Citrus Sinensis ID: 033806

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-
MDGADGGEVDRIVDSKDLQQQSKALDKLTDRVEDRQLDSTRVQEAMASIAASKAGDLNAMRMREKELAAVKINAADVDIIANELELDKKVAERTLREHKGDAVAAIRHLLR
cccccccccccccccHHHHHHHHHHHHccHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHc
cccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEcHHHHHHHHHHHHccHHHHHHHHHHHccHHHHHHHHHHc
mdgadggevdrivdsKDLQQQSKALDKLTDrvedrqldSTRVQEAMASIAASKAGDLNAMRMREKELAAVKINAADVDIIANELELDKKVAERTLREHKGDAVAAIRHLLR
mdgadggevdrivdskdlqqqskaldkltdrvedrqldstrvQEAMASIAaskagdlnAMRMREKELAAVKINAADVDIIANELELDKKVAertlrehkgdaVAAIRHLLR
MDGADGGEVDRIVDSKDLQQQSKALDKLTDRVEDRQLDSTRVQEAMASIAASKAGDLNAMRMREKELAAVKINAADVDIIANELELDKKVAERTLREHKGDAVAAIRHLLR
******************************************************************LAAVKINAADVDIIANELELDKKV*********************
**********************************************************************KINAADVDIIANELELDKKVAERTLREHKGDAVAAIRHLLR
********VDRIVDSKDLQQQSKALDKLTDRVEDRQLDSTRVQEAMASIAASKAGDLNAMRMREKELAAVKINAADVDIIANELELDKKVAERTLREHKGDAVAAIRHLLR
************************LDKLTDRVEDRQLDSTRVQEAMASIAASKAGDLNAMRMREKELAAVKINAADVDIIANELELDKKVAERTLREHKGDAVAAIRHLLR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDGADGGEVDRIVDSKDxxxxxxxxxxxxxxxxxxxxxSTRVQEAMASIAASKAGDLNAMRMREKELAAVKINAADVDIIxxxxxxxxxxxxxxxxxxxxxAVAAIRHLLR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query111 2.2.26 [Sep-21-2011]
Q9CR41129 Huntingtin-interacting pr yes no 0.738 0.635 0.378 8e-10
Q2PFU1129 Huntingtin-interacting pr N/A no 0.738 0.635 0.378 8e-10
Q9NX55129 Huntingtin-interacting pr yes no 0.738 0.635 0.378 8e-10
>sp|Q9CR41|HYPK_MOUSE Huntingtin-interacting protein K OS=Mus musculus GN=Hypk PE=2 SV=2 Back     alignment and function desciption
 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 55/82 (67%)

Query: 25  LDKLTDRVEDRQLDSTRVQEAMASIAASKAGDLNAMRMREKELAAVKINAADVDIIANEL 84
           L+++TD  E++++ S+ ++ AM+ I   ++ +  A + REKELA V I   D+++I  E+
Sbjct: 43  LERVTDYAEEKEIQSSNLETAMSVIGDRRSREQKAKQEREKELAKVTIKKEDLELIMTEM 102

Query: 85  ELDKKVAERTLREHKGDAVAAI 106
           E+ +  AER+LREH G+ V A+
Sbjct: 103 EISRAAAERSLREHMGNVVEAL 124

Mus musculus (taxid: 10090)
>sp|Q2PFU1|HYPK_MACFA Huntingtin-interacting protein K OS=Macaca fascicularis GN=HYPK PE=2 SV=1 Back     alignment and function description
>sp|Q9NX55|HYPK_HUMAN Huntingtin-interacting protein K OS=Homo sapiens GN=HYPK PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query111
224111990111 predicted protein [Populus trichocarpa] 0.990 0.990 0.890 2e-46
224099137111 predicted protein [Populus trichocarpa] 0.990 0.990 0.890 2e-46
356564876110 PREDICTED: huntingtin-interacting protei 0.990 1.0 0.882 9e-46
225431968110 PREDICTED: huntingtin-interacting protei 0.990 1.0 0.891 2e-45
255556396111 conserved hypothetical protein [Ricinus 1.0 1.0 0.873 3e-45
351724445110 uncharacterized protein LOC100527218 [Gl 0.990 1.0 0.873 6e-45
357448911110 Huntingtin-interacting protein K [Medica 0.981 0.990 0.872 2e-44
449462146110 PREDICTED: huntingtin-interacting protei 0.990 1.0 0.846 1e-43
351721603110 uncharacterized protein LOC100527445 [Gl 0.981 0.990 0.854 7e-42
356529141110 PREDICTED: huntingtin-interacting protei 0.981 0.990 0.863 8e-42
>gi|224111990|ref|XP_002316045.1| predicted protein [Populus trichocarpa] gi|222865085|gb|EEF02216.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  189 bits (479), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 103/110 (93%)

Query: 1   MDGADGGEVDRIVDSKDLQQQSKALDKLTDRVEDRQLDSTRVQEAMASIAASKAGDLNAM 60
           M+G D G +DR+VDSKDLQQQSKALDKLTDRVEDRQLDSTRVQEAMASIA+S   D NAM
Sbjct: 1   MEGGDEGGIDRVVDSKDLQQQSKALDKLTDRVEDRQLDSTRVQEAMASIASSAEADANAM 60

Query: 61  RMREKELAAVKINAADVDIIANELELDKKVAERTLREHKGDAVAAIRHLL 110
           R+REKELAAVKINAADVDIIANELELDKKVAERTLREHKGDAVAAIRHLL
Sbjct: 61  RLREKELAAVKINAADVDIIANELELDKKVAERTLREHKGDAVAAIRHLL 110

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224099137|ref|XP_002311382.1| predicted protein [Populus trichocarpa] gi|118483939|gb|ABK93858.1| unknown [Populus trichocarpa] gi|222851202|gb|EEE88749.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356564876|ref|XP_003550673.1| PREDICTED: huntingtin-interacting protein K-like [Glycine max] Back     alignment and taxonomy information
>gi|225431968|ref|XP_002278475.1| PREDICTED: huntingtin-interacting protein K [Vitis vinifera] gi|147827144|emb|CAN70980.1| hypothetical protein VITISV_034768 [Vitis vinifera] gi|296083239|emb|CBI22875.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255556396|ref|XP_002519232.1| conserved hypothetical protein [Ricinus communis] gi|223541547|gb|EEF43096.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|351724445|ref|NP_001236546.1| uncharacterized protein LOC100527218 [Glycine max] gi|255631810|gb|ACU16272.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|357448911|ref|XP_003594731.1| Huntingtin-interacting protein K [Medicago truncatula] gi|124359935|gb|ABN07951.1| hypothetical protein MtrDRAFT_AC152185g3v2 [Medicago truncatula] gi|355483779|gb|AES64982.1| Huntingtin-interacting protein K [Medicago truncatula] Back     alignment and taxonomy information
>gi|449462146|ref|XP_004148802.1| PREDICTED: huntingtin-interacting protein K-like isoform 1 [Cucumis sativus] gi|449462148|ref|XP_004148803.1| PREDICTED: huntingtin-interacting protein K-like isoform 2 [Cucumis sativus] gi|449523251|ref|XP_004168637.1| PREDICTED: huntingtin-interacting protein K-like isoform 1 [Cucumis sativus] gi|449523253|ref|XP_004168638.1| PREDICTED: huntingtin-interacting protein K-like isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|351721603|ref|NP_001236191.1| uncharacterized protein LOC100527445 [Glycine max] gi|255632372|gb|ACU16536.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356529141|ref|XP_003533155.1| PREDICTED: huntingtin-interacting protein K [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query111
TAIR|locus:2084324115 AT3G06610 "AT3G06610" [Arabido 0.990 0.956 0.754 2.4e-37
ZFIN|ZDB-GENE-080515-6121 hypk "huntingtin interacting p 0.738 0.677 0.414 3.4e-13
UNIPROTKB|Q9NX55129 HYPK "Huntingtin-interacting p 0.738 0.635 0.378 3.9e-12
MGI|MGI:1914943129 Hypk "huntingtin interacting p 0.738 0.635 0.378 3.9e-12
UNIPROTKB|G4N682123 MGG_08595 "Uncharacterized pro 0.837 0.756 0.330 2.9e-07
CGD|CAL0002387178 EGD2 [Candida albicans (taxid: 0.864 0.539 0.284 5.4e-05
UNIPROTKB|Q5ANP2178 EGD2 "Nascent polypeptide-asso 0.864 0.539 0.284 5.4e-05
SGD|S000001236174 EGD2 "Alpha subunit of the nas 0.792 0.505 0.287 0.00097
TAIR|locus:2084324 AT3G06610 "AT3G06610" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 401 (146.2 bits), Expect = 2.4e-37, P = 2.4e-37
 Identities = 83/110 (75%), Positives = 93/110 (84%)

Query:     1 MDGADGGEVDRIVDSKDLQQQSKALDKLTDRVEDRQLDSTRVQEAMASIAASKAGDLNAM 60
             M+GA+    +  VDSKDLQQQSKA DKLTDRVEDRQLDS+RVQ AMASIAAS+  DLNA 
Sbjct:     1 MEGAEEAGAEIAVDSKDLQQQSKAFDKLTDRVEDRQLDSSRVQSAMASIAASREADLNAK 60

Query:    61 RMREKELAAVKINAADVDIIANELELDKKVAERTLREHKGDAVAAIRHLL 110
             R+REKELA+VKIN ADV+ I NELE++K VAERTLREHKGDAVAA R LL
Sbjct:    61 RLREKELASVKINPADVEFIVNELEIEKNVAERTLREHKGDAVAATRQLL 110
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0005829 "cytosol" evidence=IDA
ZFIN|ZDB-GENE-080515-6 hypk "huntingtin interacting protein K" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NX55 HYPK "Huntingtin-interacting protein K" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1914943 Hypk "huntingtin interacting protein K" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|G4N682 MGG_08595 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
CGD|CAL0002387 EGD2 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ANP2 EGD2 "Nascent polypeptide-associated complex subunit alpha" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
SGD|S000001236 EGD2 "Alpha subunit of the nascent polypeptide-associated complex (NAC)" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_LG_VIII0922
SubName- Full=Putative uncharacterized protein; (111 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 111
KOG3450119 consensus Huntingtin interacting protein HYPK [Gen 99.97
COG1308122 EGD2 Transcription factor homologous to NACalpha-B 99.36
KOG2239209 consensus Transcription factor containing NAC and 99.26
PRK06369115 nac nascent polypeptide-associated complex protein 99.18
TIGR00264116 alpha-NAC-related protein. This hypothetical prote 99.09
PF0062737 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma 97.69
cd0019438 UBA Ubiquitin Associated domain. The UBA domain is 96.85
PF1455543 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 96.04
smart0016537 UBA Ubiquitin associated domain. Present in Rad23, 96.04
smart0054643 CUE Domain that may be involved in binding ubiquit 94.69
PF0284542 CUE: CUE domain; InterPro: IPR003892 This domain m 91.82
PF0347439 DMA: DMRTA motif; InterPro: IPR005173 This region 90.47
PF1224457 DUF3606: Protein of unknown function (DUF3606); In 88.69
PRK12332 198 tsf elongation factor Ts; Reviewed 88.29
COG4008153 Predicted metal-binding transcription factor [Tran 87.47
PRK09377 290 tsf elongation factor Ts; Provisional 86.55
TIGR00116 290 tsf translation elongation factor Ts. This protein 86.04
PRK05441299 murQ N-acetylmuramic acid-6-phosphate etherase; Re 81.55
COG2103298 Predicted sugar phosphate isomerase [General funct 81.13
KOG2561 568 consensus Adaptor protein NUB1, contains UBA domai 80.09
>KOG3450 consensus Huntingtin interacting protein HYPK [General function prediction only] Back     alignment and domain information 
Probab=99.97  E-value=5e-32  Score=195.54  Aligned_cols=111  Identities=40%  Similarity=0.589  Sum_probs=106.8

Q ss_pred             CCCCCccccccccCchhHHHH-------HHhhhhhhhhHHhhhcCHHHHHHHHHHHHHhhhcchHHHHHhHHHHhhcCCC
Q 033806            1 MDGADGGEVDRIVDSKDLQQQ-------SKALDKLTDRVEDRQLDSTRVQEAMASIAASKAGDLNAMRMREKELAAVKIN   73 (111)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~-------aaaLekvTD~~Eekeid~eai~~Am~~l~~~~~~~~~a~~~~e~el~~v~V~   73 (111)
                      |+|..+++.+...|++|++|+       +++|+|||||+|||+|+++.|+.+|.+|++.++++..+++.|+++|++|+|+
T Consensus         1 ~eg~~e~~~E~e~de~d~kqq~~khd~gaadlekvTD~~Eekei~ss~l~sam~~ign~rnae~~ak~~rEKELakV~Ik   80 (119)
T KOG3450|consen    1 TEGDVELELETETDEPDRKQQKPKHDSGAADLEKVTDYAEEKEIQSSNLESAMSVIGNRRNAEQKAKQEREKELAKVTIK   80 (119)
T ss_pred             CcchhhccchhccCCchhhhccccccchHHHHHHHhhHHHHhhcchhHHHHHHHHHHHHhhhhhHHHHHHHhhccccccC
Confidence            578889999999999999997       6689999999999999999999999999999999999999999999999999


Q ss_pred             hhhHHHHHHhhCCCHHHHHHHHHHhcCcHHHHHHHHhC
Q 033806           74 AADVDIIANELELDKKVAERTLREHKGDAVAAIRHLLR  111 (111)
Q Consensus        74 ~eDV~LI~~elevsk~kA~~aLre~~GDvv~Ai~~L~~  111 (111)
                      ++||+|||++|+|++..|++.||+|+||+|.|+++||.
T Consensus        81 keDlelImnELei~k~~aer~LrE~~Gdvv~Alral~s  118 (119)
T KOG3450|consen   81 KEDLELIMNELEISKAAAERSLREHMGDVVEALRALTS  118 (119)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhcccHHHHHHHHhc
Confidence            99999999999999999999999999999999999974

>COG1308 EGD2 Transcription factor homologous to NACalpha-BTF3 [Transcription] Back     alignment and domain information
>KOG2239 consensus Transcription factor containing NAC and TS-N domains [Transcription] Back     alignment and domain information
>PRK06369 nac nascent polypeptide-associated complex protein; Reviewed Back     alignment and domain information
>TIGR00264 alpha-NAC-related protein Back     alignment and domain information
>PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] Back     alignment and domain information
>cd00194 UBA Ubiquitin Associated domain Back     alignment and domain information
>PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A Back     alignment and domain information
>smart00165 UBA Ubiquitin associated domain Back     alignment and domain information
>smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>PF03474 DMA: DMRTA motif; InterPro: IPR005173 This region is found to the C terminus of the DM DNA-binding domain IPR001275 from INTERPRO [] Back     alignment and domain information
>PF12244 DUF3606: Protein of unknown function (DUF3606); InterPro: IPR022037 This family of proteins is found in bacteria Back     alignment and domain information
>PRK12332 tsf elongation factor Ts; Reviewed Back     alignment and domain information
>COG4008 Predicted metal-binding transcription factor [Transcription] Back     alignment and domain information
>PRK09377 tsf elongation factor Ts; Provisional Back     alignment and domain information
>TIGR00116 tsf translation elongation factor Ts Back     alignment and domain information
>PRK05441 murQ N-acetylmuramic acid-6-phosphate etherase; Reviewed Back     alignment and domain information
>COG2103 Predicted sugar phosphate isomerase [General function prediction only] Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query111
1tr8_A102 Conserved protein (MTH177); chaperones, nascent po 99.36
1wj7_A104 Hypothetical protein (RSGI RUH-015); UBA domain, u 97.84
2cp9_A64 EF-TS, EF-TSMT, elongation factor TS, mitochondria 97.74
1z96_A40 DNA-damage, UBA-domain protein MUD1; ubiquitin, th 97.18
2g3q_A43 Protein YBL047C; endocytosis, solution structure, 97.0
1wiv_A73 UBP14, ubiquitin-specific protease 14; ubiquitin a 96.77
1wji_A63 Tudor domain containing protein 3; UBA domain, str 96.74
2dak_A63 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 96.73
1veg_A83 NEDD8 ultimate buster-1; ubiquitin associated doma 96.61
2cpw_A64 CBL-interacting protein STS-1 variant; ubiquitin a 96.52
1vg5_A73 RSGI RUH-014, rhomboid family protein; UBA domain, 96.44
1whc_A64 RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain 96.44
1ify_A49 HHR23A, UV excision repair protein RAD23 homolog A 96.37
2dai_A83 Ubadc1, ubiquitin associated domain containing 1; 96.33
2dag_A74 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 96.27
2ekk_A47 UBA domain from E3 ubiquitin-protein ligase HUWE1; 96.26
1wgn_A63 UBAP1, ubiquitin associated protein; ubiquitin ass 96.18
2crn_A64 Ubash3A protein; compact three-helix bundle, struc 96.01
2jy5_A52 Ubiquilin-1; UBA, alternative splicing, cytoplasm, 95.84
2knz_A53 Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc 95.66
2dkl_A85 Trinucleotide repeat containing 6C protein; TNRC6C 95.48
1wgl_A59 TOLL-interacting protein; CUE domain, structural g 95.4
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 95.31
2bwb_A46 Ubiquitin-like protein DSK2; UBA, signaling protei 94.97
1vek_A84 UBP14, ubiquitin-specific protease 14, putative; U 94.89
1otr_A49 Protein CUE2; protein-protein complex, cell cycle; 94.35
2dah_A54 Ubiquilin-3; UBA domain, structural genomics, NPPS 94.19
1wr1_B58 Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu 94.16
1vej_A74 Riken cDNA 4931431F19; UBA domain, three helix bun 94.12
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 94.03
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 93.7
2cp8_A54 NEXT to BRCA1 gene 1 protein; UBA domain, structur 93.62
1v92_A46 NSFL1 cofactor P47; 3-helix bundle, recombination; 93.2
2cwb_A108 Chimera of immunoglobulin G binding protein G and 92.69
2dna_A67 Unnamed protein product; ubiquitin associated doma 92.43
2dal_A62 Protein KIAA0794; FAS associted factor 1, UBA-like 91.65
3k9o_A201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 89.41
2dzl_A66 Protein FAM100B; UBA-like domain, structural genom 89.28
1dv0_A47 DNA repair protein HHR23A; helical bundle, DNA bin 89.0
2d9s_A53 CBL E3 ubiquitin protein ligase; UBA domain, dimer 88.96
2ooa_A52 E3 ubiquitin-protein ligase CBL-B; alpha-helical d 88.89
2dhy_A67 CUE domain-containing protein 1; structural genomi 88.02
2dam_A67 ETEA protein; KIAA0887, UBA-like domain, structura 87.41
3e21_A45 HFAF1, FAS-associated factor 1; UBA, alternative s 87.29
4dbg_B162 Ring finger protein 31; ubiquitin fold, ubiquitina 81.21
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 81.14
1xb2_B 291 EF-TS, elongation factor TS, mitochondrial, EF-TSM 80.12
>1tr8_A Conserved protein (MTH177); chaperones, nascent polypeptide-associated complex, ribosome domain, ubiquitin, chaperone; 2.27A {Methanothermobacter marburgensis} Back     alignment and structure
Probab=99.36  E-value=5.9e-13  Score=93.34  Aligned_cols=41  Identities=29%  Similarity=0.470  Sum_probs=39.3

Q ss_pred             cCCChhhHHHHHHhhCCCHHHHHHHHHHhcCcHHHHHHHHh
Q 033806           70 VKINAADVDIIANELELDKKVAERTLREHKGDAVAAIRHLL  110 (111)
Q Consensus        70 v~V~~eDV~LI~~elevsk~kA~~aLre~~GDvv~Ai~~L~  110 (111)
                      ++|+.+||+|||+|++|||.+|+++|++|+||+++||+.|+
T Consensus        62 ~~i~~edi~lv~~q~~vs~~~A~~aL~~~~gDiv~Ai~~Lt  102 (102)
T 1tr8_A           62 MEIPEDDIELVMNQTGASREDATRALQETGGDLAEAIMRLS  102 (102)
T ss_dssp             CCCCHHHHHHHHHHHCCCHHHHHHHHHHTTTCHHHHHHHC-
T ss_pred             CCCCHHHHHHHHHHhCCCHHHHHHHHHHcCCCHHHHHHHhC
Confidence            78999999999999999999999999999999999999985
>1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2cp9_A EF-TS, EF-TSMT, elongation factor TS, mitochondrial; UBA, structural genomics, human, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.2 Back     alignment and structure
>1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 Back     alignment and structure
>2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ekk_A UBA domain from E3 ubiquitin-protein ligase HUWE1; ubiquitin associated domain, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B Back     alignment and structure
>2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} Back     alignment and structure
>2dkl_A Trinucleotide repeat containing 6C protein; TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1wgl_A TOLL-interacting protein; CUE domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, immune system; NMR {Homo sapiens} SCOP: a.5.2.4 Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Back     alignment and structure
>2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A Back     alignment and structure
>1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>1otr_A Protein CUE2; protein-protein complex, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.4 Back     alignment and structure
>2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Back     alignment and structure
>2cp8_A NEXT to BRCA1 gene 1 protein; UBA domain, structural genomics, human, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1v92_A NSFL1 cofactor P47; 3-helix bundle, recombination; NMR {Rattus norvegicus} SCOP: a.5.2.3 Back     alignment and structure
>2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A Back     alignment and structure
>2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2dal_A Protein KIAA0794; FAS associted factor 1, UBA-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Back     alignment and structure
>2dzl_A Protein FAM100B; UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A Back     alignment and structure
>2d9s_A CBL E3 ubiquitin protein ligase; UBA domain, dimer, protein binding, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ooa_A E3 ubiquitin-protein ligase CBL-B; alpha-helical domain; 1.56A {Homo sapiens} PDB: 2oob_A 2jnh_A 2do6_A Back     alignment and structure
>2dhy_A CUE domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dam_A ETEA protein; KIAA0887, UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3e21_A HFAF1, FAS-associated factor 1; UBA, alternative splicing, apoptosis, nucleus, phosphoprotein; 1.73A {Homo sapiens} Back     alignment and structure
>4dbg_B Ring finger protein 31; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Back     alignment and structure
>1xb2_B EF-TS, elongation factor TS, mitochondrial, EF-TSMT; protein-protein complex, translation; HET: MSE; 2.20A {Bos taurus} SCOP: a.5.2.2 d.43.1.1 d.43.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query111
d1vg5a_73 Rhomboid family protein At3g58460 {Thale cress (Ar 96.93
d1wiva_73 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 96.86
d1wjia_63 Tudor domain containing protein 3, TDRD3 {Human (H 96.71
d1oqya141 DNA repair protein Hhr23a {Human (Homo sapiens) [T 96.22
d1wgna_63 Ubiquitin-associated protein 1, UBAP1 {Human (Homo 96.11
d1whca_64 UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [Ta 95.9
d1efub354 Elongation factor Ts (EF-Ts), N-terminal domain {E 95.74
d2g3qa143 Endocytic protein Ede1, YBL047C {Saccharomyces cer 95.62
d2cpwa151 Cbl-interacting protein p70, STS1 {Human (Homo sap 95.57
d2crna151 Suppressor of T-cell receptor signaling 2 (STS-2) 95.07
d1v92a_46 NSFL1 (p97 ATPase) cofactor p47, UBA-like domain { 94.3
d1xb2b156 Elongation factor Ts (EF-Ts), N-terminal domain {C 93.81
d1veka_84 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 93.51
d1aipc152 Elongation factor Ts (EF-Ts), N-terminal domain {T 93.31
d2bwba144 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 92.3
d1veja161 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 91.95
d2daha141 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 90.37
d2dnaa150 Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus 90.12
d1vega_83 NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculu 86.87
d1wj7a191 Ubiquitin-associated protein 2-like Ubap2l {Mouse 81.71
d1wgla_59 Toll-interacting protein {Human (Homo sapiens) [Ta 80.49
>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: All alpha proteins
fold: RuvA C-terminal domain-like
superfamily: UBA-like
family: UBA domain
domain: Rhomboid family protein At3g58460
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=96.93  E-value=0.00087  Score=42.33  Aligned_cols=41  Identities=17%  Similarity=0.309  Sum_probs=35.9

Q ss_pred             hcCCChhhHHHHHHhhCCCHHHHHHHHHHhcCcHHHHHHHHh
Q 033806           69 AVKINAADVDIIANELELDKKVAERTLREHKGDAVAAIRHLL  110 (111)
Q Consensus        69 ~v~V~~eDV~LI~~elevsk~kA~~aLre~~GDvv~Ai~~L~  110 (111)
                      .+.++.+.|+.|+ +||.++..|+++|+.++||+..|+--|+
T Consensus        25 ~~~~~ee~i~~L~-~MGF~~~~a~~AL~~~~~n~e~A~~~Ll   65 (73)
T d1vg5a_          25 RVAASEEQIQKLV-AMGFDRTQVEVALAAADDDLTVAVEILM   65 (73)
T ss_dssp             CSCCCHHHHHHHH-TTTCCHHHHHHHHHHHTSCHHHHHHHHH
T ss_pred             CcCcCHHHHHHHH-HhCCCHHHHHHHHHHhCCCHHHHHHHHH
Confidence            4567888898876 7999999999999999999999988775
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1efub3 a.5.2.2 (B:1-54) Elongation factor Ts (EF-Ts), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xb2b1 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-terminal domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1aipc1 a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bwba1 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1veja1 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2daha1 a.5.2.1 (A:8-48) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dnaa1 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vega_ a.5.2.1 (A:) NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wj7a1 a.5.2.1 (A:8-98) Ubiquitin-associated protein 2-like Ubap2l {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgla_ a.5.2.4 (A:) Toll-interacting protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure