Citrus Sinensis ID: 033646


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110----
MKTVSGLAGVDSISMDMKEKKLTVIGDIDPVSIVSKLRKLCHTEILSVGPAKEPEKKKEEPKKEEAKKDDKKKDEPKKDDVADLVKAYQAYNPHMTTYYHVRSAEEDPNACVIC
ccccccccccEEEEEEccccEEEEEEEccHHHHHHHHHHHcccEEEEEcccccccccccccHHHHHHHcccccccccccHHHHHHccccccccccccEEEEEcccccccccEEc
ccEEEccccccEEEEEcccccEEEEEcccHHHHHHHHHHHcccEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccEEEEEEEccccccEEEc
mktvsglagvdsismdmkekkltvigdidpvSIVSKLRKLCHTEilsvgpakepekkkeepkkeeakkddkkkdepkkddVADLVKAYqaynphmttYYHVrsaeedpnacvic
mktvsglagvdsismDMKEKKLTVIGDIDPVSIVSKLRKLCHTeilsvgpakepekkkeepkkeeakkddkkkdepkkddvaDLVKAYQAYNPHMTTYYHVRSAEEDPNACVIC
MKTVSGLAGVDSISMDMKEKKLTVIGDIDPVSIVSKLRKLCHTEILSVGpakepekkkeepkkeeakkddkkkdepkkddVADLVKAYQAYNPHMTTYYHVRSAEEDPNACVIC
********************KLTVIGDIDPVSIVSKLRKLCHTEILSV**********************************DLVKAYQAYNPHMTTYYHVR************
*KTVSGLAGVDSISMDMKEKKLTVIGDIDPVSIVSKLRKLCHTEIL********************************DDVADLVKAYQAYNPHMTTYYHVRSAEEDPNACVIC
MKTVSGLAGVDSISMDMKEKKLTVIGDIDPVSIVSKLRKLCHTEILSVG******************************DVADLVKAYQAYNPHMTTYYHVRSAEE********
*KTVSGLAGVDSISMDMKEKKLTVIGDIDPVSIVSKLRKLCHTEILSVGPA***********************EPKKDDVADLVKAYQAYNPHMTTYYHVRSAEEDPNACVIC
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooo
ooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKTVSGLAGVDSISMDMKEKKLTVIGDIDPVSIVSKLRKLCHTEILSVGPAKEPEKKKEEPKKEEAKKDDKKKDEPKKDDVADLVKAYQAYNPHMTTYYHVRSAEEDPNACVIC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query114
171451994131 hypothetical protein [Bruguiera gymnorhi 0.982 0.854 0.745 2e-38
255590302132 metal ion binding protein, putative [Ric 0.964 0.833 0.765 9e-33
356513345136 PREDICTED: uncharacterized protein LOC10 1.0 0.838 0.675 1e-32
29124977132 unknown [Populus tremuloides] 0.964 0.833 0.686 6e-32
224077486132 predicted protein [Populus trichocarpa] 0.982 0.848 0.769 2e-31
225464598125 PREDICTED: putative late blight resistan 0.912 0.832 0.745 3e-30
224134809131 predicted protein [Populus trichocarpa] 0.973 0.847 0.752 7e-30
388512833140 unknown [Lotus japonicus] 1.0 0.814 0.561 1e-27
225426154134 PREDICTED: uncharacterized protein LOC10 1.0 0.850 0.582 2e-27
224058435152 predicted protein [Populus trichocarpa] 0.964 0.723 0.608 2e-27
>gi|171451994|dbj|BAG15861.1| hypothetical protein [Bruguiera gymnorhiza] Back     alignment and taxonomy information
 Score =  162 bits (411), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 85/114 (74%), Positives = 100/114 (87%), Gaps = 2/114 (1%)

Query: 1   MKTVSGLAGVDSISMDMKEKKLTVIGDIDPVSIVSKLRKLCHTEILSVGPAKEPEKKKEE 60
           M+TVSGL+GVDS++MDMKEKKLTV GD+DPV +VSKLRKLCHT+I+SVGPAKEPEKK E 
Sbjct: 20  MRTVSGLSGVDSVAMDMKEKKLTVTGDVDPVHVVSKLRKLCHTDIVSVGPAKEPEKKAES 79

Query: 61  PKKEEAKKDDKKKDEPKKDDVADLVKAYQAYNPHMTTYYHVRSAEEDPNACVIC 114
            K+ E  K D K  +  KDDV++L+KAYQAYNPHMTTYY+V+SAEEDPNACVIC
Sbjct: 80  EKQPEGGKKDGKDAK--KDDVSELIKAYQAYNPHMTTYYYVKSAEEDPNACVIC 131




Source: Bruguiera gymnorhiza

Species: Bruguiera gymnorhiza

Genus: Bruguiera

Family: Rhizophoraceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255590302|ref|XP_002535232.1| metal ion binding protein, putative [Ricinus communis] gi|223523696|gb|EEF27151.1| metal ion binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356513345|ref|XP_003525374.1| PREDICTED: uncharacterized protein LOC100784242 [Glycine max] Back     alignment and taxonomy information
>gi|29124977|gb|AAO63778.1| unknown [Populus tremuloides] Back     alignment and taxonomy information
>gi|224077486|ref|XP_002305267.1| predicted protein [Populus trichocarpa] gi|118486507|gb|ABK95093.1| unknown [Populus trichocarpa] gi|222848231|gb|EEE85778.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225464598|ref|XP_002274512.1| PREDICTED: putative late blight resistance protein homolog R1B-19 [Vitis vinifera] gi|302143783|emb|CBI22644.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224134809|ref|XP_002327495.1| predicted protein [Populus trichocarpa] gi|222836049|gb|EEE74470.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388512833|gb|AFK44478.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|225426154|ref|XP_002278542.1| PREDICTED: uncharacterized protein LOC100258716 [Vitis vinifera] gi|297742238|emb|CBI34387.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224058435|ref|XP_002299508.1| predicted protein [Populus trichocarpa] gi|222846766|gb|EEE84313.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query114
TAIR|locus:2025421177 AT1G01490 [Arabidopsis thalian 0.429 0.276 0.68 6.4e-26
TAIR|locus:2149584118 AT5G52740 "AT5G52740" [Arabido 0.412 0.398 0.551 5.3e-13
TAIR|locus:2149614126 AT5G52760 [Arabidopsis thalian 0.394 0.357 0.565 1.2e-11
TAIR|locus:2149629111 AT5G52770 [Arabidopsis thalian 0.403 0.414 0.652 1.4e-09
TAIR|locus:2149594139 AT5G52750 [Arabidopsis thalian 0.403 0.330 0.586 2e-08
TAIR|locus:2195493113 AT1G63950 [Arabidopsis thalian 0.333 0.336 0.526 9.8e-08
TAIR|locus:2172808103 AT5G23760 "AT5G23760" [Arabido 0.429 0.475 0.469 1.4e-07
TAIR|locus:2121199153 FP6 "farnesylated protein 6" [ 0.315 0.235 0.361 3.8e-06
TAIR|locus:2009390264 AT1G57780 [Arabidopsis thalian 0.385 0.166 0.363 5e-06
TAIR|locus:2156927147 HIPP27 "heavy metal associated 0.315 0.244 0.388 1e-05
TAIR|locus:2025421 AT1G01490 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 160 (61.4 bits), Expect = 6.4e-26, Sum P(2) = 6.4e-26
 Identities = 34/50 (68%), Positives = 42/50 (84%)

Query:     1 MKTVSGLAGVDSISMDMKEKKLTVIGDIDPVSIVSKLRKLCH-TEILSVG 49
             +KTVS L G+DSI+MDMKEKKLTVIG +DPV++VSKLRK    T+I+ VG
Sbjct:    20 LKTVSTLPGIDSIAMDMKEKKLTVIGTVDPVNVVSKLRKYWPMTDIVLVG 69


GO:0005634 "nucleus" evidence=ISM
GO:0030001 "metal ion transport" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA;ISS
TAIR|locus:2149584 AT5G52740 "AT5G52740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149614 AT5G52760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149629 AT5G52770 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149594 AT5G52750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2195493 AT1G63950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172808 AT5G23760 "AT5G23760" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2121199 FP6 "farnesylated protein 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009390 AT1G57780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156927 HIPP27 "heavy metal associated isoprenylated plant protein 27" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
pfam0040362 pfam00403, HMA, Heavy-metal-associated domain 2e-04
>gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain Back     alignment and domain information
 Score = 36.4 bits (85), Expect = 2e-04
 Identities = 15/43 (34%), Positives = 25/43 (58%)

Query: 1  MKTVSGLAGVDSISMDMKEKKLTVIGDIDPVSIVSKLRKLCHT 43
           K +S L GV S+S+D++  K+TV GD DP+ +    + +   
Sbjct: 17 EKALSKLPGVSSVSVDLETGKVTVTGDPDPLKLEKLKKAIEKA 59


Length = 62

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 114
KOG160373 consensus Copper chaperone [Inorganic ion transpor 98.91
PF0040362 HMA: Heavy-metal-associated domain; InterPro: IPR0 98.29
COG260871 CopZ Copper chaperone [Inorganic ion transport and 97.32
KOG4656 247 consensus Copper chaperone for superoxide dismutas 96.97
PLN02957238 copper, zinc superoxide dismutase 95.61
PF0268095 DUF211: Uncharacterized ArCR, COG1888; InterPro: I 92.68
COG188897 Uncharacterized protein conserved in archaea [Func 91.14
PRK10671 834 copA copper exporting ATPase; Provisional 90.05
>KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
Probab=98.91  E-value=3.1e-09  Score=69.12  Aligned_cols=45  Identities=38%  Similarity=0.735  Sum_probs=40.5

Q ss_pred             ccccCCCCccEEEEecCCCeEEEEeeCCHHHHHHHHHhcC--CeEEe
Q 033646            2 KTVSGLAGVDSISMDMKEKKLTVIGDIDPVSIVSKLRKLC--HTEIL   46 (114)
Q Consensus         2 Kal~~l~GV~sV~vD~~~~kvtV~G~vDp~~lv~~LrK~g--~aeiv   46 (114)
                      +.|+.+.||.++.+|+++++|||.|++||..|+++|++.+  ++.+|
T Consensus        24 ~~l~~~~GV~~v~id~~~~kvtV~g~~~p~~vl~~l~k~~~k~~~~~   70 (73)
T KOG1603|consen   24 RVLQKLKGVESVDIDIKKQKVTVKGNVDPVKLLKKLKKTGGKRAELW   70 (73)
T ss_pred             HHhhccCCeEEEEecCCCCEEEEEEecCHHHHHHHHHhcCCCceEEe
Confidence            5789999999999999999999999999999999999877  44444



>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures Back     alignment and domain information
>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02957 copper, zinc superoxide dismutase Back     alignment and domain information
>PF02680 DUF211: Uncharacterized ArCR, COG1888; InterPro: IPR003831 This entry describes proteins of unknown function Back     alignment and domain information
>COG1888 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 7e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 37.1 bits (85), Expect = 6e-04
 Identities = 19/115 (16%), Positives = 43/115 (37%), Gaps = 24/115 (20%)

Query: 2   KTVSGLAGVDSISMDMKEKK------LTVIGDIDPVSIVSKLRKLCHTEILSVGPAKEPE 55
           KT   +A    +S  ++ K       L +     P +++  L+KL +   +        +
Sbjct: 163 KTW--VALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQ--IDPNWTSRSD 218

Query: 56  KKKEEPKKEEAKKDDKK---KDEPKK------DDVADLVKAYQAYNPH----MTT 97
                  +  + + + +   K +P +       +V +  KA+ A+N      +TT
Sbjct: 219 HSSNIKLRIHSIQAELRRLLKSKPYENCLLVLLNVQN-AKAWNAFNLSCKILLTT 272


>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 222 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query114
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 98.58
1cc8_A73 Protein (metallochaperone ATX1); copper transport, 98.42
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 98.26
4a4j_A69 Pacszia, cation-transporting ATPase PACS; hydrolas 98.19
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 98.0
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 97.96
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 97.88
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 97.75
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 97.57
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 97.57
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 97.57
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 97.5
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 97.49
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 97.48
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 97.47
1jk9_B 249 CCS, copper chaperone for superoxide dismutase; pr 97.45
2l3m_A71 Copper-ION-binding protein; structural genomics, c 97.41
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 97.37
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 97.28
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 97.27
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 97.25
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 97.24
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 97.24
1yg0_A66 COP associated protein; open-faced beta-sandwich, 97.23
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 97.23
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 97.19
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 97.09
2kyz_A67 Heavy metal binding protein; structural genomics, 97.07
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 97.01
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 96.99
1opz_A76 Potential copper-transporting ATPase; mutation, fo 96.96
1mwy_A73 ZNTA; open-faced beta-sandwich fold, beta-alpha-be 96.88
2kkh_A95 Putative heavy metal transporter; zinc transport, 96.77
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 96.62
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 96.45
1jww_A80 Potential copper-transporting ATPase; beta-alpha-b 96.42
2aj0_A71 Probable cadmium-transporting ATPase; ferrodoxin-l 95.96
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 95.1
3bpd_A100 Uncharacterized protein; heptamer, Mg+2 ION, PSI-2 93.36
2raq_A97 Conserved protein MTH889; alpha-beta protein, stru 92.78
2x3d_A96 SSO6206; unknown function; 2.70A {Sulfolobus solfa 92.71
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 92.61
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 91.52
3j09_A 723 COPA, copper-exporting P-type ATPase A; copper tra 89.76
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Back     alignment and structure
Probab=98.58  E-value=6.4e-08  Score=59.14  Aligned_cols=46  Identities=20%  Similarity=0.382  Sum_probs=43.3

Q ss_pred             ccccCCCCccEEEEecCCCeEEEEeeCCHHHHHHHHHhcC-CeEEeec
Q 033646            2 KTVSGLAGVDSISMDMKEKKLTVIGDIDPVSIVSKLRKLC-HTEILSV   48 (114)
Q Consensus         2 Kal~~l~GV~sV~vD~~~~kvtV~G~vDp~~lv~~LrK~g-~aeivsv   48 (114)
                      ++|.+++|| ++.+|+..++++|.|.+++..|+++|++.| .+.++++
T Consensus        21 ~~l~~~~gV-~v~v~~~~~~~~v~~~~~~~~i~~~i~~~Gy~~~~~~~   67 (68)
T 3iwl_A           21 RVLNKLGGV-KYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGL   67 (68)
T ss_dssp             HHHHHHCSE-EEEEETTTTEEEEEESSCHHHHHHHHHTTCSCEEEEEC
T ss_pred             HHHHcCCCe-EEEEEcCCCEEEEEecCCHHHHHHHHHHcCCceEecCC
Confidence            468889999 999999999999999999999999999999 9999875



>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Back     alignment and structure
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Back     alignment and structure
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Back     alignment and structure
>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Back     alignment and structure
>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>3bpd_A Uncharacterized protein; heptamer, Mg+2 ION, PSI-2, NYSGXRC, structural genom protein structure initiative; 2.80A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.61.1 Back     alignment and structure
>2raq_A Conserved protein MTH889; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 3.11A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: d.58.61.1 Back     alignment and structure
>2x3d_A SSO6206; unknown function; 2.70A {Sulfolobus solfataricus} Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query114
d1qupa272 Copper chaperone for superoxide dismutase, N-termi 98.87
d1fe0a_66 ATX1 metallochaperone protein (ATOX1) {Human (Homo 98.85
d1cc8a_72 ATX1 metallochaperone protein (ATOX1) {Baker's yea 98.63
d1sb6a_64 Copper chaperone {Synechocystis sp. pcc 6803, Scat 98.44
d2ggpb172 Copper transporter domain ccc2a {Baker's yeast (Sa 98.37
d1cpza_68 Copper chaperone {Enterococcus hirae [TaxId: 1354] 98.37
d1osda_72 Mercuric ion binding protein MerP {Ralstonia metal 98.08
d2aw0a_72 Menkes copper-transporting ATPase {Human (Homo sap 98.07
d1kvja_79 Menkes copper-transporting ATPase {Human (Homo sap 98.06
d2qifa169 Copper chaperone {Bacillus subtilis, CopZ [TaxId: 97.97
d1p6ta279 Potential copper-translocating P-type ATPase CopA 97.95
d1q8la_84 Menkes copper-transporting ATPase {Human (Homo sap 97.95
d1p6ta172 Potential copper-translocating P-type ATPase CopA 97.78
d1mwza_73 Metal ion-transporting ATPase ZntA, N-terminal dom 97.7
d2raqa193 Uncharacterized protein MTH889 {Methanobacterium t 91.32
d3bpda191 Uncharacterized protein AF1549 {Archaeoglobus fulg 90.84
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: Copper chaperone for superoxide dismutase, N-terminal domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=98.87  E-value=1.6e-09  Score=67.96  Aligned_cols=45  Identities=20%  Similarity=0.471  Sum_probs=42.9

Q ss_pred             ccccCCCCccEEEEecCCCeEEEEeeCCHHHHHHHHHhcC-CeEEe
Q 033646            2 KTVSGLAGVDSISMDMKEKKLTVIGDIDPVSIVSKLRKLC-HTEIL   46 (114)
Q Consensus         2 Kal~~l~GV~sV~vD~~~~kvtV~G~vDp~~lv~~LrK~g-~aeiv   46 (114)
                      ++|++++||.+|.+|+..++++|.|.+++.+|+++|+++| +|.|.
T Consensus        25 k~l~~~~gV~~v~vdl~~~~v~V~~~~~~~~i~~~I~~~G~~A~l~   70 (72)
T d1qupa2          25 ACLKNVPGINSLNFDIEQQIMSVESSVAPSTIINTLRNCGKDAIIR   70 (72)
T ss_dssp             HHHTTCTTEEEEEEETTTTEEEEEESSCHHHHHHHHHHTTCCCEEE
T ss_pred             HHHhcCCCeeEEEEECCCCEEEEEeeCCHHHHHHHHHHhCCCEEEe
Confidence            5789999999999999999999999999999999999999 88875



>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Back     information, alignment and structure
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2raqa1 d.58.61.1 (A:3-95) Uncharacterized protein MTH889 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d3bpda1 d.58.61.1 (A:1-91) Uncharacterized protein AF1549 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure