Ubiquitin; hydrophobic mutants, folding, stability | 99.73 | |
| 1yqb_A | 100 | Ubiquilin 3; structural genomics consortium, ubiqu | 99.73 | |
| 2bwf_A | 77 | Ubiquitin-like protein DSK2; signaling protein, UB | 99.73 | |
| 3vdz_A | 111 | Ubiquitin-40S ribosomal protein S27A; gadolinium, | 99.72 | |
| 1wx8_A | 96 | Riken cDNA 4931431F19; ubiquitin-like domain, ubiq | 99.72 | |
| 2fnj_B | 118 | Transcription elongation factor B polypeptide 2; b | 99.72 | |
| 2klc_A | 101 | Ubiquilin-1; ubiquitin-like, structural genomics, | 99.72 | |
| 1wx7_A | 106 | Ubiquilin 3; ubiquitin-like domain, structural gen | 99.72 | |
| 1ttn_A | 106 | DC-UBP, dendritic cell-derived ubiquitin-like prot | 99.71 | |
| 2l7r_A | 93 | Ubiquitin-like protein FUBI; structural genomics, | 99.71 | |
| 1yx5_B | 98 | Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s | 99.71 | |
| 3b1l_X | 76 | E3 ubiquitin-protein ligase parkin; proteasome, AL | 99.54 | |
| 3rt3_B | 159 | Ubiquitin-like protein ISG15; ubiquitin-like domai | 99.7 | |
| 3l0w_B | 169 | Monoubiquitinated proliferating cell nuclear antig | 99.7 | |
| 1x1m_A | 107 | Ubiquitin-like protein SB132; structural genomics, | 99.69 | |
| 3m63_B | 101 | Ubiquitin domain-containing protein DSK2; armadill | 99.69 | |
| 1v5o_A | 102 | 1700011N24RIK protein; hypothetical protein, ubiqu | 99.69 | |
| 1we6_A | 111 | Splicing factor, putative; structural genomics, ub | 99.69 | |
| 2ojr_A | 111 | Ubiquitin; lanthide-binding TAG, terbium, TB, SAD | 99.68 | |
| 1wgg_A | 96 | Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti | 99.68 | |
| 2kdi_A | 114 | Ubiquitin, vacuolar protein sorting-associated pro | 99.68 | |
| 1wxv_A | 92 | BAG-family molecular chaperone regulator-1; struct | 99.67 | |
| 1v5t_A | 90 | 8430435I17RIK protein; hypothetical protein, ubiqu | 99.67 | |
| 1we7_A | 115 | SF3A1 protein; structural genomics, ubiquitin-like | 99.67 | |
| 3u30_A | 172 | Ubiquitin, linear DI-ubiquitin; immune system; 2.4 | 99.67 | |
| 3q3f_A | 189 | Ribonuclease/ubiquitin chimeric protein; domain SW | 99.66 | |
| 4dbg_A | 105 | Ranbp-type and C3HC4-type zinc finger-containing; | 99.65 | |
| 3u5e_m | 128 | 60S ribosomal protein L40; translation, ribosome, | 99.64 | |
| 2kd0_A | 85 | LRR repeats and ubiquitin-like domain-containing p | 99.64 | |
| 3u30_A | 172 | Ubiquitin, linear DI-ubiquitin; immune system; 2.4 | 99.63 | |
| 3rt3_B | 159 | Ubiquitin-like protein ISG15; ubiquitin-like domai | 99.63 | |
| 3u5c_f | 152 | 40S ribosomal protein S31; translation, ribosome, | 99.63 | |
| 3b08_A | 152 | Polyubiquitin-C, ubiquitin; protein complex, signa | 99.62 | |
| 4b6w_A | 86 | Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik | 99.62 | |
| 3b08_A | 152 | Polyubiquitin-C, ubiquitin; protein complex, signa | 99.6 | |
| 1v86_A | 95 | DNA segment, CHR 7, wayne state university 128, ex | 99.6 | |
| 1oqy_A | 368 | HHR23A, UV excision repair protein RAD23 homolog A | 99.59 | |
| 2dzj_A | 88 | Synaptic glycoprotein SC2; ubiquitin-like fold, st | 99.58 | |
| 2kj6_A | 97 | Tubulin folding cofactor B; methods development, N | 99.57 | |
| 2kjr_A | 95 | CG11242; UBL, ubiquitin, ubiquitin-like, structura | 99.56 | |
| 1v6e_A | 95 | Cytoskeleton-associated protein 1; tubulin-specifi | 99.55 | |
| 2dzm_A | 100 | FAS-associated factor 1; ubiquitin-like domain, HF | 99.54 | |
| 3ai5_A | 307 | Yeast enhanced green fluorescent protein, ubiquit; | 99.54 | |
| 2xzm_9 | 189 | RPS31E; ribosome, translation; 3.93A {Tetrahymena | 99.54 | |
| 1wf9_A | 107 | NPL4 family protein; beta-grAsp fold like domain, | 99.51 | |
| 2io1_B | 94 | Small ubiquitin-related modifier 3 precursor; SUMO | 99.49 | |
| 2io0_B | 91 | Small ubiquitin-related modifier 2 precursor; SUMO | 99.45 | |
| 1t0y_A | 122 | Tubulin folding cofactor B; ubiquitin-like, cytosk | 99.43 | |
| 3shq_A | 320 | UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila | 99.37 | |
| 2d07_B | 93 | Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho | 99.36 | |
| 1wm3_A | 72 | Ubiquitin-like protein SMT3B; ubiquitin fold, half | 99.34 | |
| 1wz0_A | 104 | Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li | 99.33 | |
| 2kzr_A | 86 | Ubiquitin thioesterase OTU1; structural genomics, | 99.32 | |
| 3a4r_A | 79 | Nfatc2-interacting protein; ubiquitin fold, coiled | 99.32 | |
| 2k8h_A | 110 | Small ubiquitin protein; SUMO, post-translational | 99.25 | |
| 2eke_C | 106 | Ubiquitin-like protein SMT3; UBC9, SUMO binding mo | 99.25 | |
| 1wjn_A | 97 | Tubulin-folding protein TBCE; ubiquitin-like domai | 99.03 | |
| 3kyd_D | 115 | Small ubiquitin-related modifier 1; SUMO, thioeste | 98.9 | |
| 3pge_A | 200 | SUMO-modified proliferating cell nuclear antigen; | 98.77 | |
| 3tix_A | 207 | Ubiquitin-like protein SMT3, RNA-induced transcri | 98.64 | |
| 4efo_A | 94 | Serine/threonine-protein kinase TBK1; ubiquitin li | 98.37 | |
| 3v7o_A | 227 | Minor nucleoprotein VP30; ssgcid, seattle structur | 98.3 | |
| 3uf8_A | 209 | Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- | 98.06 | |
| 2jxx_A | 97 | Nfatc2-interacting protein; nuclear factor of acti | 98.04 | |
| 3goe_A | 82 | DNA repair protein RAD60; SUMO-like domain, sumoyl | 98.01 | |
| 3ix6_A | 360 | TS, tsase, thymidylate synthase; niaid, ssgcid, se | 97.96 | |
| 2pjh_A | 80 | Protein NPL4, nuclear protein localization protein | 97.96 | |
| 3qx1_A | 84 | FAS-associated factor 1; UBX, protein binding, P97 | 97.88 | |
| 4da1_A | 389 | Protein phosphatase 1K, mitochondrial; metal-ION-a | 97.59 | |
| 2l76_A | 95 | Nfatc2-interacting protein; ubiquitin-like domain, | 97.52 | |
| 2dzk_A | 109 | UBX domain-containing protein 2; ubiquitin-like fo | 97.34 | |
| 1s3s_G | 127 | P47 protein; AAA ATPase, protein-protein complex, | 97.31 | |
| 2bps_A | 81 | YUKD protein; ubiquitin-like protein, ubiquitin; 2 | 97.27 | |
| 3ivf_A | 371 | Talin-1; FERM domain, cell membrane, cell projecti | 97.22 | |
| 1wj4_A | 124 | KIAA0794 protein; UBX domain, beta-grAsp fold, str | 97.17 | |
| 2cr5_A | 109 | Reproduction 8; UBX domain, D0H8S2298E protein, st | 97.09 | |
| 2kc2_A | 128 | Talin-1, F1; FERM, adhesion, cell membrane, cell p | 97.06 | |
| 4e71_A | 111 | Plexin-B2, MM1; transmembrane, signaling, RBD, str | 96.12 | |
| 3h6n_A | 127 | Plexin-D1; structural genomics consortium, SGC, me | 95.43 | |
| 2al3_A | 90 | TUG long isoform; TUG UBL1 insulin, endocytosis/ex | 95.15 | |
| 2r2o_A | 138 | Plexin-B1; effector domain, structural genomics, s | 94.84 | |
| 4e74_A | 117 | Plexin-A4; RBD, structural genomics, structural ge | 92.93 | |
| 2l32_A | 74 | Small archaeal modifier protein 2; protein BIN; NM | 92.56 | |
| 1vjk_A | 98 | Molybdopterin converting factor, subunit 1; struct | 91.3 | |
| 3hm6_X | 644 | Plexin-B1; structural genomics consortium, SGC, me | 88.99 | |
| 3po0_A | 89 | Small archaeal modifier protein 1; ubiquitin-like | 88.47 | |
| 2v1y_A | 108 | Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca | 88.26 | |
| 3kuz_A | 126 | Plexin-C1; structural genomics, structural genomic | 87.63 | |
| 3ig3_A | 627 | Plxna3 protein; plexin intracellular GAP RBD inact | 87.59 | |
| 1ryj_A | 70 | Unknown; beta/alpha protein, structural genomics, | 87.51 | |
| 4a3p_A | 217 | Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {H | 86.43 | |
| 3ge3_C | 84 | Toluene-4-monooxygenase system protein B; DIIRON h | 83.74 | |
| 2q5w_D | 77 | Molybdopterin converting factor, subunit 1; MOCO, | 82.77 | |
| 1wgr_A | 100 | Growth factor receptor-bound protein 7; RA domain, | 82.45 | |
| 1oey_A | 83 | P67-PHOX, neutrophil cytosol factor 2; immune syst | 82.05 | |
| 3jyu_A | 231 | Ubiquitin carboxyl-terminal hydrolase; domain in u | 81.0 |
| >1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
Probab=100.00 E-value=1.3e-35 Score=208.21 Aligned_cols=116 Identities=66% Similarity=1.117 Sum_probs=92.5
Q ss_pred CCCCceeEEEEEeCCCceeeeeecCCCCcHHHHHHHhhhcCCCcccCCCCCCCceeEEecCeecCCCCcccccCCCCCCC
Q 033555 2 ASVQDQLEIKFRLTDGSDIGPKSFPAATSVATLKESVLSQWPKEKENGPRTVKDVKLISAGKILENNRTLGECRSPLCDI 81 (117)
Q Consensus 2 ~~~~~~~~i~~~~~~G~~~~~l~~~~~~TV~~lK~~I~~~wp~~~~~~p~~~~~qrLI~~Gk~L~D~~tL~~~~i~~g~~ 81 (117)
|++++.+.|+||+.+|+++.+++++|++||++||++|+++||++++++|.++++|||||+||+|+|+.||++|+|+.+++
T Consensus 11 ~~~~~~~~i~~kt~~G~~i~~l~v~psdTV~~lK~kI~~~~p~dkegiP~~~~qQrLIy~GK~LeD~~TLsdy~I~~~~~ 90 (126)
T 1se9_A 11 AEVHNQLEIKFRLTDGSDIGPKAFPDATTVSALKETVISEWPREKENGPKTVKEVKLISAGKVLENSKTVKDYRSPVSNL 90 (126)
T ss_dssp CSSCCCEEEEEEETTSCEEEEEEECTTCBHHHHHHHHHHHSCTTCSSSCCSGGGEEEEETTEECCTTSBGGGGSCCTTSC
T ss_pred hhhcccEEEEEEECCCCEEEeeecCccCHHHHHHHHHHhhcccccccCCCChhhEEEEECCeECcCCCcHHHcCCCcCCc
Confidence 57889999999999999995599999999999999999999999999986669999999999999999999999999988
Q ss_pred CCCeEEEEEEeCCCCchhhhhhccCCCCCCeeEeeC
Q 033555 82 PGGVTTMHVVVQPPSTEKEKKAASQPKQNKCVCVIL 117 (117)
Q Consensus 82 ~~~~~tmhlv~~~~~~~~~~~~~~~~~~~~c~c~i~ 117 (117)
|+.++||||++++++++++.+.....+.++|+|+||
T Consensus 91 ~~~v~tmhlVlrl~g~~kkkk~~~~pkk~~C~C~Il 126 (126)
T 1se9_A 91 AGAVTTMHVIIQAPVTEKEKKPKGDPKMNKCVCSVM 126 (126)
T ss_dssp TTCCEEEEEEECCCSSCCCC----------------
T ss_pred cCCcEEEEEEeccCCccccccCCCCCCCCCceEEeC
Confidence 877899999999999876622344556899999997
|
| >2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A | Back alignment and structure |
|---|
| >1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A | Back alignment and structure |
|---|
| >1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I | Back alignment and structure |
|---|
| >4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B | Back alignment and structure |
|---|
| >2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B | Back alignment and structure |
|---|
| >1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B | Back alignment and structure |
|---|
| >1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A | Back alignment and structure |
|---|
| >2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A | Back alignment and structure |
|---|
| >2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A | Back alignment and structure |
|---|
| >3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A | Back alignment and structure |
|---|
| >2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C | Back alignment and structure |
|---|
| >3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... | Back alignment and structure |
|---|
| >1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* | Back alignment and structure |
|---|
| >1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S | Back alignment and structure |
|---|
| >3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A | Back alignment and structure |
|---|
| >1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A | Back alignment and structure |
|---|
| >2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B | Back alignment and structure |
|---|
| >3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A | Back alignment and structure |
|---|
| >3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A | Back alignment and structure |
|---|
| >3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B | Back alignment and structure |
|---|
| >1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A | Back alignment and structure |
|---|
| >1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A | Back alignment and structure |
|---|
| >3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} | Back alignment and structure |
|---|
| >3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} | Back alignment and structure |
|---|
| >4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A | Back alignment and structure |
|---|
| >3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p | Back alignment and structure |
|---|
| >2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} | Back alignment and structure |
|---|
| >3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A | Back alignment and structure |
|---|
| >3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f | Back alignment and structure |
|---|
| >3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B | Back alignment and structure |
|---|
| >4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} | Back alignment and structure |
|---|
| >3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B | Back alignment and structure |
|---|
| >1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A | Back alignment and structure |
|---|
| >2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* | Back alignment and structure |
|---|
| >2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 | Back alignment and structure |
|---|
| >1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A | Back alignment and structure |
|---|
| >1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B | Back alignment and structure |
|---|
| >1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A | Back alignment and structure |
|---|
| >2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4efo_A Serine/threonine-protein kinase TBK1; ubiquitin like domain, transferase; 1.77A {Homo sapiens} | Back alignment and structure |
|---|
| >3v7o_A Minor nucleoprotein VP30; ssgcid, seattle structural genomics center for infectious disease, SMT, transcription; 2.25A {Reston ebolavirus} | Back alignment and structure |
|---|
| >3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* | Back alignment and structure |
|---|
| >2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* | Back alignment and structure |
|---|
| >3ix6_A TS, tsase, thymidylate synthase; niaid, ssgcid, seattle structural center for infectious DISE brucellosis, orchitis, epididymitis, mastitis; 2.20A {Brucella melitensis} | Back alignment and structure |
|---|
| >2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A | Back alignment and structure |
|---|
| >4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A | Back alignment and structure |
|---|
| >2l76_A Nfatc2-interacting protein; ubiquitin-like domain, structural genomics, PSI-biology, Pro structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A | Back alignment and structure |
|---|
| >1s3s_G P47 protein; AAA ATPase, protein-protein complex, UBX domain, protein binding; HET: ADP; 2.90A {Rattus norvegicus} SCOP: d.15.1.2 PDB: 1i42_A 1jru_A | Back alignment and structure |
|---|
| >2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A | Back alignment and structure |
|---|
| >1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 | Back alignment and structure |
|---|
| >2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 | Back alignment and structure |
|---|
| >2kc2_A Talin-1, F1; FERM, adhesion, cell membrane, cell projection, cytoplasm, cytoskeleton, membrane, phosphoprotein, structural protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4e71_A Plexin-B2, MM1; transmembrane, signaling, RBD, structural genomics consortium, SGC, signaling protein; 2.26A {Homo sapiens} | Back alignment and structure |
|---|
| >3h6n_A Plexin-D1; structural genomics consortium, SGC, membrane, transmembrane, receptor, alternative splicing, cell membrane, glycoprotein, polymorphism; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 | Back alignment and structure |
|---|
| >2r2o_A Plexin-B1; effector domain, structural genomics, structural GEN consortium, SGC, glycoprotein, membrane, phosphorylation, R secreted, transmembrane; 2.00A {Homo sapiens} PDB: 2rex_A* 2jph_A | Back alignment and structure |
|---|
| >4e74_A Plexin-A4; RBD, structural genomics, structural genomics consor SGC, signaling protein; 1.58A {Homo sapiens} PDB: 3q3j_A* | Back alignment and structure |
|---|
| >2l32_A Small archaeal modifier protein 2; protein BIN; NMR {Haloferax volcanii} | Back alignment and structure |
|---|
| >1vjk_A Molybdopterin converting factor, subunit 1; structural genomics, PSI, protein structure INI southeast collaboratory for structural genomics; 1.51A {Pyrococcus furiosus} SCOP: d.15.3.1 | Back alignment and structure |
|---|
| >3hm6_X Plexin-B1; structural genomics consortium, SGC, membrane, transmembrane receptor, cell membrane, glycoprotein, phosphoprotein; 2.40A {Homo sapiens} PDB: 3sua_D* 3su8_X* | Back alignment and structure |
|---|
| >3po0_A Small archaeal modifier protein 1; ubiquitin-like protein, protein binding; 1.55A {Haloferax volcanii} PDB: 2l83_A | Back alignment and structure |
|---|
| >2v1y_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit alpha isoform; cancer, SH2 domain, SH3 domain, transferase, oncogen mutations, HOST-virus interaction; 2.4A {Bos taurus} | Back alignment and structure |
|---|
| >3kuz_A Plexin-C1; structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3ig3_A Plxna3 protein; plexin intracellular GAP RBD inactive, membrane, transmembra membrane protein, signaling protein; 1.99A {Mus musculus} PDB: 3ryt_A* | Back alignment and structure |
|---|
| >1ryj_A Unknown; beta/alpha protein, structural genomics, protein structure initiative, OCSP, NESG, PSI; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.15.3.2 | Back alignment and structure |
|---|
| >4a3p_A Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {Homo sapiens} PDB: 4a3o_A 3pv1_A 3ppa_A* 3t9l_A 3lmn_A | Back alignment and structure |
|---|
| >3ge3_C Toluene-4-monooxygenase system protein B; DIIRON hydroxylase, effector protein, T201A, aromatic hydrocarbons catabolism, FAD, flavoprotein; 1.52A {Pseudomonas mendocina} SCOP: d.15.12.0 PDB: 3dhh_C* 3dhg_C* 3dhi_C 3ge8_C 3i5j_C 3i63_C 3q14_C 3q2a_C* 3q3m_C* 3q3n_C* 3q3o_C* 3rmk_C* 3ri7_C* | Back alignment and structure |
|---|
| >2q5w_D Molybdopterin converting factor, subunit 1; MOCO, MPT synthase, MOAD, MOAE, transferase, molybdenum cofactor biosynthesis; 2.00A {Staphylococcus aureus} PDB: 2qie_B* | Back alignment and structure |
|---|
| >1wgr_A Growth factor receptor-bound protein 7; RA domain, GRB7, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.15.1.5 | Back alignment and structure |
|---|
| >1oey_A P67-PHOX, neutrophil cytosol factor 2; immune system, PB1 heterodimer/complex, NADPH oxidase, PB1 D heterodimerization; 2.0A {Homo sapiens} SCOP: d.15.2.2 | Back alignment and structure |
|---|
| >3jyu_A Ubiquitin carboxyl-terminal hydrolase; domain in ubiquitin-specific peptidases (DUSP), proto- oncogene, ubiquitin-fold, UBL, protease, thioesterase; HET: 1PS; 2.37A {Mus musculus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 117 | ||||
| d1se9a_ | 101 | d.15.1.1 (A:) Hypothetical protein At3g01050 {Thal | 7e-34 | |
| d1wgha_ | 116 | d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mous | 2e-12 | |
| d1wgda_ | 93 | d.15.1.1 (A:) Homocysteine-responsive endoplasmic | 2e-05 | |
| d1x1ma1 | 94 | d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse | 4e-05 | |
| d1wx9a1 | 73 | d.15.1.1 (A:8-80) Large proline-rich protein BAT3 | 0.003 | |
| d1uela_ | 95 | d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homol | 0.004 |
| >d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 101 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-Grasp (ubiquitin-like) superfamily: Ubiquitin-like family: Ubiquitin-related domain: Hypothetical protein At3g01050 species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 111 bits (278), Expect = 7e-34
Identities = 69/100 (69%), Positives = 89/100 (89%)
Query: 2 ASVQDQLEIKFRLTDGSDIGPKSFPAATSVATLKESVLSQWPKEKENGPRTVKDVKLISA 61
A V +QLEIKFRLTDGSDIGPK+FP AT+V+ LKE+V+S+WP+EKENGP+TVK+VKLISA
Sbjct: 2 AEVHNQLEIKFRLTDGSDIGPKAFPDATTVSALKETVISEWPREKENGPKTVKEVKLISA 61
Query: 62 GKILENNRTLGECRSPLCDIPGGVTTMHVVVQPPSTEKEK 101
GK+LEN++T+ + RSP+ ++ G VTTMHV++Q P TEKEK
Sbjct: 62 GKVLENSKTVKDYRSPVSNLAGAVTTMHVIIQAPVTEKEK 101
|
| >d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 116 | Back information, alignment and structure |
|---|
| >d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
| >d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 117 | |||
| d1se9a_ | 101 | Hypothetical protein At3g01050 {Thale cress (Arabi | 99.97 | |
| d1wgha_ | 116 | Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu | 99.92 | |
| d1wh3a_ | 87 | 2'-5'-oligoadenylate synthetase-like protein, OASL | 99.86 | |
| d2zeqa1 | 78 | Ubiquitin-like domain of parkin {Mouse (Mus muscul | 99.85 | |
| d1bt0a_ | 73 | Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI | 99.84 | |
| d1ttna1 | 80 | Dendritic cell-derived ubiquitin-like protein {Hum | 99.84 | |
| d1z2ma2 | 76 | Interferon-induced 15 kDa protein {Human (Homo sap | 99.83 | |
| d1ogwa_ | 76 | Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} | 99.82 | |
| d1wx9a1 | 73 | Large proline-rich protein BAT3 {Human (Homo sapie | 99.81 | |
| d2faza1 | 76 | Ubiquitin-like PHD and RING finger domain-containi | 99.81 | |
| d1wgda_ | 93 | Homocysteine-responsive endoplasmic reticulum-resi | 99.81 | |
| d1wy8a1 | 76 | Ubiquitin-like PHD and RING finger domain-containi | 99.8 | |
| d1uela_ | 95 | Ubiquitin-like domain of Rad23 homolog B (Hhr23B) | 99.8 | |
| d1oqya4 | 77 | Ubiquitin-like domain of Rad23 homolog A (Hhr23a) | 99.79 | |
| d1z2ma1 | 76 | Interferon-induced 15 kDa protein {Human (Homo sap | 99.78 | |
| d1wiaa_ | 95 | Ubiquitin-like protein bab25500 (2010008E23Rik) {M | 99.78 | |
| d2bwfa1 | 73 | DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 99.78 | |
| d1m94a_ | 73 | Ubiquitin-like modifier protein hub1 {Baker's yeas | 99.77 | |
| d1zkha1 | 86 | Splicing factor 3 subunit 1, C-terminal domain {Hu | 99.76 | |
| d1yqba1 | 84 | Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.75 | |
| d1wx8a1 | 83 | 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] | 99.75 | |
| d1uh6a_ | 100 | Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu | 99.74 | |
| d1j8ca_ | 103 | Ubiquitin-like N-terminal domain of PLIC-2 {Human | 99.74 | |
| d1we6a_ | 111 | Splicing factor 3 subunit 1, C-terminal domain {Th | 99.72 | |
| d1wgga_ | 96 | Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M | 99.71 | |
| d1v5oa_ | 102 | 1700011n24rik protein {Mouse (Mus musculus) [TaxId | 99.71 | |
| d1wjua_ | 100 | NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens | 99.7 | |
| d2c9wb1 | 103 | Elongin B {Human (Homo sapiens) [TaxId: 9606]} | 99.69 | |
| d1v2ya_ | 105 | Ubiquitin-like protein 3300001g02rik {Mouse (Mus m | 99.69 | |
| d1x1ma1 | 94 | Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta | 99.67 | |
| d1v86a_ | 95 | hypothetical D7wsu128e protein {Mouse (Mus musculu | 99.62 | |
| d1v5ta_ | 90 | 8430435i17rik protein {Mouse (Mus musculus) [TaxId | 99.61 | |
| d1wxva1 | 81 | Bag-family molecular chaperone regulator-1 {Human | 99.53 | |
| d1v6ea_ | 95 | Ubiquitin-like domain of tubulin folding cofactor | 99.53 | |
| d1euvb_ | 79 | SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy | 99.46 | |
| d2uyzb1 | 77 | SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax | 99.36 | |
| d1wjna_ | 97 | Tubulin-folding protein TbcE {Mouse (Mus musculus) | 99.36 | |
| d1t0ya_ | 90 | Ubiquitin-like domain of tubulin folding cofactor | 99.23 | |
| d1wm3a_ | 72 | SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} | 98.47 | |
| d1i42a_ | 89 | p47 {Rat (Rattus norvegicus) [TaxId: 10116]} | 97.95 | |
| d2cr5a1 | 96 | UBX domain-containing protein 6 (Reproduction 8) { | 97.76 | |
| d1wf9a1 | 94 | NPL4-like protein 1 {Thale cress (Arabidopsis thal | 97.65 | |
| d1h8ca_ | 82 | Fas-associated factor 1, Faf1 {Human (Homo sapiens | 97.52 | |
| d1wj4a_ | 124 | Hypothetical protein KIAA0794 {Human (Homo sapiens | 97.18 | |
| d1vjka_ | 88 | Molybdopterin synthase subunit MoaD {Pyrococcus fu | 96.04 | |
| d2al3a1 | 76 | Tether containing UBX domain for GLUT4 (Tug) {Mous | 94.18 | |
| d1s3si_ | 50 | p47 {Rat (Rattus norvegicus) [TaxId: 10116]} | 89.0 | |
| d1wgra_ | 100 | Growth factor receptor-bound protein 7, GRB-7 {Hum | 82.84 | |
| d1fm0d_ | 81 | Molybdopterin synthase subunit MoaD {Escherichia c | 82.18 | |
| d1ip9a_ | 85 | Bud emergence mediator Bemp1 {Baker's yeast (Sacch | 80.03 |
| >d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-Grasp (ubiquitin-like) superfamily: Ubiquitin-like family: Ubiquitin-related domain: Hypothetical protein At3g01050 species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=99.97 E-value=1.2e-30 Score=175.31 Aligned_cols=98 Identities=68% Similarity=1.121 Sum_probs=91.7
Q ss_pred CCCCceeEEEEEeCCCceeeeeecCCCCcHHHHHHHhhhcCCCcccCCCCCCCceeEEecCeecCCCCcccccCCCCCCC
Q 033555 2 ASVQDQLEIKFRLTDGSDIGPKSFPAATSVATLKESVLSQWPKEKENGPRTVKDVKLISAGKILENNRTLGECRSPLCDI 81 (117)
Q Consensus 2 ~~~~~~~~i~~~~~~G~~~~~l~~~~~~TV~~lK~~I~~~wp~~~~~~p~~~~~qrLI~~Gk~L~D~~tL~~~~i~~g~~ 81 (117)
|++++.+.|+||+.+|+++.++.|++++||.+||++|++.||.+++++|.++++|||||+||+|+|++||++|++..|+.
T Consensus 2 ~~~~~~i~I~~r~~~G~~i~~~~v~~s~TV~~lK~~I~~~~~~~k~~iP~~~~~qRLIf~Gk~L~D~~tL~dy~i~~g~~ 81 (101)
T d1se9a_ 2 AEVHNQLEIKFRLTDGSDIGPKAFPDATTVSALKETVISEWPREKENGPKTVKEVKLISAGKVLENSKTVKDYRSPVSNL 81 (101)
T ss_dssp CSSCCCEEEEEEETTSCEEEEEEECTTCBHHHHHHHHHHHSCTTCSSSCCSGGGEEEEETTEECCTTSBGGGGSCCTTSC
T ss_pred CCccceEEEEEEeCCCCeecceecCccCHHHHHHHHHHHhccccccCCCCCcccEEEEECCeEecCCCCHHHcCCCCCCc
Confidence 67889999999999999986699999999999999999999999999987789999999999999999999999999977
Q ss_pred CCCeEEEEEEeCCCCchh
Q 033555 82 PGGVTTMHVVVQPPSTEK 99 (117)
Q Consensus 82 ~~~~~tmhlv~~~~~~~~ 99 (117)
++++++|||++|++.+++
T Consensus 82 ~~~~~tmHlVvrpp~~~~ 99 (101)
T d1se9a_ 82 AGAVTTMHVIIQAPVTEK 99 (101)
T ss_dssp TTCCEEEEEEECCCSSCC
T ss_pred CCCceEEEEEeCCCCCcc
Confidence 777899999999987765
|
| >d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vjka_ d.15.3.1 (A:) Molybdopterin synthase subunit MoaD {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1s3si_ d.15.1.2 (I:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wgra_ d.15.1.5 (A:) Growth factor receptor-bound protein 7, GRB-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fm0d_ d.15.3.1 (D:) Molybdopterin synthase subunit MoaD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ip9a_ d.15.2.2 (A:) Bud emergence mediator Bemp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|