Citrus Sinensis ID: 033647

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110----
MFVSIPKAEAIFMKWICHNWSEEACVKILKNCYEALPEDGKVIVVDCILPVLPDTSLASKQVIQLDCFMLAYTIGGREMTEQDFKTLAKAAGFQGFKVVCSAFNTYIMEFLKNP
cccccccccEEEEEcccccccHHHHHHHHHHHHHHcccccEEEEEEEEccccccccHHHHHHHHHHHHHHHcccccEEccHHHHHHHHHHccccccEEEEccccEEEEEEEEcc
ccccccccccEEccccHHHccHHHHHHHHHHHHHHcccccEEEEEEEEEcccccccHHHHHHHHHHHHHHHHccccccEEHHHHHHHHHHcccccccEEEEEccEEEEEEEccc
MFVSIPKAEAIFMKWICHNWSEEACVKILKNCYEalpedgkvivvdcilpvlpdtslaskQVIQLDCFMLAYtiggremtEQDFKTLAKAAGFQGFKVVCSAFNTYIMEFLKNP
MFVSIPKAEAIFMKWICHNWSEEACVKILKNCYEALPEDGKVIVVDCILPVLPDTSLASKQVIQLDCFMLAYTIGGREMTEQDFKTLAKAAGFQGFKVVCSAFNTYIMEFLKNP
MFVSIPKAEAIFMKWICHNWSEEACVKILKNCYEALPEDGKVIVVDCILPVLPDTSLASKQVIQLDCFMLAYTIGGREMTEQDFKTLAKAAGFQGFKVVCSAFNTYIMEFLKNP
****IPKAEAIFMKWICHNWSEEACVKILKNCYEALPEDGKVIVVDCILPVLPDTSLASKQVIQLDCFMLAYTIGGREMTEQDFKTLAKAAGFQGFKVVCSAFNTYIMEFL***
MFVSIPKAEAIFMKWICHNWSEEACVKILKNCYEALPEDGKVIVVDCILPVLPDTSLASKQVIQLDCFMLAYTIGGREMTEQDFKTLAKAAGFQGFKVVCSAFNTYIMEFLKNP
MFVSIPKAEAIFMKWICHNWSEEACVKILKNCYEALPEDGKVIVVDCILPVLPDTSLASKQVIQLDCFMLAYTIGGREMTEQDFKTLAKAAGFQGFKVVCSAFNTYIMEFLKNP
*F*SIPKAEAIFMKWICHNWSEEACVKILKNCYEALPEDGKVIVVDCILPVLPDTSLASKQVIQLDCFMLAYTIGGREMTEQDFKTLAKAAGFQGFKVVCSAFNTYIMEFLKNP
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFVSIPKAEAIFMKWICHNWSEEACVKILKNCYEALPEDGKVIVVDCILPVLPDTSLASKQVIQLDCFMLAYTIGGREMTEQDFKTLAKAAGFQGFKVVCSAFNTYIMEFLKNP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query114 2.2.26 [Sep-21-2011]
P28002365 Caffeic acid 3-O-methyltr N/A no 0.982 0.306 0.705 1e-45
Q43609365 Caffeic acid 3-O-methyltr N/A no 0.982 0.306 0.678 2e-44
P46484366 Caffeic acid 3-O-methyltr N/A no 0.982 0.306 0.669 9e-44
Q8GU25365 Caffeic acid 3-O-methyltr N/A no 0.982 0.306 0.660 2e-43
Q00763365 Caffeic acid 3-O-methyltr N/A no 0.982 0.306 0.660 6e-43
O23760370 Caffeic acid 3-O-methyltr N/A no 0.991 0.305 0.672 1e-42
Q9FK25363 Flavone 3'-O-methyltransf yes no 0.982 0.308 0.651 1e-42
Q43047364 Caffeic acid 3-O-methyltr N/A no 0.982 0.307 0.633 1e-42
Q41086364 Caffeic acid 3-O-methyltr N/A no 0.982 0.307 0.633 4e-42
Q43046365 Caffeic acid 3-O-methyltr N/A no 0.982 0.306 0.642 6e-42
>sp|P28002|COMT1_MEDSA Caffeic acid 3-O-methyltransferase OS=Medicago sativa PE=1 SV=1 Back     alignment and function desciption
 Score =  181 bits (459), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 79/112 (70%), Positives = 98/112 (87%)

Query: 1   MFVSIPKAEAIFMKWICHNWSEEACVKILKNCYEALPEDGKVIVVDCILPVLPDTSLASK 60
           MFVSIPKA+A+FMKWICH+WS+E C+K LKNCYEALP++GKVIV +CILPV PD+SLA+K
Sbjct: 252 MFVSIPKADAVFMKWICHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATK 311

Query: 61  QVIQLDCFMLAYTIGGREMTEQDFKTLAKAAGFQGFKVVCSAFNTYIMEFLK 112
            V+ +D  MLA+  GG+E T+++F+ LAK AGFQGFKV C+AFNTYIMEFLK
Sbjct: 312 GVVHIDVIMLAHNPGGKERTQKEFEDLAKGAGFQGFKVHCNAFNTYIMEFLK 363
Catalyzes the conversion of caffeic acid to ferulic acid and of 5-hydroxyferulic acid to sinapic acid. The resulting products may subsequently be converted to the corresponding alcohols that are incorporated into lignins.
Medicago sativa (taxid: 3879)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 6EC: 8
>sp|Q43609|COMT1_PRUDU Caffeic acid 3-O-methyltransferase OS=Prunus dulcis GN=COMT1 PE=2 SV=1 Back     alignment and function description
>sp|P46484|COMT1_EUCGU Caffeic acid 3-O-methyltransferase OS=Eucalyptus gunnii GN=OMT PE=2 SV=1 Back     alignment and function description
>sp|Q8GU25|COMT1_ROSCH Caffeic acid 3-O-methyltransferase OS=Rosa chinensis GN=COMT1 PE=2 SV=1 Back     alignment and function description
>sp|Q00763|COMT1_POPTM Caffeic acid 3-O-methyltransferase 1 OS=Populus tremuloides GN=OMT1 PE=1 SV=1 Back     alignment and function description
>sp|O23760|COMT1_CLABR Caffeic acid 3-O-methyltransferase OS=Clarkia breweri GN=COMT PE=1 SV=1 Back     alignment and function description
>sp|Q9FK25|OMT1_ARATH Flavone 3'-O-methyltransferase 1 OS=Arabidopsis thaliana GN=OMT1 PE=1 SV=1 Back     alignment and function description
>sp|Q43047|COMT3_POPKI Caffeic acid 3-O-methyltransferase 3 OS=Populus kitakamiensis GN=HOMT3 PE=3 SV=1 Back     alignment and function description
>sp|Q41086|COMT2_POPTM Caffeic acid 3-O-methyltransferase 2 OS=Populus tremuloides GN=OMT2 PE=3 SV=1 Back     alignment and function description
>sp|Q43046|COMT1_POPKI Caffeic acid 3-O-methyltransferase 1 OS=Populus kitakamiensis GN=HOMT1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query114
154091348 365 caffeic acid O-methyl transferase [Leuca 1.0 0.312 0.710 2e-45
68159362 365 caffeic acid O-methyltransferase [Acacia 1.0 0.312 0.701 3e-45
302171551 366 putative caffeic acid O-methyltransferas 0.991 0.308 0.743 4e-45
1582580 365 caffeic acid O-methyltransferase 1.0 0.312 0.692 6e-45
254935147 365 caffeic acid O-methyltransferase [Jatrop 0.982 0.306 0.705 4e-44
357464229 365 Caffeic acid O-methyltransferase [Medica 0.982 0.306 0.705 4e-44
261889456 365 S-adenosyl-L-methionine: caffeic acid 3- 0.982 0.306 0.705 4e-44
116908 365 RecName: Full=Caffeic acid 3-O-methyltra 0.982 0.306 0.705 5e-44
363542116 224 caffeic acid-O-methyltransferase, partia 0.982 0.5 0.705 9e-44
363542089 224 caffeic acid-O-methyltransferase, partia 0.982 0.5 0.705 9e-44
>gi|154091348|gb|ABS57468.1| caffeic acid O-methyl transferase [Leucaena leucocephala] gi|155966780|gb|ABU41320.1| caffeic acid o-methyl transferase [Leucaena leucocephala] Back     alignment and taxonomy information
 Score =  186 bits (471), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 99/114 (86%)

Query: 1   MFVSIPKAEAIFMKWICHNWSEEACVKILKNCYEALPEDGKVIVVDCILPVLPDTSLASK 60
           MFVS+PKA+A+FMKWICH+WS+E CVK LKNCY+ALPE+GKVIV +CILP  PD+SLA+K
Sbjct: 252 MFVSVPKADAVFMKWICHDWSDEHCVKFLKNCYDALPENGKVIVAECILPASPDSSLATK 311

Query: 61  QVIQLDCFMLAYTIGGREMTEQDFKTLAKAAGFQGFKVVCSAFNTYIMEFLKNP 114
            V+ +D  MLA+  GG+E TE++F+ LAKAAGFQGF+V CSAFNTYIMEFLK P
Sbjct: 312 GVVHIDVIMLAHNPGGKERTEKEFEALAKAAGFQGFRVCCSAFNTYIMEFLKKP 365

Source: Leucaena leucocephala

Species: Leucaena leucocephala

Genus: Leucaena

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|68159362|gb|AAY86361.1| caffeic acid O-methyltransferase [Acacia auriculiformis x Acacia mangium] gi|312232062|gb|ADQ53456.1| caffeic acid O-methyltransferase [Acacia auriculiformis x Acacia mangium] Back     alignment and taxonomy information
>gi|302171551|gb|ADK97702.1| putative caffeic acid O-methyltransferase [Citrus aurantium] Back     alignment and taxonomy information
>gi|1582580|prf||2119166A caffeic acid O-methyltransferase Back     alignment and taxonomy information
>gi|254935147|gb|ACT87981.1| caffeic acid O-methyltransferase [Jatropha curcas] Back     alignment and taxonomy information
>gi|357464229|ref|XP_003602396.1| Caffeic acid O-methyltransferase [Medicago truncatula] gi|355491444|gb|AES72647.1| Caffeic acid O-methyltransferase [Medicago truncatula] Back     alignment and taxonomy information
>gi|261889456|gb|ACY06328.1| S-adenosyl-L-methionine: caffeic acid 3-0-methyltransferase [Medicago sativa] Back     alignment and taxonomy information
>gi|116908|sp|P28002.1|COMT1_MEDSA RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic acid 3-O-methyltransferase gi|23200293|pdb|1KYW|A Chain A, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde gi|23200294|pdb|1KYW|C Chain C, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde gi|23200295|pdb|1KYW|F Chain F, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde gi|23200296|pdb|1KYZ|A Chain A, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic Acid 35-O-Methyltransferase Ferulic Acid Complex gi|23200297|pdb|1KYZ|C Chain C, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic Acid 35-O-Methyltransferase Ferulic Acid Complex gi|23200298|pdb|1KYZ|E Chain E, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic Acid 35-O-Methyltransferase Ferulic Acid Complex gi|166420|gb|AAB46623.1| S-adenosyl-L-methionine: caffeic acid 3-0-methyltransferase [Medicago sativa] Back     alignment and taxonomy information
>gi|363542116|gb|AEW26176.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. x hemicycla] Back     alignment and taxonomy information
>gi|363542089|gb|AEW26161.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. x hemicycla] gi|363542091|gb|AEW26162.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. caerulea] gi|363542103|gb|AEW26169.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. caerulea] gi|363542105|gb|AEW26170.1| caffeic acid-O-methyltransferase, partial [Medicago falcata] gi|363542112|gb|AEW26174.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. caerulea] gi|363542121|gb|AEW26179.1| caffeic acid-O-methyltransferase, partial [Medicago falcata] gi|363542123|gb|AEW26180.1| caffeic acid-O-methyltransferase, partial [Medicago falcata] gi|363542129|gb|AEW26183.1| caffeic acid-O-methyltransferase, partial [Medicago falcata] gi|363542131|gb|AEW26184.1| caffeic acid-O-methyltransferase, partial [Medicago falcata] gi|363542133|gb|AEW26185.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. caerulea] gi|363542138|gb|AEW26188.1| caffeic acid-O-methyltransferase, partial [Medicago falcata] gi|363542140|gb|AEW26189.1| caffeic acid-O-methyltransferase, partial [Medicago falcata] gi|363542142|gb|AEW26190.1| caffeic acid-O-methyltransferase, partial [Medicago falcata] gi|363542146|gb|AEW26192.1| caffeic acid-O-methyltransferase, partial [Medicago falcata] gi|363542148|gb|AEW26193.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. caerulea] gi|363542150|gb|AEW26194.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. caerulea] gi|363542152|gb|AEW26195.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. caerulea] gi|363542154|gb|AEW26196.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. caerulea] gi|363542156|gb|AEW26197.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. caerulea] gi|363542158|gb|AEW26198.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. x hemicycla] gi|363542160|gb|AEW26199.1| caffeic acid-O-methyltransferase, partial [Medicago falcata] gi|363542165|gb|AEW26202.1| caffeic acid-O-methyltransferase, partial [Medicago falcata] gi|363542167|gb|AEW26203.1| caffeic acid-O-methyltransferase, partial [Medicago falcata] gi|363542169|gb|AEW26204.1| caffeic acid-O-methyltransferase, partial [Medicago falcata] gi|363542174|gb|AEW26207.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. caerulea] gi|363542176|gb|AEW26208.1| caffeic acid-O-methyltransferase, partial [Medicago falcata] gi|363542186|gb|AEW26214.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. caerulea] gi|363542191|gb|AEW26217.1| caffeic acid-O-methyltransferase, partial [Medicago falcata] gi|363542195|gb|AEW26219.1| caffeic acid-O-methyltransferase, partial [Medicago falcata] gi|363542197|gb|AEW26220.1| caffeic acid-O-methyltransferase, partial [Medicago falcata] gi|363542209|gb|AEW26227.1| caffeic acid-O-methyltransferase, partial [Medicago falcata] gi|363542211|gb|AEW26228.1| caffeic acid-O-methyltransferase, partial [Medicago falcata] gi|363542213|gb|AEW26229.1| caffeic acid-O-methyltransferase, partial [Medicago falcata] gi|363542215|gb|AEW26230.1| caffeic acid-O-methyltransferase, partial [Medicago falcata] gi|363542229|gb|AEW26239.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. x hemicycla] gi|363542233|gb|AEW26241.1| caffeic acid-O-methyltransferase, partial [Medicago falcata] gi|363542235|gb|AEW26242.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. caerulea] gi|363542240|gb|AEW26245.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. caerulea] gi|363542242|gb|AEW26246.1| caffeic acid-O-methyltransferase, partial [Medicago falcata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query114
TAIR|locus:2153423363 OMT1 "AT5G54160" [Arabidopsis 0.982 0.308 0.651 8.7e-40
UNIPROTKB|Q6ZD89368 ROMT-9 "Flavone 3'-O-methyltra 0.982 0.304 0.495 1e-27
UNIPROTKB|Q84N28360 OMT1 "Flavone O-methyltransfer 0.982 0.311 0.482 9.4e-27
UNIPROTKB|P93324372 P93324 "Isoliquiritigenin 2'-O 0.973 0.298 0.495 2.5e-26
TAIR|locus:2038026352 AT1G33030 [Arabidopsis thalian 0.991 0.321 0.442 3.6e-25
TAIR|locus:2034016363 AT1G51990 [Arabidopsis thalian 0.991 0.311 0.456 7.6e-25
TAIR|locus:2204680381 AT1G77520 [Arabidopsis thalian 0.982 0.293 0.442 2e-24
TAIR|locus:2204695381 AT1G77530 [Arabidopsis thalian 0.982 0.293 0.433 6.8e-24
TAIR|locus:2015223381 AT1G63140 [Arabidopsis thalian 0.982 0.293 0.460 1.4e-23
TAIR|locus:2015519205 AT1G62900 [Arabidopsis thalian 0.982 0.546 0.460 1.4e-23
TAIR|locus:2153423 OMT1 "AT5G54160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 424 (154.3 bits), Expect = 8.7e-40, P = 8.7e-40
 Identities = 73/112 (65%), Positives = 94/112 (83%)

Query:     1 MFVSIPKAEAIFMKWICHNWSEEACVKILKNCYEALPEDGKVIVVDCILPVLPDTSLASK 60
             MFVS+PK +AIFMKWICH+WS+E CVK LKNCYE+LPEDGKVI+ +CILP  PD+SL++K
Sbjct:   250 MFVSVPKGDAIFMKWICHDWSDEHCVKFLKNCYESLPEDGKVILAECILPETPDSSLSTK 309

Query:    61 QVIQLDCFMLAYTIGGREMTEQDFKTLAKAAGFQGFKVVCSAFNTYIMEFLK 112
             QV+ +DC MLA+  GG+E TE++F+ LAKA+GF+G KVVC AF   ++E LK
Sbjct:   310 QVVHVDCIMLAHNPGGKERTEKEFEALAKASGFKGIKVVCDAFGVNLIELLK 361
GO:0030744 "luteolin O-methyltransferase activity" evidence=IDA
GO:0030755 "quercetin 3-O-methyltransferase activity" evidence=IDA
GO:0033799 "myricetin 3'-O-methyltransferase activity" evidence=IDA
GO:0047763 "caffeate O-methyltransferase activity" evidence=ISS;IMP
GO:0051555 "flavonol biosynthetic process" evidence=IDA
GO:0009809 "lignin biosynthetic process" evidence=IMP
GO:0005634 "nucleus" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0006598 "polyamine catabolic process" evidence=RCA
GO:0009611 "response to wounding" evidence=RCA
GO:0009698 "phenylpropanoid metabolic process" evidence=RCA
GO:0009805 "coumarin biosynthetic process" evidence=RCA
GO:0009963 "positive regulation of flavonoid biosynthetic process" evidence=RCA
GO:0016126 "sterol biosynthetic process" evidence=RCA
GO:0042398 "cellular modified amino acid biosynthetic process" evidence=RCA
GO:0005829 "cytosol" evidence=TAS
UNIPROTKB|Q6ZD89 ROMT-9 "Flavone 3'-O-methyltransferase 1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q84N28 OMT1 "Flavone O-methyltransferase 1" [Triticum aestivum (taxid:4565)] Back     alignment and assigned GO terms
UNIPROTKB|P93324 P93324 "Isoliquiritigenin 2'-O-methyltransferase" [Medicago sativa (taxid:3879)] Back     alignment and assigned GO terms
TAIR|locus:2038026 AT1G33030 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034016 AT1G51990 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2204680 AT1G77520 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2204695 AT1G77530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015223 AT1G63140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015519 AT1G62900 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
pfam00891239 pfam00891, Methyltransf_2, O-methyltransferase 2e-40
>gnl|CDD|216177 pfam00891, Methyltransf_2, O-methyltransferase Back     alignment and domain information 
 Score =  133 bits (338), Expect = 2e-40
 Identities = 46/89 (51%), Positives = 63/89 (70%), Gaps = 2/89 (2%)

Query: 1   MFVSIPKAEAIFMKWICHNWSEEACVKILKNCYEALPEDGKVIVVDCILPVLPDTSLASK 60
            F S+P+A+AI +KW+ H+WS+E CVKILK CYEALP  GKVIVV+ +LP  PD  L + 
Sbjct: 153 FFESVPEADAILLKWVLHDWSDEDCVKILKRCYEALPPGGKVIVVEMVLPEDPDDDLET- 211

Query: 61  QVIQLDCFMLAYTIGGREMTEQDFKTLAK 89
           +V+ LD  ML    GG+E TE++++ L  
Sbjct: 212 EVLLLDLNMLV-LNGGKERTEKEWRKLLS 239

This family includes a range of O-methyltransferases. These enzymes utilise S-adenosyl methionine. Length = 239

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 114
KOG3178342 consensus Hydroxyindole-O-methyltransferase and re 99.92
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 99.89
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 99.66
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 99.47
TIGR00740239 methyltransferase, putative. A simple BLAST search 99.26
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 99.04
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 99.03
PLN02233261 ubiquinone biosynthesis methyltransferase 99.0
PLN02232160 ubiquinone biosynthesis methyltransferase 98.98
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 98.91
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 98.91
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 98.88
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 98.88
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 98.85
PLN02490340 MPBQ/MSBQ methyltransferase 98.85
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 98.82
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 98.79
TIGR00452314 methyltransferase, putative. Known examples to dat 98.77
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 98.77
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 98.73
PLN02244340 tocopherol O-methyltransferase 98.65
PLN02336475 phosphoethanolamine N-methyltransferase 98.63
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 98.61
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 98.5
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 98.47
PRK08317241 hypothetical protein; Provisional 98.47
PLN02336 475 phosphoethanolamine N-methyltransferase 98.44
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 98.36
PRK11207197 tellurite resistance protein TehB; Provisional 98.35
KOG4300252 consensus Predicted methyltransferase [General fun 98.32
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 98.28
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 98.27
KOG2361264 consensus Predicted methyltransferase [General fun 98.24
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 98.17
PRK04266226 fibrillarin; Provisional 98.16
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 98.16
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 98.14
TIGR03438301 probable methyltransferase. This model represents 98.13
PF04672267 Methyltransf_19: S-adenosyl methyltransferase; Int 98.1
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 98.03
PRK12335287 tellurite resistance protein TehB; Provisional 98.03
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 97.96
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 97.95
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 97.94
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 97.93
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 97.92
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 97.91
PLN02585315 magnesium protoporphyrin IX methyltransferase 97.89
PF11968219 DUF3321: Putative methyltransferase (DUF3321); Int 97.86
PRK06202232 hypothetical protein; Provisional 97.84
PTZ00146293 fibrillarin; Provisional 97.83
PRK10611287 chemotaxis methyltransferase CheR; Provisional 97.75
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 97.73
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 97.7
PRK06922677 hypothetical protein; Provisional 97.67
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 97.65
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 97.58
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 97.58
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 97.58
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 97.56
PRK05785226 hypothetical protein; Provisional 97.54
PLN03075296 nicotianamine synthase; Provisional 97.5
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 97.48
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 97.45
PF01234256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 97.45
PRK10258251 biotin biosynthesis protein BioC; Provisional 97.44
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 97.36
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 97.33
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 97.25
KOG1270282 consensus Methyltransferases [Coenzyme transport a 97.19
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 97.13
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 97.06
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 97.0
COG4798238 Predicted methyltransferase [General function pred 96.99
KOG3045325 consensus Predicted RNA methylase involved in rRNA 96.94
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 96.93
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 96.74
PRK13255218 thiopurine S-methyltransferase; Reviewed 96.71
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 96.68
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 96.64
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 96.6
PRK14968188 putative methyltransferase; Provisional 96.51
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 96.29
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 96.21
COG4627185 Uncharacterized protein conserved in bacteria [Fun 96.18
PRK13256226 thiopurine S-methyltransferase; Reviewed 96.18
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 95.96
KOG1975389 consensus mRNA cap methyltransferase [RNA processi 95.78
KOG2899288 consensus Predicted methyltransferase [General fun 95.75
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 95.6
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 95.44
TIGR03439319 methyl_EasF probable methyltransferase domain, Eas 95.35
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 95.32
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 95.07
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 94.88
PF06859110 Bin3: Bicoid-interacting protein 3 (Bin3); InterPr 94.73
PF07942270 N2227: N2227-like protein; InterPro: IPR012901 Thi 94.49
TIGR00027260 mthyl_TIGR00027 methyltransferase, putative, TIGR0 94.48
COG4106257 Tam Trans-aconitate methyltransferase [General fun 94.42
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 94.12
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 93.84
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 93.74
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 93.3
KOG1331293 consensus Predicted methyltransferase [General fun 92.98
PF09243274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 92.76
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 92.75
PF11899380 DUF3419: Protein of unknown function (DUF3419); In 92.55
COG3315297 O-Methyltransferase involved in polyketide biosynt 91.7
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 91.53
COG5459 484 Predicted rRNA methylase [Translation, ribosomal s 91.51
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 90.84
TIGR00438188 rrmJ cell division protein FtsJ. 90.28
COG4123248 Predicted O-methyltransferase [General function pr 90.14
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 90.13
COG4976287 Predicted methyltransferase (contains TPR repeat) 90.05
cd01842183 SGNH_hydrolase_like_5 SGNH_hydrolase subfamily. SG 90.04
COG4301321 Uncharacterized conserved protein [Function unknow 89.95
PF03141506 Methyltransf_29: Putative S-adenosyl-L-methionine- 89.57
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 89.44
PRK14967223 putative methyltransferase; Provisional 89.3
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 89.1
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 88.79
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 88.58
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 88.58
KOG2798369 consensus Putative trehalase [Carbohydrate transpo 88.54
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 88.34
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 88.29
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 88.24
PRK00811283 spermidine synthase; Provisional 87.49
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 86.73
COG2521287 Predicted archaeal methyltransferase [General func 86.55
PF10017127 Methyltransf_33: Histidine-specific methyltransfer 86.42
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 86.41
KOG3010261 consensus Methyltransferase [General function pred 85.97
PF0710997 Mg-por_mtran_C: Magnesium-protoporphyrin IX methyl 85.8
PRK04457262 spermidine synthase; Provisional 85.77
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 85.52
TIGR00006305 S-adenosyl-methyltransferase MraW. Genetics paper 84.88
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 84.46
COG0275314 Predicted S-adenosylmethionine-dependent methyltra 83.99
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 83.77
PRK07402196 precorrin-6B methylase; Provisional 83.36
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 83.24
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 83.21
PRK00050296 16S rRNA m(4)C1402 methyltranserfase; Provisional 82.92
PF03269177 DUF268: Caenorhabditis protein of unknown function 82.38
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 82.35
PLN02366308 spermidine synthase 81.92
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 81.14
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 80.41
KOG3987288 consensus Uncharacterized conserved protein DREV/C 80.36
>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information 
Probab=99.92  E-value=2.6e-25  Score=158.72  Aligned_cols=112  Identities=42%  Similarity=0.760  Sum_probs=97.4

Q ss_pred             CCCCCCcceEEEeccccccCChHHHHHHHHHHHHhCCCCcEEEEEeeecCCCCCC-chhhhhhhhcchhccccccCceec
Q 033647            1 MFVSIPKAEAIFMKWICHNWSEEACVKILKNCYEALPEDGKVIVVDCILPVLPDT-SLASKQVIQLDCFMLAYTIGGREM   79 (114)
Q Consensus         1 ~f~~~p~~D~vl~~~vlh~~~d~~~~~lL~~~~~aL~pgg~l~i~e~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~g~~r   79 (114)
                      ||+.+|.+|+||++||||||+|++|+++|+||+++|+|||.|+++|.+.++.... +.........|+.|++++.+|++|
T Consensus       230 mfq~~P~~daI~mkWiLhdwtDedcvkiLknC~~sL~~~GkIiv~E~V~p~e~~~dd~~s~v~~~~d~lm~~~~~~Gker  309 (342)
T KOG3178|consen  230 MFQDTPKGDAIWMKWILHDWTDEDCVKILKNCKKSLPPGGKIIVVENVTPEEDKFDDIDSSVTRDMDLLMLTQTSGGKER  309 (342)
T ss_pred             ccccCCCcCeEEEEeecccCChHHHHHHHHHHHHhCCCCCEEEEEeccCCCCCCccccccceeehhHHHHHHHhccceec
Confidence            6867999999999999999999999999999999999999999999999863222 111223456888888777889999


Q ss_pred             CHHHHHHHHHHcCCceeEEEEcCCceeEEEEEe
Q 033647           80 TEQDFKTLAKAAGFQGFKVVCSAFNTYIMEFLK  112 (114)
Q Consensus        80 t~~e~~~ll~~aGf~~~~~~~~~~~~~~ie~~~  112 (114)
                      +.+||+.++.++||....+...+..+++||++|
T Consensus       310 t~~e~q~l~~~~gF~~~~~~~~~~~~~~Ie~~k  342 (342)
T KOG3178|consen  310 TLKEFQALLPEEGFPVCMVALTAYSYSVIEFHK  342 (342)
T ss_pred             cHHHHHhcchhhcCceeEEEeccCccchheeCC
Confidence            999999999999999999999988899999875

>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>COG4627 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PF06859 Bin3: Bicoid-interacting protein 3 (Bin3); InterPro: IPR010675 This entry represents a conserved region of approximately 120 residues within eukaryotic Bicoid-interacting protein 3 (Bin3) Back     alignment and domain information
>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) Back     alignment and domain information
>TIGR00027 mthyl_TIGR00027 methyltransferase, putative, TIGR00027 family Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>KOG1331 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PF11899 DUF3419: Protein of unknown function (DUF3419); InterPro: IPR021829 This family of proteins are functionally uncharacterised Back     alignment and domain information
>COG3315 O-Methyltransferase involved in polyketide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>COG5459 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>cd01842 SGNH_hydrolase_like_5 SGNH_hydrolase subfamily Back     alignment and domain information
>COG4301 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>KOG2798 consensus Putative trehalase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>PF10017 Methyltransf_33: Histidine-specific methyltransferase, SAM-dependent; InterPro: IPR019257 This domain is found in methyltransferases and various hypothetical proteins Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>PF07109 Mg-por_mtran_C: Magnesium-protoporphyrin IX methyltransferase C-terminus; InterPro: IPR010940 This entry represents the C terminus (approximately 100 residues) of bacterial and eukaryotic Magnesium-protoporphyrin IX methyltransferase (2 Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>PF03269 DUF268: Caenorhabditis protein of unknown function, DUF268; InterPro: IPR004951 This family consists of proteins of unknown function found in Caenorhabditis species Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>KOG3987 consensus Uncharacterized conserved protein DREV/CGI-81 [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
1kyw_A365 Crystal Structure Analysis Of Caffeic Acid5-Hydroxy 8e-47
3reo_A368 Monolignol O-Methyltransferase (Momt) Length = 368 6e-40
3p9c_A364 Crystal Structure Of Perennial Ryegrass Lpomt1 Boun 4e-29
1fp1_D372 Crystal Structure Analysis Of Chalcone O-Methyltran 2e-28
1fpq_A372 Crystal Structure Analysis Of Selenomethionine Subs 3e-26
2qyo_A357 Crystal Structure Of Isoflavone O-Methyltransferase 3e-15
1fp2_A352 Crystal Structure Analysis Of Isoflavone O-Methyltr 3e-15
1zg3_A358 Crystal Structure Of The Isoflavanone 4'-O-Methyltr 3e-15
1zga_A357 Crystal Structure Of Isoflavanone 4'-o-methyltransf 3e-15
1zgj_A354 Crystal Structure Of Isoflavanone 4'-O-Methyltransf 3e-15
1fpx_A352 Crystal Structure Analysis Of Selenomethionine Subs 7e-14
3lst_A348 Crystal Structure Of Calo1, Methyltransferase In Ca 6e-09
1tw2_A360 Crystal Structure Of Carminomycin-4-O-Methyltransfe 1e-05
4a6d_A353 Crystal Structure Of Human N-Acetylserotonin Methyl 2e-04
3i53_A332 Crystal Structure Of An O-Methyltransferase (Ncsb1) 6e-04
3gwz_A369 Structure Of The Mitomycin 7-O-Methyltransferase Mm 7e-04
1qzz_A374 Crystal Structure Of Aclacinomycin-10-Hydroxylase ( 7e-04
>pdb|1KYW|A Chain A, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde Length = 365 Back     alignment and structure 
Iteration: 1

 Score =  181 bits (459), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 79/112 (70%), Positives = 98/112 (87%)
Query: 1   MFVSIPKAEAIFMKWICHNWSEEACVKILKNCYEALPEDGKVIVVDCILPVLPDTSLASK 60
           MFVSIPKA+A+FMKWICH+WS+E C+K LKNCYEALP++GKVIV +CILPV PD+SLA+K
Sbjct: 252 MFVSIPKADAVFMKWICHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATK 311
Query: 61  QVIQLDCFMLAYTIGGREMTEQDFKTLAKAAGFQGFKVVCSAFNTYIMEFLK 112
            V+ +D  MLA+  GG+E T+++F+ LAK AGFQGFKV C+AFNTYIMEFLK
Sbjct: 312 GVVHIDVIMLAHNPGGKERTQKEFEDLAKGAGFQGFKVHCNAFNTYIMEFLK 363
>pdb|3REO|A Chain A, Monolignol O-Methyltransferase (Momt) Length = 368 Back     alignment and structure
>pdb|3P9C|A Chain A, Crystal Structure Of Perennial Ryegrass Lpomt1 Bound To Sah Length = 364 Back     alignment and structure
>pdb|1FP1|D Chain D, Crystal Structure Analysis Of Chalcone O-Methyltransferase Length = 372 Back     alignment and structure
>pdb|1FPQ|A Chain A, Crystal Structure Analysis Of Selenomethionine Substituted Chalcone O- Methyltransferase Length = 372 Back     alignment and structure
>pdb|2QYO|A Chain A, Crystal Structure Of Isoflavone O-Methyltransferase Homolog In Complex With Biochanin A And Sah Length = 357 Back     alignment and structure
>pdb|1FP2|A Chain A, Crystal Structure Analysis Of Isoflavone O-Methyltransferase Length = 352 Back     alignment and structure
>pdb|1ZG3|A Chain A, Crystal Structure Of The Isoflavanone 4'-O-Methyltransferase Complexed With Sah And 2,7,4'-Trihydroxyisoflavanone Length = 358 Back     alignment and structure
>pdb|1ZGA|A Chain A, Crystal Structure Of Isoflavanone 4'-o-methyltransferase Complexed With (+)-6a-hydroxymaackiain Length = 357 Back     alignment and structure
>pdb|1ZGJ|A Chain A, Crystal Structure Of Isoflavanone 4'-O-Methyltransferase Complexed With (+)-Pisatin Length = 354 Back     alignment and structure
>pdb|1FPX|A Chain A, Crystal Structure Analysis Of Selenomethionine Substituted Isoflavone O-Methyltransferase Length = 352 Back     alignment and structure
>pdb|3LST|A Chain A, Crystal Structure Of Calo1, Methyltransferase In Calicheamicin Biosynthesis, Sah Bound Form Length = 348 Back     alignment and structure
>pdb|1TW2|A Chain A, Crystal Structure Of Carminomycin-4-O-Methyltransferase (Dnrk) In Complex With S-Adenosyl-L-Homocystein (Sah) And 4-Methoxy-E-Rhodomycin T (M-Et) Length = 360 Back     alignment and structure
>pdb|4A6D|A Chain A, Crystal Structure Of Human N-Acetylserotonin Methyltransferase (Asmt) In Complex With Sam Length = 353 Back     alignment and structure
>pdb|3I53|A Chain A, Crystal Structure Of An O-Methyltransferase (Ncsb1) From Neocarzinostatin Biosynthesis In Complex With S-Adenosyl-L- Homocysteine (Sah) Length = 332 Back     alignment and structure
>pdb|3GWZ|A Chain A, Structure Of The Mitomycin 7-O-Methyltransferase Mmcr Length = 369 Back     alignment and structure
>pdb|1QZZ|A Chain A, Crystal Structure Of Aclacinomycin-10-Hydroxylase (Rdmb) In Complex With S-Adensyl-L-Methionine (Sam) Length = 374 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 7e-52
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 3e-51
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 4e-49
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 6e-45
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 2e-43
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 1e-42
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 3e-42
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 8e-42
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 5e-41
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 1e-40
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 3e-39
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 2e-36
2r3s_A335 Uncharacterized protein; methyltransferase domain, 1e-35
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 2e-31
3dp7_A363 SAM-dependent methyltransferase; structural genomi 9e-28
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 4e-05
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Length = 364 Back     alignment and structure
 Score =  166 bits (421), Expect = 7e-52
 Identities = 53/112 (47%), Positives = 74/112 (66%)

Query: 1   MFVSIPKAEAIFMKWICHNWSEEACVKILKNCYEALPEDGKVIVVDCILPVLPDTSLASK 60
           MF  +P  + I MKWI H+WS++ C  +LKNCY+ALP  GKV++V CILPV P+ + +S+
Sbjct: 253 MFKEVPSGDTILMKWILHDWSDQHCATLLKNCYDALPAHGKVVLVQCILPVNPEANPSSQ 312

Query: 61  QVIQLDCFMLAYTIGGREMTEQDFKTLAKAAGFQGFKVVCSAFNTYIMEFLK 112
            V  +D  MLA+  GGRE  E++F+ LA+ AGF G K      N + +EF K
Sbjct: 313 GVFHVDMIMLAHNPGGRERYEREFQALARGAGFTGVKSTYIYANAWAIEFTK 364
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 1kyz_A* 1kyw_A* Length = 368 Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Length = 372 Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Length = 352 Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Length = 348 Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Length = 334 Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Length = 369 Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Length = 374 Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Length = 358 Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Length = 360 Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Length = 332 Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Length = 359 Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Length = 335 Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Length = 352 Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Length = 363 Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Length = 241 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query114
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 99.96
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 99.92
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 99.92
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 99.87
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 99.86
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 99.86
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 99.86
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 99.84
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 99.84
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 99.84
3dp7_A363 SAM-dependent methyltransferase; structural genomi 99.82
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 99.78
2r3s_A335 Uncharacterized protein; methyltransferase domain, 99.77
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 99.76
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 99.75
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 99.74
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 99.38
3dtn_A234 Putative methyltransferase MM_2633; structural gen 99.34
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 99.22
3hnr_A220 Probable methyltransferase BT9727_4108; structural 99.2
3dh0_A219 SAM dependent methyltransferase; cystal structure, 99.16
3i9f_A170 Putative type 11 methyltransferase; structural gen 99.14
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 99.1
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 99.07
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 99.07
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 99.07
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 99.06
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 99.04
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 99.04
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 99.01
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 98.99
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 98.97
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 98.97
1vl5_A260 Unknown conserved protein BH2331; putative methylt 98.95
3ocj_A305 Putative exported protein; structural genomics, PS 98.94
3lcc_A235 Putative methyl chloride transferase; halide methy 98.94
1xxl_A239 YCGJ protein; structural genomics, protein structu 98.92
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 98.9
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 98.9
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 98.9
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 98.89
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 98.89
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 98.88
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 98.88
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 98.86
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 98.85
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 98.85
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 98.83
1vlm_A219 SAM-dependent methyltransferase; possible histamin 98.83
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 98.82
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 98.82
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 98.81
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 98.8
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 98.79
2i62_A265 Nicotinamide N-methyltransferase; structural genom 98.76
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 98.76
2p7i_A250 Hypothetical protein; putative methyltransferase, 98.75
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 98.75
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 98.75
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 98.75
3cc8_A230 Putative methyltransferase; structural genomics, j 98.74
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 98.7
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 98.69
3f4k_A257 Putative methyltransferase; structural genomics, P 98.68
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 98.67
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 98.66
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 98.62
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 98.61
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 98.61
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 98.6
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 98.58
3gu3_A284 Methyltransferase; alpha-beta protein, structural 98.56
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 98.54
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 98.51
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 98.49
3ege_A261 Putative methyltransferase from antibiotic biosyn 98.49
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 98.46
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 98.45
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 98.45
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 98.44
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 98.41
3giw_A277 Protein of unknown function DUF574; rossmann-fold 98.35
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 98.34
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 98.32
3m70_A286 Tellurite resistance protein TEHB homolog; structu 98.24
2kw5_A202 SLR1183 protein; structural genomics, northeast st 98.19
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 98.16
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 98.07
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 98.05
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 98.04
1wzn_A252 SAM-dependent methyltransferase; structural genomi 97.98
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 97.97
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 97.75
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 97.7
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 97.67
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 97.67
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 97.65
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 97.64
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 97.62
4hg2_A257 Methyltransferase type 11; structural genomics, PS 97.52
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 97.5
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 97.47
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 97.46
2b3t_A276 Protein methyltransferase HEMK; translation termin 97.46
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 97.46
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 97.45
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 97.42
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 97.41
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 97.39
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 97.34
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 97.31
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 97.25
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 97.24
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 97.16
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 97.11
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 97.04
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 96.95
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 96.94
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 96.93
2h00_A254 Methyltransferase 10 domain containing protein; st 96.9
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 96.82
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 96.81
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 96.78
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 96.75
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 96.65
3lpm_A259 Putative methyltransferase; structural genomics, p 96.63
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 96.63
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 96.58
1rjd_A334 PPM1P, carboxy methyl transferase for protein phos 96.55
3b5i_A374 S-adenosyl-L-methionine:salicylic acid carboxyl me 96.48
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 96.33
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 96.22
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 96.2
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 96.19
1yb2_A275 Hypothetical protein TA0852; structural genomics, 96.19
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 96.15
3m33_A226 Uncharacterized protein; structural genomics, PSI- 96.13
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 96.13
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 95.87
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 95.8
2efj_A384 3,7-dimethylxanthine methyltransferase; SAM-depend 95.77
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 95.66
1m6e_X359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 95.6
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 95.49
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 95.46
3iei_A334 Leucine carboxyl methyltransferase 1; LCMT-1, S-ad 95.45
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 95.45
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 95.34
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 95.32
2zwa_A 695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 95.3
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 95.26
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 95.19
3duw_A223 OMT, O-methyltransferase, putative; alternating of 95.18
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 95.13
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 94.8
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 94.74
2qm3_A373 Predicted methyltransferase; putative methyltransf 94.58
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 94.56
1jsx_A207 Glucose-inhibited division protein B; methyltransf 94.51
2frn_A278 Hypothetical protein PH0793; structural genomics, 94.36
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 94.29
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 94.28
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 94.21
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 94.2
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 94.17
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 94.08
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 94.04
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 94.01
3sso_A419 Methyltransferase; macrolide, natural product, ros 93.99
2avd_A229 Catechol-O-methyltransferase; structural genomics, 93.44
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 93.24
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 93.24
2uyo_A310 Hypothetical protein ML2640; putative methyltransf 93.24
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 93.09
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 92.88
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 92.85
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 92.82
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 92.51
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 92.45
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 92.3
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 92.25
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 92.04
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 91.97
2i7c_A283 Spermidine synthase; transferase, structural genom 91.78
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 91.69
1ws6_A171 Methyltransferase; structural genomics, riken stru 91.67
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 91.59
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 91.25
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown 90.79
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 90.61
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 90.61
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 90.47
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 90.16
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 90.12
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 89.99
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 89.98
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 89.97
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 89.92
3gjy_A317 Spermidine synthase; APC62791, structural genomics 89.78
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 89.66
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 89.49
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 89.46
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 89.43
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 89.27
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 89.25
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 89.17
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 88.98
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 88.97
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 88.75
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 88.69
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 88.68
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 88.57
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 88.55
2esr_A177 Methyltransferase; structural genomics, hypothetic 88.41
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 88.33
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 88.14
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 88.05
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 87.88
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 87.5
2o07_A304 Spermidine synthase; structural genomics, structur 87.45
3vyw_A308 MNMC2; tRNA wobble uridine, modification enzyme, g 87.21
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 87.06
2pt6_A321 Spermidine synthase; transferase, structural genom 86.72
1xj5_A334 Spermidine synthase 1; structural genomics, protei 86.71
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 85.97
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 85.79
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 84.97
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 84.63
2fpo_A202 Methylase YHHF; structural genomics, putative meth 84.43
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 84.02
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 83.99
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 83.02
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 82.9
2cmg_A262 Spermidine synthase; transferase, putrescine amino 82.44
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 82.43
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 82.07
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 81.74
2km1_A136 Protein DRE2; yeast, antiapoptotic, protein bindin 81.46
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 80.66
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
Probab=99.96  E-value=1.3e-28  Score=177.51  Aligned_cols=110  Identities=21%  Similarity=0.390  Sum_probs=98.6

Q ss_pred             CC-CCCCcceEEEeccccccCChHHHHHHHHHHHHhCCCCcEEEEEeeecCCCCCCchhhhhhhhcchhccccccCceec
Q 033647            1 MF-VSIPKAEAIFMKWICHNWSEEACVKILKNCYEALPEDGKVIVVDCILPVLPDTSLASKQVIQLDCFMLAYTIGGREM   79 (114)
Q Consensus         1 ~f-~~~p~~D~vl~~~vlh~~~d~~~~~lL~~~~~aL~pgg~l~i~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~r   79 (114)
                      || +++|.+|+|+++++||+|+|++|.++|++++++|+|||+++|+|.+.++++..+.   ....+|+.|+. ..+|++|
T Consensus       237 ~~~~~~~~~D~~~~~~vlh~~~d~~~~~iL~~~~~al~pgg~lli~e~~~~~~~~~~~---~~~~~dl~ml~-~~~g~er  312 (353)
T 4a6d_A          237 FFKDPLPEADLYILARVLHDWADGKCSHLLERIYHTCKPGGGILVIESLLDEDRRGPL---LTQLYSLNMLV-QTEGQER  312 (353)
T ss_dssp             TTTSCCCCCSEEEEESSGGGSCHHHHHHHHHHHHHHCCTTCEEEEEECCCCTTSCCCH---HHHHHHHHHHH-SSSCCCC
T ss_pred             cccCCCCCceEEEeeeecccCCHHHHHHHHHHHHhhCCCCCEEEEEEeeeCCCCCCCH---HHHHHHHHHHH-hCCCcCC
Confidence            56 4567799999999999999999999999999999999999999999988765543   34568899885 6799999


Q ss_pred             CHHHHHHHHHHcCCceeEEEEcCCceeEEEEEeCC
Q 033647           80 TEQDFKTLAKAAGFQGFKVVCSAFNTYIMEFLKNP  114 (114)
Q Consensus        80 t~~e~~~ll~~aGf~~~~~~~~~~~~~~ie~~~~~  114 (114)
                      |.+||.+||++|||+.+++.++++.+++|+|+|-+
T Consensus       313 t~~e~~~ll~~AGf~~v~v~~~~~~~~~i~ArKgt  347 (353)
T 4a6d_A          313 TPTHYHMLLSSAGFRDFQFKKTGAIYDAILARKGT  347 (353)
T ss_dssp             CHHHHHHHHHHHTCEEEEEECCSSSCEEEEEECCC
T ss_pred             CHHHHHHHHHHCCCceEEEEEcCCceEEEEEEecC
Confidence            99999999999999999999999999999999864
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>1rjd_A PPM1P, carboxy methyl transferase for protein phosphatase 2A catalytic subunit; SAM dependent methyltransferase; HET: SAM; 1.80A {Saccharomyces cerevisiae} SCOP: c.66.1.37 PDB: 1rje_A* 1rjf_A 1rjg_A* 2ob2_A* 2ob1_A Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3iei_A Leucine carboxyl methyltransferase 1; LCMT-1, S-adenosyl-L-methionine; HET: SAH MES; 1.90A {Homo sapiens} PDB: 3p71_T* 3mnt_A* 3o7w_A* Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>2uyo_A Hypothetical protein ML2640; putative methyltransferase, transferas; 1.7A {Mycobacterium leprae} SCOP: c.66.1.57 PDB: 2ckd_A 2uyq_A* Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>3vyw_A MNMC2; tRNA wobble uridine, modification enzyme, genetic CODE, 5- methylaminomethyl-2-thiouridine, methyltransferase; HET: SAM; 2.49A {Aquifex aeolicus} PDB: 2e58_A* Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>2km1_A Protein DRE2; yeast, antiapoptotic, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 114
d1kyza2243 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferuli 4e-32
d1fp1d2244 c.66.1.12 (D:129-372) Chalcone O-methyltransferase 4e-32
d1fp2a2244 c.66.1.12 (A:109-352) Isoflavone O-methyltransfera 4e-26
d1qzza2256 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase 4e-12
d1tw3a2253 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransf 1e-10
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 243 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Plant O-methyltransferase, C-terminal domain
domain: Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase
species: Alfalfa (Medicago sativa) [TaxId: 3879]

 Score =  111 bits (277), Expect = 4e-32
 Identities = 78/111 (70%), Positives = 97/111 (87%)

Query: 1   MFVSIPKAEAIFMKWICHNWSEEACVKILKNCYEALPEDGKVIVVDCILPVLPDTSLASK 60
           MFVSIPKA+A+FMKWICH+WS+E C+K LKNCYEALP++GKVIV +CILPV PD+SLA+K
Sbjct: 133 MFVSIPKADAVFMKWICHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATK 192

Query: 61  QVIQLDCFMLAYTIGGREMTEQDFKTLAKAAGFQGFKVVCSAFNTYIMEFL 111
            V+ +D  MLA+  GG+E T+++F+ LAK AGFQGFKV C+AFNTYIMEFL
Sbjct: 193 GVVHIDVIMLAHNPGGKERTQKEFEDLAKGAGFQGFKVHCNAFNTYIMEFL 243
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 244 Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 244 Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Length = 256 Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Length = 253 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query114
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 99.97
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 99.97
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 99.95
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 99.92
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 99.87
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 99.33
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 99.31
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 99.21
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 99.15
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.11
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 99.11
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 98.91
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 98.89
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 98.8
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 98.62
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 98.57
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 98.53
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 98.49
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 98.45
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 98.41
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 98.38
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 98.32
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 98.2
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 98.16
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 98.13
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 98.13
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 98.13
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 97.87
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 97.77
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 97.72
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 97.52
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 97.27
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 96.93
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 96.84
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 96.7
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 96.56
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 96.54
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 96.14
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 95.95
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 94.91
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 93.98
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 92.35
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 92.08
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 92.0
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 91.56
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 90.84
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 90.74
d2uyoa1297 Putative methyltransferase ML2640 {Mycobacterium l 88.12
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 87.88
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 87.86
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 87.56
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 85.67
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 83.0
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 81.91
d1rjda_328 Leucine carboxy methyltransferase Ppm1 {Baker's ye 81.43
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 80.65
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 80.49
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Plant O-methyltransferase, C-terminal domain
domain: Chalcone O-methyltransferase
species: Alfalfa (Medicago sativa) [TaxId: 3879]

Probab=99.97  E-value=6.8e-31  Score=179.94  Aligned_cols=111  Identities=48%  Similarity=0.875  Sum_probs=98.9

Q ss_pred             CCCCCCcceEEEeccccccCChHHHHHHHHHHHHhCCCCcEEEEEeeecCCCCCCchhhhhhhhcchhccccccCceecC
Q 033647            1 MFVSIPKAEAIFMKWICHNWSEEACVKILKNCYEALPEDGKVIVVDCILPVLPDTSLASKQVIQLDCFMLAYTIGGREMT   80 (114)
Q Consensus         1 ~f~~~p~~D~vl~~~vlh~~~d~~~~~lL~~~~~aL~pgg~l~i~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~rt   80 (114)
                      ||+++|.+|+|+++++||+|+|++|.++|++++++|+|||+++|+|.+.++.+..+........+|+.|+. +.+|++||
T Consensus       133 ~~~~~p~~D~~~l~~vLh~~~de~~~~iL~~~~~aL~pgg~llI~e~v~~~~~~~~~~~~~~~~~d~~m~~-~~~g~ert  211 (244)
T d1fp1d2         133 MFASVPQGDAMILKAVCHNWSDEKCIEFLSNCHKALSPNGKVIIVEFILPEEPNTSEESKLVSTLDNLMFI-TVGGRERT  211 (244)
T ss_dssp             TTTCCCCEEEEEEESSGGGSCHHHHHHHHHHHHHHEEEEEEEEEEEEEECSSCCSSHHHHHHHHHHHHHHH-HHSCCCEE
T ss_pred             cccccccceEEEEehhhhhCCHHHHHHHHHHHHHHcCCCcEEEEEEEEecCCCCCchHHHHHHHHHHHHHh-hCCCcCCC
Confidence            68999999999999999999999999999999999999999999999999877655443345677888884 67999999


Q ss_pred             HHHHHHHHHHcCCceeEEEEc-CCceeEEEEEe
Q 033647           81 EQDFKTLAKAAGFQGFKVVCS-AFNTYIMEFLK  112 (114)
Q Consensus        81 ~~e~~~ll~~aGf~~~~~~~~-~~~~~~ie~~~  112 (114)
                      .+||.+||++|||+.+++++. .+..+|||++|
T Consensus       212 ~~e~~~ll~~AGF~~v~v~~~~~~~~~viE~~K  244 (244)
T d1fp1d2         212 EKQYEKLSKLSGFSKFQVACRAFNSLGVMEFYK  244 (244)
T ss_dssp             HHHHHHHHHHTTCSEEEEEEEETTTEEEEEEEC
T ss_pred             HHHHHHHHHHcCCCceEEEecCCCCEEEEEEeC
Confidence            999999999999999999765 57899999997
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2uyoa1 c.66.1.57 (A:14-310) Putative methyltransferase ML2640 {Mycobacterium leprae [TaxId: 1769]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1rjda_ c.66.1.37 (A:) Leucine carboxy methyltransferase Ppm1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure