Citrus Sinensis ID: 034012
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 106 | ||||||
| 16550928 | 175 | calcineurin-like protein [Eucalyptus gra | 1.0 | 0.605 | 0.877 | 1e-46 | |
| 255553285 | 175 | calcineurin B subunit, putative [Ricinus | 1.0 | 0.605 | 0.858 | 5e-44 | |
| 18401887 | 175 | EF-hand, calcium binding motif-containin | 1.0 | 0.605 | 0.820 | 6e-44 | |
| 297830498 | 175 | calcium-binding EF hand family protein [ | 1.0 | 0.605 | 0.820 | 7e-44 | |
| 379048253 | 175 | calcineurin-like protein [Hevea brasilie | 1.0 | 0.605 | 0.858 | 7e-44 | |
| 224134919 | 175 | predicted protein [Populus trichocarpa] | 1.0 | 0.605 | 0.830 | 8e-44 | |
| 118489050 | 116 | unknown [Populus trichocarpa x Populus d | 1.0 | 0.913 | 0.830 | 8e-44 | |
| 21592761 | 175 | calcineurin-like protein [Arabidopsis th | 1.0 | 0.605 | 0.811 | 8e-43 | |
| 449436166 | 175 | PREDICTED: calcineurin subunit B-like [C | 1.0 | 0.605 | 0.773 | 2e-42 | |
| 351724641 | 175 | uncharacterized protein LOC100305685 [Gl | 1.0 | 0.605 | 0.801 | 6e-42 |
| >gi|16550928|gb|AAL25647.1|AF197330_1 calcineurin-like protein [Eucalyptus grandis] gi|16550937|gb|AAL25650.1|AF197334_1 calcineurin-like protein [Eucalyptus camaldulensis] | Back alignment and taxonomy information |
|---|
Score = 190 bits (482), Expect = 1e-46, Method: Compositional matrix adjust.
Identities = 93/106 (87%), Positives = 98/106 (92%)
Query: 1 MVDGLNFKDFVAFLSVFSAKASMQQKVQLIFKVYDSDCNGKVSFNDILEVLRDLSGSFMS 60
MVDGLNFKDFVAFLS FSAKAS QQK++LIFKVYDSDCNGKVSFNDILEVLRDLSG FMS
Sbjct: 70 MVDGLNFKDFVAFLSAFSAKASKQQKIELIFKVYDSDCNGKVSFNDILEVLRDLSGPFMS 129
Query: 61 DEQREQVLTQVFKDAGYTRDSYLTLGDFIKVFGNSGLKMEVEVPVD 106
DEQREQVL QV K+AGYTR+SYL L DF+KVFGNS LKMEVEVPVD
Sbjct: 130 DEQREQVLVQVLKEAGYTRESYLLLDDFVKVFGNSDLKMEVEVPVD 175
|
Source: Eucalyptus grandis Species: Eucalyptus grandis Genus: Eucalyptus Family: Myrtaceae Order: Myrtales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255553285|ref|XP_002517685.1| calcineurin B subunit, putative [Ricinus communis] gi|223543317|gb|EEF44849.1| calcineurin B subunit, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|18401887|ref|NP_566610.1| EF-hand, calcium binding motif-containing protein [Arabidopsis thaliana] gi|334185438|ref|NP_001189924.1| EF-hand, calcium binding motif-containing protein [Arabidopsis thaliana] gi|11994106|dbj|BAB01109.1| calcineurin b subunit (protein phosphatase 2b regulatory subunit)-like protein [Arabidopsis thaliana] gi|17380818|gb|AAL36096.1| unknown protein [Arabidopsis thaliana] gi|20259021|gb|AAM14226.1| unknown protein [Arabidopsis thaliana] gi|332642575|gb|AEE76096.1| EF-hand, calcium binding motif-containing protein [Arabidopsis thaliana] gi|332642576|gb|AEE76097.1| EF-hand, calcium binding motif-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297830498|ref|XP_002883131.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. lyrata] gi|297328971|gb|EFH59390.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|379048253|gb|AFC88294.1| calcineurin-like protein [Hevea brasiliensis] | Back alignment and taxonomy information |
|---|
| >gi|224134919|ref|XP_002327522.1| predicted protein [Populus trichocarpa] gi|222836076|gb|EEE74497.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|118489050|gb|ABK96332.1| unknown [Populus trichocarpa x Populus deltoides] | Back alignment and taxonomy information |
|---|
| >gi|21592761|gb|AAM64710.1| calcineurin-like protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|449436166|ref|XP_004135865.1| PREDICTED: calcineurin subunit B-like [Cucumis sativus] gi|449509301|ref|XP_004163549.1| PREDICTED: calcineurin subunit B-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|351724641|ref|NP_001235273.1| uncharacterized protein LOC100305685 [Glycine max] gi|255626307|gb|ACU13498.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 106 | ||||||
| TAIR|locus:2095052 | 175 | AT3G18430 [Arabidopsis thalian | 1.0 | 0.605 | 0.820 | 1.2e-42 | |
| DICTYBASE|DDB_G0267446 | 180 | cnbA "calcineurin B" [Dictyost | 0.933 | 0.55 | 0.28 | 8.2e-12 | |
| FB|FBgn0015614 | 170 | CanB2 "Calcineurin B2" [Drosop | 0.933 | 0.582 | 0.297 | 2.5e-10 | |
| UNIPROTKB|Q6VN51 | 170 | PPP3R1 "Protein phospatase 3 r | 0.943 | 0.588 | 0.294 | 2.5e-10 | |
| UNIPROTKB|P63099 | 170 | PPP3R1 "Calcineurin subunit B | 0.943 | 0.588 | 0.294 | 2.5e-10 | |
| UNIPROTKB|D3YTA9 | 189 | PPP3R1 "Calcineurin subunit B | 0.943 | 0.529 | 0.294 | 2.5e-10 | |
| UNIPROTKB|F6U1T9 | 160 | PPP3R1 "Calcineurin subunit B | 0.943 | 0.625 | 0.294 | 2.5e-10 | |
| UNIPROTKB|P63098 | 170 | PPP3R1 "Calcineurin subunit B | 0.943 | 0.588 | 0.294 | 2.5e-10 | |
| UNIPROTKB|F2Z5U5 | 160 | LOC100627903 "Uncharacterized | 0.943 | 0.625 | 0.294 | 2.5e-10 | |
| MGI|MGI:107172 | 170 | Ppp3r1 "protein phosphatase 3, | 0.943 | 0.588 | 0.294 | 2.5e-10 |
| TAIR|locus:2095052 AT3G18430 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 451 (163.8 bits), Expect = 1.2e-42, P = 1.2e-42
Identities = 87/106 (82%), Positives = 99/106 (93%)
Query: 1 MVDGLNFKDFVAFLSVFSAKASMQQKVQLIFKVYDSDCNGKVSFNDILEVLRDLSGSFMS 60
MVDGLNFKDFVAFLS FSAKAS++QKVQLIFKVYDSDCNGKVSF DI+EVLRDLSGSFMS
Sbjct: 70 MVDGLNFKDFVAFLSAFSAKASLRQKVQLIFKVYDSDCNGKVSFKDIMEVLRDLSGSFMS 129
Query: 61 DEQREQVLTQVFKDAGYTRDSYLTLGDFIKVFGNSGLKMEVEVPVD 106
DEQREQVL+QV K++GYT DS+LTL DFIK+FG+S +M+VE+PVD
Sbjct: 130 DEQREQVLSQVLKESGYTSDSFLTLEDFIKIFGSSRPEMDVEIPVD 175
|
|
| DICTYBASE|DDB_G0267446 cnbA "calcineurin B" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0015614 CanB2 "Calcineurin B2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6VN51 PPP3R1 "Protein phospatase 3 regulatory subunit B alpha isoform type 1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P63099 PPP3R1 "Calcineurin subunit B type 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D3YTA9 PPP3R1 "Calcineurin subunit B type 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6U1T9 PPP3R1 "Calcineurin subunit B type 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P63098 PPP3R1 "Calcineurin subunit B type 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F2Z5U5 LOC100627903 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:107172 Ppp3r1 "protein phosphatase 3, regulatory subunit B, alpha isoform (calcineurin B, type I)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| AT3G18430 | calcium-binding EF hand family protein; calcium-binding EF hand family protein; FUNCTIONS IN- calcium ion binding; INVOLVED IN- N-terminal protein myristoylation; LOCATED IN- vacuole; EXPRESSED IN- 24 plant structures; EXPRESSED DURING- 13 growth stages; CONTAINS InterPro DOMAIN/s- EF-HAND 1 (InterPro-IPR018247), EF-HAND 2 (InterPro-IPR018249), EF-Hand type (InterPro-IPR011992), EF hand (InterPro-IPR018248); BEST Arabidopsis thaliana protein match is- CAM9 (CALMODULIN 9); calcium ion binding (TAIR-AT3G51920.1); Has 3772 Blast hits to 3771 proteins in 389 species- Archae - 0; Bacteria - [...] (175 aa) | ||||||||||
(Arabidopsis thaliana) | |||||||||||
| AT1G49730 | • | 0.821 | |||||||||
| AT1G76460 | • | 0.788 | |||||||||
| SOS3 | • | 0.786 | |||||||||
| AT3G07450 | • | 0.780 | |||||||||
| AT1G20370 | • | 0.780 | |||||||||
| UPF3 | • | 0.746 | |||||||||
| SMO1-1 | • | 0.679 | |||||||||
| AT2G22080 | • | 0.677 | |||||||||
| NIP7;1 | • | 0.621 | |||||||||
| AT2G42940 | • | 0.599 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 106 | |||
| COG5126 | 160 | COG5126, FRQ1, Ca2+-binding protein (EF-Hand super | 3e-08 | |
| pfam13499 | 60 | pfam13499, EF_hand_5, EF-hand domain pair | 9e-05 | |
| cd00051 | 63 | cd00051, EFh, EF-hand, calcium binding motif; A di | 0.004 |
| >gnl|CDD|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
Score = 48.5 bits (116), Expect = 3e-08
Identities = 16/90 (17%), Positives = 45/90 (50%), Gaps = 5/90 (5%)
Query: 3 DGLNFKDFVAFLSVFSAKASMQQKVQLIFKVYDSDCNGKVSFNDILEVLRDLSGSFMSDE 62
+ ++F +F+ +SV + +++++ FK++D D +G +S ++ VL + +
Sbjct: 70 ETVDFPEFLTVMSVKLKRGDKEEELREAFKLFDKDHDGYISIGELRRVL-----KSLGER 124
Query: 63 QREQVLTQVFKDAGYTRDSYLTLGDFIKVF 92
++ + ++ K+ D + +F K+
Sbjct: 125 LSDEEVEKLLKEYDEDGDGEIDYEEFKKLI 154
|
Length = 160 |
| >gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair | Back alignment and domain information |
|---|
| >gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 106 | |||
| KOG0034 | 187 | consensus Ca2+/calmodulin-dependent protein phosph | 99.81 | |
| COG5126 | 160 | FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S | 99.79 | |
| KOG0027 | 151 | consensus Calmodulin and related proteins (EF-Hand | 99.67 | |
| PF13499 | 66 | EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A | 99.65 | |
| KOG0038 | 189 | consensus Ca2+-binding kinase interacting protein | 99.63 | |
| KOG0044 | 193 | consensus Ca2+ sensor (EF-Hand superfamily) [Signa | 99.58 | |
| KOG0028 | 172 | consensus Ca2+-binding protein (centrin/caltractin | 99.58 | |
| PTZ00183 | 158 | centrin; Provisional | 99.55 | |
| PTZ00184 | 149 | calmodulin; Provisional | 99.53 | |
| cd05022 | 89 | S-100A13 S-100A13: S-100A13 domain found in protei | 99.53 | |
| cd05027 | 88 | S-100B S-100B: S-100B domain found in proteins sim | 99.45 | |
| KOG0030 | 152 | consensus Myosin essential light chain, EF-Hand pr | 99.43 | |
| cd05026 | 93 | S-100Z S-100Z: S-100Z domain found in proteins sim | 99.37 | |
| cd05029 | 88 | S-100A6 S-100A6: S-100A6 domain found in proteins | 99.32 | |
| cd05031 | 94 | S-100A10_like S-100A10_like: S-100A10 domain found | 99.32 | |
| KOG0037 | 221 | consensus Ca2+-binding protein, EF-Hand protein su | 99.31 | |
| KOG0031 | 171 | consensus Myosin regulatory light chain, EF-Hand p | 99.31 | |
| cd05025 | 92 | S-100A1 S-100A1: S-100A1 domain found in proteins | 99.3 | |
| smart00027 | 96 | EH Eps15 homology domain. Pair of EF hand motifs t | 99.27 | |
| cd00213 | 88 | S-100 S-100: S-100 domain, which represents the la | 99.25 | |
| KOG0027 | 151 | consensus Calmodulin and related proteins (EF-Hand | 99.25 | |
| cd00052 | 67 | EH Eps15 homology domain; found in proteins implic | 99.21 | |
| KOG0044 | 193 | consensus Ca2+ sensor (EF-Hand superfamily) [Signa | 99.2 | |
| PF13833 | 54 | EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A | 99.19 | |
| cd00051 | 63 | EFh EF-hand, calcium binding motif; A diverse supe | 99.18 | |
| cd05023 | 89 | S-100A11 S-100A11: S-100A11 domain found in protei | 99.16 | |
| PTZ00183 | 158 | centrin; Provisional | 99.12 | |
| cd00252 | 116 | SPARC_EC SPARC_EC; extracellular Ca2+ binding doma | 99.09 | |
| COG5126 | 160 | FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S | 99.07 | |
| PTZ00184 | 149 | calmodulin; Provisional | 99.05 | |
| cd05030 | 88 | calgranulins Calgranulins: S-100 domain found in p | 99.01 | |
| PF14658 | 66 | EF-hand_9: EF-hand domain | 99.0 | |
| KOG0036 | 463 | consensus Predicted mitochondrial carrier protein | 98.89 | |
| KOG0028 | 172 | consensus Ca2+-binding protein (centrin/caltractin | 98.81 | |
| PF00036 | 29 | EF-hand_1: EF hand; InterPro: IPR018248 Many calci | 98.81 | |
| KOG0041 | 244 | consensus Predicted Ca2+-binding protein, EF-Hand | 98.8 | |
| KOG0031 | 171 | consensus Myosin regulatory light chain, EF-Hand p | 98.77 | |
| KOG0030 | 152 | consensus Myosin essential light chain, EF-Hand pr | 98.72 | |
| cd05024 | 91 | S-100A10 S-100A10: A subgroup of the S-100A10 doma | 98.7 | |
| PLN02964 | 644 | phosphatidylserine decarboxylase | 98.64 | |
| PF13405 | 31 | EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J | 98.58 | |
| PF13833 | 54 | EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A | 98.57 | |
| KOG0037 | 221 | consensus Ca2+-binding protein, EF-Hand protein su | 98.54 | |
| KOG4065 | 144 | consensus Uncharacterized conserved protein [Funct | 98.48 | |
| PRK12309 | 391 | transaldolase/EF-hand domain-containing protein; P | 98.43 | |
| KOG0377 | 631 | consensus Protein serine/threonine phosphatase RDG | 98.4 | |
| PF00036 | 29 | EF-hand_1: EF hand; InterPro: IPR018248 Many calci | 98.4 | |
| KOG0036 | 463 | consensus Predicted mitochondrial carrier protein | 98.3 | |
| PF14788 | 51 | EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA | 98.3 | |
| PLN02964 | 644 | phosphatidylserine decarboxylase | 98.28 | |
| PF13202 | 25 | EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ | 98.28 | |
| PF12763 | 104 | EF-hand_4: Cytoskeletal-regulatory complex EF hand | 98.26 | |
| KOG0034 | 187 | consensus Ca2+/calmodulin-dependent protein phosph | 98.24 | |
| KOG2643 | 489 | consensus Ca2+ binding protein, contains EF-hand m | 98.24 | |
| KOG0040 | 2399 | consensus Ca2+-binding actin-bundling protein (spe | 98.15 | |
| PF13499 | 66 | EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A | 98.12 | |
| KOG4223 | 325 | consensus Reticulocalbin, calumenin, DNA supercoil | 98.12 | |
| PF10591 | 113 | SPARC_Ca_bdg: Secreted protein acidic and rich in | 97.99 | |
| KOG4223 | 325 | consensus Reticulocalbin, calumenin, DNA supercoil | 97.94 | |
| PF13202 | 25 | EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ | 97.92 | |
| cd00051 | 63 | EFh EF-hand, calcium binding motif; A diverse supe | 97.86 | |
| PF14788 | 51 | EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA | 97.83 | |
| KOG0046 | 627 | consensus Ca2+-binding actin-bundling protein (fim | 97.76 | |
| cd05022 | 89 | S-100A13 S-100A13: S-100A13 domain found in protei | 97.7 | |
| KOG4666 | 412 | consensus Predicted phosphate acyltransferase, con | 97.69 | |
| KOG0751 | 694 | consensus Mitochondrial aspartate/glutamate carrie | 97.67 | |
| cd05030 | 88 | calgranulins Calgranulins: S-100 domain found in p | 97.65 | |
| cd05029 | 88 | S-100A6 S-100A6: S-100A6 domain found in proteins | 97.62 | |
| PF13405 | 31 | EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J | 97.61 | |
| KOG2562 | 493 | consensus Protein phosphatase 2 regulatory subunit | 97.57 | |
| cd05026 | 93 | S-100Z S-100Z: S-100Z domain found in proteins sim | 97.55 | |
| KOG2643 | 489 | consensus Ca2+ binding protein, contains EF-hand m | 97.54 | |
| cd05023 | 89 | S-100A11 S-100A11: S-100A11 domain found in protei | 97.54 | |
| KOG4251 | 362 | consensus Calcium binding protein [General functio | 97.5 | |
| smart00054 | 29 | EFh EF-hand, calcium binding motif. EF-hands are c | 97.47 | |
| cd00052 | 67 | EH Eps15 homology domain; found in proteins implic | 97.46 | |
| cd05027 | 88 | S-100B S-100B: S-100B domain found in proteins sim | 97.43 | |
| PF09279 | 83 | EF-hand_like: Phosphoinositide-specific phospholip | 97.43 | |
| cd05031 | 94 | S-100A10_like S-100A10_like: S-100A10 domain found | 97.35 | |
| cd05024 | 91 | S-100A10 S-100A10: A subgroup of the S-100A10 doma | 97.34 | |
| cd00213 | 88 | S-100 S-100: S-100 domain, which represents the la | 97.3 | |
| cd05025 | 92 | S-100A1 S-100A1: S-100A1 domain found in proteins | 97.23 | |
| smart00027 | 96 | EH Eps15 homology domain. Pair of EF hand motifs t | 97.23 | |
| KOG0377 | 631 | consensus Protein serine/threonine phosphatase RDG | 97.22 | |
| smart00054 | 29 | EFh EF-hand, calcium binding motif. EF-hands are c | 97.05 | |
| KOG4251 | 362 | consensus Calcium binding protein [General functio | 97.0 | |
| cd00252 | 116 | SPARC_EC SPARC_EC; extracellular Ca2+ binding doma | 96.86 | |
| PF09069 | 90 | EF-hand_3: EF-hand; InterPro: IPR015154 Like other | 96.61 | |
| PLN02952 | 599 | phosphoinositide phospholipase C | 96.33 | |
| KOG4578 | 421 | consensus Uncharacterized conserved protein, conta | 96.32 | |
| PF14658 | 66 | EF-hand_9: EF-hand domain | 96.31 | |
| PF12763 | 104 | EF-hand_4: Cytoskeletal-regulatory complex EF hand | 96.14 | |
| KOG4347 | 671 | consensus GTPase-activating protein VRP [General f | 95.97 | |
| KOG2243 | 5019 | consensus Ca2+ release channel (ryanodine receptor | 95.44 | |
| PRK12309 | 391 | transaldolase/EF-hand domain-containing protein; P | 95.42 | |
| KOG3555 | 434 | consensus Ca2+-binding proteoglycan Testican [Gene | 95.35 | |
| KOG0169 | 746 | consensus Phosphoinositide-specific phospholipase | 95.31 | |
| KOG4666 | 412 | consensus Predicted phosphate acyltransferase, con | 95.3 | |
| KOG0751 | 694 | consensus Mitochondrial aspartate/glutamate carrie | 95.13 | |
| KOG2562 | 493 | consensus Protein phosphatase 2 regulatory subunit | 95.12 | |
| PF05517 | 154 | p25-alpha: p25-alpha ; InterPro: IPR008907 This fa | 94.97 | |
| KOG0042 | 680 | consensus Glycerol-3-phosphate dehydrogenase [Ener | 94.86 | |
| KOG1955 | 737 | consensus Ral-GTPase effector RALBP1 [Intracellula | 94.67 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 94.54 | |
| KOG0038 | 189 | consensus Ca2+-binding kinase interacting protein | 94.13 | |
| KOG0039 | 646 | consensus Ferric reductase, NADH/NADPH oxidase and | 93.91 | |
| KOG3866 | 442 | consensus DNA-binding protein of the nucleobindin | 93.72 | |
| KOG0035 | 890 | consensus Ca2+-binding actin-bundling protein (act | 93.43 | |
| PF05042 | 174 | Caleosin: Caleosin related protein; InterPro: IPR0 | 92.59 | |
| KOG1707 | 625 | consensus Predicted Ras related/Rac-GTP binding pr | 91.25 | |
| PF08976 | 118 | DUF1880: Domain of unknown function (DUF1880); Int | 90.57 | |
| KOG1707 | 625 | consensus Predicted Ras related/Rac-GTP binding pr | 89.64 | |
| KOG0040 | 2399 | consensus Ca2+-binding actin-bundling protein (spe | 89.62 | |
| KOG0041 | 244 | consensus Predicted Ca2+-binding protein, EF-Hand | 89.02 | |
| PF08726 | 69 | EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPr | 88.81 | |
| KOG1265 | 1189 | consensus Phospholipase C [Lipid transport and met | 88.25 | |
| TIGR01848 | 107 | PHA_reg_PhaR polyhydroxyalkanoate synthesis repres | 86.56 | |
| PF09279 | 83 | EF-hand_like: Phosphoinositide-specific phospholip | 86.22 | |
| PLN02230 | 598 | phosphoinositide phospholipase C 4 | 84.87 | |
| PF08414 | 100 | NADPH_Ox: Respiratory burst NADPH oxidase; InterPr | 81.65 | |
| PF07879 | 64 | PHB_acc_N: PHB/PHA accumulation regulator DNA-bind | 81.3 | |
| PF11829 | 96 | DUF3349: Protein of unknown function (DUF3349); In | 80.98 | |
| PLN02223 | 537 | phosphoinositide phospholipase C | 80.69 | |
| PF12174 | 70 | RST: RCD1-SRO-TAF4 (RST) plant domain; InterPro: I | 80.09 |
| >KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=99.81 E-value=5.3e-19 Score=112.83 Aligned_cols=98 Identities=34% Similarity=0.584 Sum_probs=89.9
Q ss_pred ccHHHHHHHHhhhccCCCHHHHHHHHHHhhcCCCCCceeHHHHHHHHHHhcCCCCC--HHHHHHHHHHHHHHhcCCCCCc
Q 034012 5 LNFKDFVAFLSVFSAKASMQQKVQLIFKVYDSDCNGKVSFNDILEVLRDLSGSFMS--DEQREQVLTQVFKDAGYTRDSY 82 (106)
Q Consensus 5 i~~~eF~~~~~~~~~~~~~~~~~~~~F~~~D~d~~g~i~~~el~~~l~~~~~~~l~--~~~~~~~~~~~~~~~d~~~~g~ 82 (106)
|+|++|+.+++.+.+....+++++.+|++||.+++|+|+.+|+..++..+++...+ +++.+.++++++.++|.++||+
T Consensus 84 v~F~~Fv~~ls~f~~~~~~~~Kl~faF~vYD~~~~G~I~reel~~iv~~~~~~~~~~~~e~~~~i~d~t~~e~D~d~DG~ 163 (187)
T KOG0034|consen 84 VDFEEFVRLLSVFSPKASKREKLRFAFRVYDLDGDGFISREELKQILRMMVGENDDMSDEQLEDIVDKTFEEADTDGDGK 163 (187)
T ss_pred cCHHHHHHHHhhhcCCccHHHHHHHHHHHhcCCCCCcCcHHHHHHHHHHHHccCCcchHHHHHHHHHHHHHHhCCCCCCc
Confidence 89999999999999888888999999999999999999999999999998887777 9999999999999999999999
Q ss_pred ccHHHHHHHHhcC-CCceeee
Q 034012 83 LTLGDFIKVFGNS-GLKMEVE 102 (106)
Q Consensus 83 I~~~ef~~~l~~~-~~~~~~~ 102 (106)
|+|+||..++.+. .+...+.
T Consensus 164 IsfeEf~~~v~~~P~~~~~m~ 184 (187)
T KOG0034|consen 164 ISFEEFCKVVEKQPDLLEKMT 184 (187)
T ss_pred CcHHHHHHHHHcCccHHHHcC
Confidence 9999999999887 4444333
|
|
| >COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
| >KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E | Back alignment and domain information |
|---|
| >KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PTZ00183 centrin; Provisional | Back alignment and domain information |
|---|
| >PTZ00184 calmodulin; Provisional | Back alignment and domain information |
|---|
| >cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 | Back alignment and domain information |
|---|
| >cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B | Back alignment and domain information |
|---|
| >KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z | Back alignment and domain information |
|---|
| >cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 | Back alignment and domain information |
|---|
| >cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 | Back alignment and domain information |
|---|
| >smart00027 EH Eps15 homology domain | Back alignment and domain information |
|---|
| >cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif | Back alignment and domain information |
|---|
| >KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction | Back alignment and domain information |
|---|
| >KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A | Back alignment and domain information |
|---|
| >cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 | Back alignment and domain information |
|---|
| >PTZ00183 centrin; Provisional | Back alignment and domain information |
|---|
| >cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) | Back alignment and domain information |
|---|
| >COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00184 calmodulin; Provisional | Back alignment and domain information |
|---|
| >cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 | Back alignment and domain information |
|---|
| >PF14658 EF-hand_9: EF-hand domain | Back alignment and domain information |
|---|
| >KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand | Back alignment and domain information |
|---|
| >KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >PLN02964 phosphatidylserine decarboxylase | Back alignment and domain information |
|---|
| >PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B | Back alignment and domain information |
|---|
| >PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A | Back alignment and domain information |
|---|
| >KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4065 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK12309 transaldolase/EF-hand domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand | Back alignment and domain information |
|---|
| >KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A | Back alignment and domain information |
|---|
| >PLN02964 phosphatidylserine decarboxylase | Back alignment and domain information |
|---|
| >PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A | Back alignment and domain information |
|---|
| >PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A | Back alignment and domain information |
|---|
| >KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E | Back alignment and domain information |
|---|
| >KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins | Back alignment and domain information |
|---|
| >KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A | Back alignment and domain information |
|---|
| >cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A | Back alignment and domain information |
|---|
| >KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 | Back alignment and domain information |
|---|
| >KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0751 consensus Mitochondrial aspartate/glutamate carrier protein Aralar/Citrin (contains EF-hand Ca2+-binding domains) [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 | Back alignment and domain information |
|---|
| >cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 | Back alignment and domain information |
|---|
| >PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B | Back alignment and domain information |
|---|
| >KOG2562 consensus Protein phosphatase 2 regulatory subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z | Back alignment and domain information |
|---|
| >KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 | Back alignment and domain information |
|---|
| >KOG4251 consensus Calcium binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >smart00054 EFh EF-hand, calcium binding motif | Back alignment and domain information |
|---|
| >cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction | Back alignment and domain information |
|---|
| >cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B | Back alignment and domain information |
|---|
| >PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C | Back alignment and domain information |
|---|
| >cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif | Back alignment and domain information |
|---|
| >cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 | Back alignment and domain information |
|---|
| >smart00027 EH Eps15 homology domain | Back alignment and domain information |
|---|
| >KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00054 EFh EF-hand, calcium binding motif | Back alignment and domain information |
|---|
| >KOG4251 consensus Calcium binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) | Back alignment and domain information |
|---|
| >PF09069 EF-hand_3: EF-hand; InterPro: IPR015154 Like other EF hand domains, this domain forms a helix-loop-helix motif, though since it does not contain the canonical pattern of calcium binding residues found in many EF hand domains, it does not bind calcium ions | Back alignment and domain information |
|---|
| >PLN02952 phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >KOG4578 consensus Uncharacterized conserved protein, contains KAZAL and TY domains [General function prediction only] | Back alignment and domain information |
|---|
| >PF14658 EF-hand_9: EF-hand domain | Back alignment and domain information |
|---|
| >PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A | Back alignment and domain information |
|---|
| >KOG4347 consensus GTPase-activating protein VRP [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2243 consensus Ca2+ release channel (ryanodine receptor) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK12309 transaldolase/EF-hand domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG3555 consensus Ca2+-binding proteoglycan Testican [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0751 consensus Mitochondrial aspartate/glutamate carrier protein Aralar/Citrin (contains EF-hand Ca2+-binding domains) [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG2562 consensus Protein phosphatase 2 regulatory subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF05517 p25-alpha: p25-alpha ; InterPro: IPR008907 This family encodes a 25 kDa protein that is phosphorylated by a Ser/Thr-Pro kinase [] | Back alignment and domain information |
|---|
| >KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG1955 consensus Ral-GTPase effector RALBP1 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0039 consensus Ferric reductase, NADH/NADPH oxidase and related proteins [Inorganic ion transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG3866 consensus DNA-binding protein of the nucleobindin family [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0035 consensus Ca2+-binding actin-bundling protein (actinin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin | Back alignment and domain information |
|---|
| >KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF08976 DUF1880: Domain of unknown function (DUF1880); InterPro: IPR015070 This entry represents EF-hand calcium-binding domain-containing protein 6 that negatively regulates the androgen receptor by recruiting histone deacetylase complex, and protein DJ-1 antagonises this inhibition by abrogation of this complex [] | Back alignment and domain information |
|---|
| >KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF08726 EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPro: IPR014837 EF hands are helix-loop-helix binding motifs involved in the regulation of many cellular processes | Back alignment and domain information |
|---|
| >KOG1265 consensus Phospholipase C [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01848 PHA_reg_PhaR polyhydroxyalkanoate synthesis repressor PhaR | Back alignment and domain information |
|---|
| >PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C | Back alignment and domain information |
|---|
| >PLN02230 phosphoinositide phospholipase C 4 | Back alignment and domain information |
|---|
| >PF08414 NADPH_Ox: Respiratory burst NADPH oxidase; InterPro: IPR013623 This domain is found in plant proteins such as respiratory burst NADPH oxidase proteins which produce reactive oxygen species as a defence mechanism | Back alignment and domain information |
|---|
| >PF07879 PHB_acc_N: PHB/PHA accumulation regulator DNA-binding domain; InterPro: IPR012909 This domain is found at the N terminus of the polyhydroxyalkanoate (PHA) synthesis regulators | Back alignment and domain information |
|---|
| >PF11829 DUF3349: Protein of unknown function (DUF3349); InterPro: IPR021784 This family of proteins are functionally uncharacterised | Back alignment and domain information |
|---|
| >PLN02223 phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >PF12174 RST: RCD1-SRO-TAF4 (RST) plant domain; InterPro: IPR022003 This domain is found in many plant proteins including SROs and RCD1s; it is required for interaction with multiple plant transcription factors | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 106 | ||||
| 1tco_B | 169 | Ternary Complex Of A Calcineurin A Fragment, Calcin | 1e-08 | ||
| 3ll8_B | 155 | Crystal Structure Of Calcineurin In Complex With Ak | 1e-08 | ||
| 1mf8_B | 170 | Crystal Structure Of Human Calcineurin Complexed Wi | 1e-08 | ||
| 2p6b_B | 156 | Crystal Structure Of Human Calcineurin In Complex W | 1e-08 | ||
| 2l4h_A | 214 | The Solution Structure Of Calcium Bound Cib1 Length | 4e-06 | ||
| 1dgu_A | 183 | Homology-Based Model Of Calcium-Saturated Cib (Calc | 4e-06 | ||
| 2ct9_A | 208 | The Crystal Structure Of Calcineurin B Homologous P | 2e-05 | ||
| 1bjf_A | 193 | Crystal Structure Of Recombinant Bovine Neurocalcin | 2e-05 | ||
| 2e30_A | 195 | Solution Structure Of The Cytoplasmic Region Of Na+ | 2e-05 | ||
| 2bec_A | 202 | Crystal Structure Of Chp2 In Complex With Its Bindi | 1e-04 | ||
| 1m39_A | 89 | Solution Structure Of The C-Terminal Fragment (F86- | 1e-04 | ||
| 2ggz_A | 211 | Crystal Structure Of Human Guanylate Cyclase Activa | 2e-04 | ||
| 2obh_A | 143 | Centrin-Xpc Peptide Length = 143 | 3e-04 | ||
| 3kf9_A | 149 | Crystal Structure Of The SdcenSKMLCK COMPLEX Length | 3e-04 | ||
| 2i94_A | 202 | Nmr Structure Of Recoverin Bound To Rhodopsin Kinas | 4e-04 | ||
| 2het_A | 189 | Non-Myristoylated Bovine Recoverin (Truncated At C- | 4e-04 | ||
| 1omr_A | 201 | Non-Myristoylated Wild-Type Bovine Recoverin With C | 4e-04 | ||
| 1jsa_A | 201 | Myristoylated Recoverin With Two Calciums Bound, Nm | 4e-04 | ||
| 2ggm_A | 172 | Human Centrin 2 Xeroderma Pigmentosum Group C Prote | 7e-04 | ||
| 2d8n_A | 207 | Crystal Structure Of Human Recoverin At 2.2 A Resol | 7e-04 | ||
| 1omv_A | 201 | Non-Myristoylated Bovine Recoverin (E85q Mutant) Wi | 7e-04 | ||
| 1la3_A | 201 | Solution Structure Of Recoverin Mutant, E85q Length | 8e-04 |
| >pdb|1TCO|B Chain B, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 169 | Back alignment and structure |
|
| >pdb|3LL8|B Chain B, Crystal Structure Of Calcineurin In Complex With Akap79 Peptide Length = 155 | Back alignment and structure |
| >pdb|1MF8|B Chain B, Crystal Structure Of Human Calcineurin Complexed With Cyclosporin A And Human Cyclophilin Length = 170 | Back alignment and structure |
| >pdb|2P6B|B Chain B, Crystal Structure Of Human Calcineurin In Complex With Pvivit Peptide Length = 156 | Back alignment and structure |
| >pdb|2L4H|A Chain A, The Solution Structure Of Calcium Bound Cib1 Length = 214 | Back alignment and structure |
| >pdb|1DGU|A Chain A, Homology-Based Model Of Calcium-Saturated Cib (Calcium-And Integrin-Binding Protein) Length = 183 | Back alignment and structure |
| >pdb|2CT9|A Chain A, The Crystal Structure Of Calcineurin B Homologous Proein 1 (Chp1) Length = 208 | Back alignment and structure |
| >pdb|1BJF|A Chain A, Crystal Structure Of Recombinant Bovine Neurocalcin Delta At 2.4 Angstroms Length = 193 | Back alignment and structure |
| >pdb|2E30|A Chain A, Solution Structure Of The Cytoplasmic Region Of Na+H+ Exchanger 1 Complexed With Essential Cofactor Calcineurin B Homologous Protein 1 Length = 195 | Back alignment and structure |
| >pdb|2BEC|A Chain A, Crystal Structure Of Chp2 In Complex With Its Binding Region In Nhe1 And Insights Into The Mechanism Of Ph Regulation Length = 202 | Back alignment and structure |
| >pdb|1M39|A Chain A, Solution Structure Of The C-Terminal Fragment (F86-I165) Of The Human Centrin 2 In Calcium Saturated Form Length = 89 | Back alignment and structure |
| >pdb|2GGZ|A Chain A, Crystal Structure Of Human Guanylate Cyclase Activating Protein-3 Length = 211 | Back alignment and structure |
| >pdb|2OBH|A Chain A, Centrin-Xpc Peptide Length = 143 | Back alignment and structure |
| >pdb|3KF9|A Chain A, Crystal Structure Of The SdcenSKMLCK COMPLEX Length = 149 | Back alignment and structure |
| >pdb|2I94|A Chain A, Nmr Structure Of Recoverin Bound To Rhodopsin Kinase Length = 202 | Back alignment and structure |
| >pdb|2HET|A Chain A, Non-Myristoylated Bovine Recoverin (Truncated At C-Terminus) With Calcium Bound To Ef-Hand 3 Length = 189 | Back alignment and structure |
| >pdb|1OMR|A Chain A, Non-Myristoylated Wild-Type Bovine Recoverin With Calcium Bound To Ef- Hand 3 Length = 201 | Back alignment and structure |
| >pdb|1JSA|A Chain A, Myristoylated Recoverin With Two Calciums Bound, Nmr, 24 Structures Length = 201 | Back alignment and structure |
| >pdb|2GGM|A Chain A, Human Centrin 2 Xeroderma Pigmentosum Group C Protein Complex Length = 172 | Back alignment and structure |
| >pdb|2D8N|A Chain A, Crystal Structure Of Human Recoverin At 2.2 A Resolution Length = 207 | Back alignment and structure |
| >pdb|1OMV|A Chain A, Non-Myristoylated Bovine Recoverin (E85q Mutant) With Calcium Bound To Ef-Hand 3 Length = 201 | Back alignment and structure |
| >pdb|1LA3|A Chain A, Solution Structure Of Recoverin Mutant, E85q Length = 201 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 106 | |||
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 5e-20 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 2e-19 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 5e-19 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 5e-18 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 1e-16 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 7e-14 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 4e-13 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 1e-10 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 2e-10 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 3e-10 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 3e-10 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 4e-10 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 1e-09 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 1e-09 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 1e-09 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 2e-09 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 2e-09 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 7e-09 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 4e-07 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 6e-07 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 2e-04 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 3e-04 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 3e-04 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 3e-04 | |
| 3a8r_A | 179 | Putative uncharacterized protein; EF-hand, membran | 3e-04 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 4e-04 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 5e-04 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 6e-04 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 8e-04 |
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Length = 214 | Back alignment and structure |
|---|
Score = 79.5 bits (196), Expect = 5e-20
Identities = 25/95 (26%), Positives = 50/95 (52%), Gaps = 4/95 (4%)
Query: 5 LNFKDFVAFLSVFSAKASMQQKVQLIFKVYDSDCNGKVSFNDILEVLRDL----SGSFMS 60
L+F+DF+ LSVFS A+ K F+++D D +G ++ D+ ++ L + +S
Sbjct: 109 LSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDDGTLNREDLSRLVNCLTGEGEDTRLS 168
Query: 61 DEQREQVLTQVFKDAGYTRDSYLTLGDFIKVFGNS 95
+ +Q++ + +++ RD + L +F V S
Sbjct: 169 ASEMKQLIDNILEESDIDRDGTINLSEFQHVISRS 203
|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183 | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207 | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256 | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Length = 143 | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Length = 156 | Back alignment and structure |
|---|
| >3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Length = 179 | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 106 | |||
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 99.78 | |
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 99.78 | |
| 3i5g_C | 159 | Myosin catalytic light chain LC-1, mantle muscle; | 99.75 | |
| 3i5g_B | 153 | Myosin regulatory light chain LC-2, mantle muscle; | 99.75 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 99.74 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 99.73 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 99.72 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 99.72 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 99.72 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 99.72 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 99.71 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 99.71 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 99.71 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 99.7 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 99.7 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 99.7 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 99.7 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 99.69 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 99.69 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 99.69 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 99.69 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 99.69 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 99.68 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 99.68 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 99.68 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 99.68 | |
| 3u0k_A | 440 | Rcamp; fluorescent protein, calcium binding, EF-ha | 99.68 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 99.68 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 99.68 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 99.67 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 99.67 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 99.67 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 99.67 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 99.66 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 99.66 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 99.66 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 99.66 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 99.65 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 99.65 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 99.65 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 99.64 | |
| 2lv7_A | 100 | Calcium-binding protein 7; metal binding protein; | 99.64 | |
| 3a8r_A | 179 | Putative uncharacterized protein; EF-hand, membran | 99.63 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 99.63 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 99.63 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 99.63 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 99.62 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 99.62 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 99.61 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 99.58 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 99.58 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 99.58 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 99.58 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 99.57 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 99.57 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 99.57 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 99.56 | |
| 1tiz_A | 67 | Calmodulin-related protein, putative; helix-turn-h | 99.56 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 99.56 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 99.56 | |
| 3nso_A | 101 | Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta | 99.55 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 99.55 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 99.55 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 99.55 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 99.55 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 99.55 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 99.55 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 99.55 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 99.54 | |
| 3n22_A | 98 | Protein S100-A2; EF-hand, calcium-binding, zinc-bi | 99.54 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 99.54 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 99.54 | |
| 1s6j_A | 87 | CDPK, calcium-dependent protein kinase SK5; EF-han | 99.54 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 99.54 | |
| 2b1u_A | 71 | Calmodulin-like protein 5; CLSP, calmodulin-like S | 99.54 | |
| 2kn2_A | 92 | Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco | 99.53 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 99.53 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 99.53 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 99.53 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 99.52 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 99.52 | |
| 1k9u_A | 78 | Polcalcin PHL P 7; pollen allergen, calcium-bindin | 99.51 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 99.51 | |
| 2lnk_A | 113 | Protein S100-A4; EF-hand, calcium binding, all alp | 99.51 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 99.51 | |
| 1yx7_A | 83 | Calsensin, LAN3-6 antigen; calcium-binding protein | 99.51 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 99.51 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 99.51 | |
| 4eto_A | 93 | Protein S100-A4; calcium-binding protein, EF-hand, | 99.5 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 99.5 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 99.5 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 99.5 | |
| 3zwh_A | 104 | Protein S100-A4; Ca-binding protein-motor protein | 99.49 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 99.49 | |
| 1c7v_A | 81 | CAVP, calcium vector protein; EF-hand family, calc | 99.49 | |
| 3nxa_A | 100 | Protein S100-A16; S100 family, calcium binding pro | 99.49 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 99.48 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 99.48 | |
| 2y5i_A | 99 | S100Z, S100 calcium binding protein Z; metal-bindi | 99.48 | |
| 1j7q_A | 86 | CAVP, calcium vector protein; EF-hand family, calc | 99.48 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 99.48 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 99.48 | |
| 1qx2_A | 76 | Vitamin D-dependent calcium-binding protein, INTE; | 99.48 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 99.47 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 99.47 | |
| 1fi6_A | 92 | EH domain protein REPS1; EPS15 homology domain, EF | 99.47 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 99.47 | |
| 2d58_A | 107 | Allograft inflammatory factor 1; EF-hand, metal bi | 99.47 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 99.47 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 99.47 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 99.47 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 99.47 | |
| 3rm1_A | 92 | Protein S100-B; alpha-helical, EF hand, metal bind | 99.47 | |
| 2wcb_A | 95 | Protein S100-A12; calcium signalling, HOST-parasit | 99.46 | |
| 4drw_A | 121 | Protein S100-A10/annexin A2 chimeric protein; atyp | 99.46 | |
| 1eg3_A | 261 | Dystrophin; EF-hand like domain, WW domain, struct | 99.46 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 99.45 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 99.45 | |
| 1j55_A | 95 | S-100P protein; metal binding protein; 2.00A {Homo | 99.45 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 99.45 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 99.45 | |
| 1c07_A | 95 | Protein (epidermal growth factor receptor pathway | 99.45 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 99.44 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 99.44 | |
| 1k2h_A | 93 | S100A1, S-100 protein, alpha chain; non-covalent h | 99.44 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 99.44 | |
| 1qjt_A | 99 | EH1, epidermal growth factor receptor substrate su | 99.43 | |
| 2lvv_A | 226 | Flagellar calcium-binding protein TB-24; EF-hand, | 99.43 | |
| 2kgr_A | 111 | Intersectin-1; structure, alternative splicing, ca | 99.42 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 99.42 | |
| 1snl_A | 103 | Nucleobindin 1, calnuc; EF-hand, calcium-binding, | 99.42 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 99.42 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 99.42 | |
| 2kld_A | 123 | Polycystin-2; PC2, PKD2, calcium binding domain, E | 99.42 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 99.42 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 99.41 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 99.41 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 99.4 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 99.4 | |
| 2h2k_A | 106 | Protein S100-A13; calcium binding protein, metal b | 99.4 | |
| 2kax_A | 92 | Protein S100-A5; EF-hand, calcium binding protien, | 99.39 | |
| 1k8u_A | 90 | S100A6, calcyclin, CACY; calcium regulatory protei | 99.39 | |
| 1cb1_A | 78 | Calbindin D9K; calcium-binding protein; NMR {Sus s | 99.38 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 99.38 | |
| 1iq3_A | 110 | Ralbp1-interacting protein (partner of ralbp1); EF | 99.38 | |
| 2jjz_A | 150 | Ionized calcium-binding adapter molecule 2; EF-han | 99.38 | |
| 1eh2_A | 106 | EPS15; calcium binding, signaling domain, NPF bind | 99.38 | |
| 1wy9_A | 147 | Allograft inflammatory factor 1; EF-hand, calucium | 99.37 | |
| 1xk4_C | 113 | Calgranulin B; S100 family, heterotetramer, metal | 99.37 | |
| 1xk4_A | 93 | Calgranulin A; S100 family, heterotetramer, metal | 99.37 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 99.36 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 99.36 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 99.35 | |
| 2jq6_A | 139 | EH domain-containing protein 1; metal binding prot | 99.35 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 99.33 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 99.33 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 99.33 | |
| 1psr_A | 100 | Psoriasin, S100A7; EF-hand protein, MAD phasing, p | 99.31 | |
| 1a4p_A | 96 | S100A10; S100 family, EF-hand protein, ligand of a | 99.31 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 99.31 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 99.31 | |
| 3bow_A | 714 | Calpain-2 catalytic subunit; cysteine protease, in | 99.31 | |
| 1qls_A | 99 | S100C protein, calgizzarin; metal-binding protein/ | 99.3 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 99.3 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 99.28 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 99.27 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 99.27 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 99.26 | |
| 1h8b_A | 75 | ACT-EF34, alpha-actinin 2, skeletal muscle isoform | 99.26 | |
| 3i5g_B | 153 | Myosin regulatory light chain LC-2, mantle muscle; | 99.26 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 99.26 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 99.25 | |
| 3u0k_A | 440 | Rcamp; fluorescent protein, calcium binding, EF-ha | 99.25 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 99.22 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 99.22 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 99.22 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 99.21 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 99.21 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 99.2 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 99.19 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 99.18 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 99.18 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 99.17 | |
| 1qxp_A | 900 | MU-like calpain; M-calpain, MU-calpain, catalytic | 99.17 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 99.16 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 99.16 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 99.15 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 99.15 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 99.15 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.15 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 99.15 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 99.14 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 99.14 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 99.13 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 99.13 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 99.13 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 99.13 | |
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 99.12 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 99.12 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 99.11 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 99.11 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 99.1 | |
| 3fia_A | 121 | Intersectin-1; EH 1 domain, NESG, structural genom | 99.1 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 99.09 | |
| 3i5g_C | 159 | Myosin catalytic light chain LC-1, mantle muscle; | 99.09 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 99.09 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 99.09 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 99.08 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 99.06 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 99.06 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 99.06 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 99.05 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 99.05 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 99.05 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 99.03 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 99.03 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 99.02 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 99.02 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 99.02 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 98.98 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 98.98 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 98.97 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 98.96 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 98.96 | |
| 1qxp_A | 900 | MU-like calpain; M-calpain, MU-calpain, catalytic | 98.95 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 98.93 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 98.93 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 98.93 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 98.92 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 98.92 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 98.91 | |
| 2lvv_A | 226 | Flagellar calcium-binding protein TB-24; EF-hand, | 98.9 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 98.89 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 98.87 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 98.86 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 98.84 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 98.82 | |
| 1sra_A | 151 | Sparc; extracellular matrix protein, calcium-bindi | 98.79 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 98.78 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 98.74 | |
| 3bow_A | 714 | Calpain-2 catalytic subunit; cysteine protease, in | 98.69 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 98.66 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 98.65 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 98.6 | |
| 3a8r_A | 179 | Putative uncharacterized protein; EF-hand, membran | 98.6 | |
| 1eg3_A | 261 | Dystrophin; EF-hand like domain, WW domain, struct | 98.55 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 98.55 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 98.49 | |
| 1nub_A | 229 | Basement membrane protein BM-40; extracellular mod | 98.42 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 98.41 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 98.41 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 98.41 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 98.38 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 98.37 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 98.34 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 98.31 | |
| 1tiz_A | 67 | Calmodulin-related protein, putative; helix-turn-h | 98.28 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 98.12 | |
| 2jjz_A | 150 | Ionized calcium-binding adapter molecule 2; EF-han | 98.09 | |
| 1k9u_A | 78 | Polcalcin PHL P 7; pollen allergen, calcium-bindin | 98.07 | |
| 2lv7_A | 100 | Calcium-binding protein 7; metal binding protein; | 98.07 | |
| 4drw_A | 121 | Protein S100-A10/annexin A2 chimeric protein; atyp | 98.06 | |
| 2kn2_A | 92 | Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco | 98.05 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 98.03 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 98.01 | |
| 3rm1_A | 92 | Protein S100-B; alpha-helical, EF hand, metal bind | 98.0 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 97.98 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 97.97 | |
| 1wy9_A | 147 | Allograft inflammatory factor 1; EF-hand, calucium | 97.96 | |
| 1tuz_A | 118 | Diacylglycerol kinase alpha; transferase, HR532, n | 97.96 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 97.94 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 97.94 | |
| 1xk4_C | 113 | Calgranulin B; S100 family, heterotetramer, metal | 97.93 | |
| 1qx2_A | 76 | Vitamin D-dependent calcium-binding protein, INTE; | 97.92 | |
| 2b1u_A | 71 | Calmodulin-like protein 5; CLSP, calmodulin-like S | 97.91 | |
| 3nxa_A | 100 | Protein S100-A16; S100 family, calcium binding pro | 97.87 | |
| 3n22_A | 98 | Protein S100-A2; EF-hand, calcium-binding, zinc-bi | 97.83 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 97.8 | |
| 1k2h_A | 93 | S100A1, S-100 protein, alpha chain; non-covalent h | 97.8 | |
| 1c7v_A | 81 | CAVP, calcium vector protein; EF-hand family, calc | 97.8 | |
| 4eto_A | 93 | Protein S100-A4; calcium-binding protein, EF-hand, | 97.78 | |
| 1cb1_A | 78 | Calbindin D9K; calcium-binding protein; NMR {Sus s | 97.78 | |
| 3nso_A | 101 | Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta | 97.77 | |
| 3zwh_A | 104 | Protein S100-A4; Ca-binding protein-motor protein | 97.74 | |
| 2kgr_A | 111 | Intersectin-1; structure, alternative splicing, ca | 97.73 | |
| 1k8u_A | 90 | S100A6, calcyclin, CACY; calcium regulatory protei | 97.71 | |
| 2d58_A | 107 | Allograft inflammatory factor 1; EF-hand, metal bi | 97.68 | |
| 1qjt_A | 99 | EH1, epidermal growth factor receptor substrate su | 97.68 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 97.67 | |
| 1j55_A | 95 | S-100P protein; metal binding protein; 2.00A {Homo | 97.67 | |
| 1s6j_A | 87 | CDPK, calcium-dependent protein kinase SK5; EF-han | 97.67 | |
| 2kax_A | 92 | Protein S100-A5; EF-hand, calcium binding protien, | 97.66 | |
| 1eh2_A | 106 | EPS15; calcium binding, signaling domain, NPF bind | 97.65 | |
| 1tuz_A | 118 | Diacylglycerol kinase alpha; transferase, HR532, n | 97.65 | |
| 1yx7_A | 83 | Calsensin, LAN3-6 antigen; calcium-binding protein | 97.64 | |
| 1j7q_A | 86 | CAVP, calcium vector protein; EF-hand family, calc | 97.64 | |
| 1fi6_A | 92 | EH domain protein REPS1; EPS15 homology domain, EF | 97.63 | |
| 2y5i_A | 99 | S100Z, S100 calcium binding protein Z; metal-bindi | 97.62 | |
| 1c07_A | 95 | Protein (epidermal growth factor receptor pathway | 97.6 | |
| 1qls_A | 99 | S100C protein, calgizzarin; metal-binding protein/ | 97.6 | |
| 1xk4_A | 93 | Calgranulin A; S100 family, heterotetramer, metal | 97.55 | |
| 2lnk_A | 113 | Protein S100-A4; EF-hand, calcium binding, all alp | 97.55 | |
| 1snl_A | 103 | Nucleobindin 1, calnuc; EF-hand, calcium-binding, | 97.53 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 97.5 | |
| 2h2k_A | 106 | Protein S100-A13; calcium binding protein, metal b | 97.49 | |
| 2wcb_A | 95 | Protein S100-A12; calcium signalling, HOST-parasit | 97.48 | |
| 1a4p_A | 96 | S100A10; S100 family, EF-hand protein, ligand of a | 97.44 | |
| 2jq6_A | 139 | EH domain-containing protein 1; metal binding prot | 97.36 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 97.28 | |
| 1iq3_A | 110 | Ralbp1-interacting protein (partner of ralbp1); EF | 97.24 | |
| 3fia_A | 121 | Intersectin-1; EH 1 domain, NESG, structural genom | 97.14 | |
| 2kld_A | 123 | Polycystin-2; PC2, PKD2, calcium binding domain, E | 97.11 | |
| 1psr_A | 100 | Psoriasin, S100A7; EF-hand protein, MAD phasing, p | 97.06 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 97.04 | |
| 2l5y_A | 150 | Stromal interaction molecule 2; EF-hand, SAM domai | 96.44 | |
| 1pul_A | 125 | Hypothetical protein C32E8.3 in chromosome I; alph | 96.16 | |
| 1sra_A | 151 | Sparc; extracellular matrix protein, calcium-bindi | 95.77 | |
| 2kav_A | 129 | Sodium channel protein type 2 subunit alpha; volta | 95.67 | |
| 4dck_A | 168 | Sodium channel protein type 5 subunit alpha; IQ-mo | 95.19 | |
| 3kev_A | 199 | Galieria sulfuraria DCUN1 domain-containing prote; | 94.46 | |
| 1wlm_A | 151 | Protein CGI-38; structural genomics, NPPSFA, natio | 94.44 | |
| 2k60_A | 150 | Protein (stromal interaction molecule 1); EF-hand, | 94.35 | |
| 2kav_A | 129 | Sodium channel protein type 2 subunit alpha; volta | 94.16 | |
| 3tdu_A | 200 | DCN1-like protein 1; E2:E3, ligase-protein binding | 94.08 | |
| 4fl4_A | 88 | Glycoside hydrolase family 9; structural genomics, | 93.78 | |
| 2jrf_A | 184 | Tubulin polymerization-promoting protein family me | 93.52 | |
| 4dh2_B | 82 | Dockerin type 1; cellulosome, cohesin, type I cohe | 92.33 | |
| 4gba_A | 221 | DCN1-like protein 3; E3 ligase, ligase-peptide com | 90.54 | |
| 4dck_A | 168 | Sodium channel protein type 5 subunit alpha; IQ-mo | 89.78 | |
| 3ul4_B | 65 | Cellulosome enzyme, dockerin type I; cohesin, type | 89.76 | |
| 2ccl_B | 63 | Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/d | 89.23 | |
| 1nub_A | 229 | Basement membrane protein BM-40; extracellular mod | 88.5 | |
| 1h8b_A | 75 | ACT-EF34, alpha-actinin 2, skeletal muscle isoform | 87.45 | |
| 2vn6_B | 64 | Endoglucanase A; cell adhesion, carbohydrate metab | 85.66 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 85.6 | |
| 3bq3_A | 270 | Defective in cullin neddylation protein 1; ubiquit | 85.48 | |
| 4dxt_A | 198 | SUN domain-containing protein 2; beta-sandwich, LI | 83.41 | |
| 2y3n_B | 71 | Cellulosomal family-48 processive glycoside hydro; | 81.49 |
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* | Back alignment and structure |
|---|
Probab=99.78 E-value=5.6e-18 Score=102.90 Aligned_cols=95 Identities=27% Similarity=0.538 Sum_probs=87.0
Q ss_pred CcccHHHHHHHHhhhccCCCHHHHHHHHHHhhcCCCCCceeHHHHHHHHHHhcCCCCCHHHHHHHHHHHHHHhcCCCCCc
Q 034012 3 DGLNFKDFVAFLSVFSAKASMQQKVQLIFKVYDSDCNGKVSFNDILEVLRDLSGSFMSDEQREQVLTQVFKDAGYTRDSY 82 (106)
Q Consensus 3 ~~i~~~eF~~~~~~~~~~~~~~~~~~~~F~~~D~d~~g~i~~~el~~~l~~~~~~~l~~~~~~~~~~~~~~~~d~~~~g~ 82 (106)
+.|+|+||+.++..........+.+..+|+.+|++++|+|+.+|++.++..+.+..++.+++..++..+|..+|.+++|.
T Consensus 53 g~i~~~ef~~~~~~~~~~~~~~~~~~~~F~~~D~d~~G~i~~~e~~~~l~~~~~~~~~~~~~~~~~~~~~~~~D~~~dg~ 132 (155)
T 3ll8_B 53 GEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGR 132 (155)
T ss_dssp SSBCHHHHHHHHGGGCSSCCHHHHHHHHHHHHCTTCSSCBCHHHHHHHHHHHHGGGSCHHHHHHHHHHHHHHHCTTSSSS
T ss_pred CcCcHHHHHHHHHHHcccCCHHHHHHHHHHHhCCCCCCcCcHHHHHHHHHHHhccCCCHHHHHHHHHHHHHHhCCCCCCc
Confidence 46999999999998766668889999999999999999999999999999844899999999999888888899999999
Q ss_pred ccHHHHHHHHhcCCC
Q 034012 83 LTLGDFIKVFGNSGL 97 (106)
Q Consensus 83 I~~~ef~~~l~~~~~ 97 (106)
|+|+||+.++.+.++
T Consensus 133 i~~~eF~~~~~~~~~ 147 (155)
T 3ll8_B 133 ISFEEFCAVVGGLDI 147 (155)
T ss_dssp BCHHHHHHHHGGGCG
T ss_pred CcHHHHHHHHhccCc
Confidence 999999999999877
|
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
| >3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C | Back alignment and structure |
|---|
| >3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C | Back alignment and structure |
|---|
| >2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A | Back alignment and structure |
|---|
| >2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A | Back alignment and structure |
|---|
| >3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A | Back alignment and structure |
|---|
| >2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} | Back alignment and structure |
|---|
| >1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A | Back alignment and structure |
|---|
| >1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A | Back alignment and structure |
|---|
| >2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... | Back alignment and structure |
|---|
| >2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A | Back alignment and structure |
|---|
| >4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A | Back alignment and structure |
|---|
| >1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A | Back alignment and structure |
|---|
| >1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A | Back alignment and structure |
|---|
| >1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A | Back alignment and structure |
|---|
| >2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A | Back alignment and structure |
|---|
| >2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A | Back alignment and structure |
|---|
| >1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A | Back alignment and structure |
|---|
| >1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A | Back alignment and structure |
|---|
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A | Back alignment and structure |
|---|
| >1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A | Back alignment and structure |
|---|
| >1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A | Back alignment and structure |
|---|
| >1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* | Back alignment and structure |
|---|
| >1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A | Back alignment and structure |
|---|
| >1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A | Back alignment and structure |
|---|
| >1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L | Back alignment and structure |
|---|
| >1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... | Back alignment and structure |
|---|
| >3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* | Back alignment and structure |
|---|
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
| >3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} | Back alignment and structure |
|---|
| >2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} | Back alignment and structure |
|---|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A | Back alignment and structure |
|---|
| >1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A | Back alignment and structure |
|---|
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L | Back alignment and structure |
|---|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A | Back alignment and structure |
|---|
| >1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} | Back alignment and structure |
|---|
| >2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A | Back alignment and structure |
|---|
| >1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 | Back alignment and structure |
|---|
| >2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A | Back alignment and structure |
|---|
| >3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A | Back alignment and structure |
|---|
| >1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A | Back alignment and structure |
|---|
| >1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A | Back alignment and structure |
|---|
| >1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* | Back alignment and structure |
|---|
| >1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A | Back alignment and structure |
|---|
| >2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A | Back alignment and structure |
|---|
| >1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A | Back alignment and structure |
|---|
| >4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* | Back alignment and structure |
|---|
| >1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 | Back alignment and structure |
|---|
| >3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A | Back alignment and structure |
|---|
| >3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A | Back alignment and structure |
|---|
| >2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A | Back alignment and structure |
|---|
| >1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A | Back alignment and structure |
|---|
| >1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A | Back alignment and structure |
|---|
| >1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A | Back alignment and structure |
|---|
| >1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A | Back alignment and structure |
|---|
| >2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A | Back alignment and structure |
|---|
| >1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A | Back alignment and structure |
|---|
| >2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A | Back alignment and structure |
|---|
| >1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A | Back alignment and structure |
|---|
| >2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A | Back alignment and structure |
|---|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A | Back alignment and structure |
|---|
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A | Back alignment and structure |
|---|
| >2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A | Back alignment and structure |
|---|
| >1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 | Back alignment and structure |
|---|
| >1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 | Back alignment and structure |
|---|
| >2kav_A Sodium channel protein type 2 subunit alpha; voltage-gated sodium channel, alternative splicing, disease epilepsy, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kbi_A | Back alignment and structure |
|---|
| >4dck_A Sodium channel protein type 5 subunit alpha; IQ-motif, EF-hand, voltage-gated sodium channel regulation, CTD binds to FGF13 and CAM. CAM binds to Ca2+.; 2.20A {Homo sapiens} PDB: 2kbi_A | Back alignment and structure |
|---|
| >3kev_A Galieria sulfuraria DCUN1 domain-containing prote; cullin, neddylation, DCN-1, center for eukaryotic structural genomics, PSI; HET: CSO MSE; 1.30A {Galdieria sulphuraria} | Back alignment and structure |
|---|
| >1wlm_A Protein CGI-38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.39.1.11 | Back alignment and structure |
|---|
| >2k60_A Protein (stromal interaction molecule 1); EF-hand, SAM domain, EF-SAM, STIM1, store operated calcium entry regulator, SOCE; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kav_A Sodium channel protein type 2 subunit alpha; voltage-gated sodium channel, alternative splicing, disease epilepsy, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kbi_A | Back alignment and structure |
|---|
| >3tdu_A DCN1-like protein 1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_A 4gao_A* | Back alignment and structure |
|---|
| >4fl4_A Glycoside hydrolase family 9; structural genomics, montreal-kingston bacterial structural initiative, BSGI, dockerin; 2.80A {Clostridium thermocellum} PDB: 3p0d_A | Back alignment and structure |
|---|
| >2jrf_A Tubulin polymerization-promoting protein family member 3; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4dh2_B Dockerin type 1; cellulosome, cohesin, type I cohesin-dockerin, Pro protein interaction, cell adhesion; 1.75A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >4gba_A DCN1-like protein 3; E3 ligase, ligase-peptide complex; HET: AME; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >4dck_A Sodium channel protein type 5 subunit alpha; IQ-motif, EF-hand, voltage-gated sodium channel regulation, CTD binds to FGF13 and CAM. CAM binds to Ca2+.; 2.20A {Homo sapiens} PDB: 2kbi_A | Back alignment and structure |
|---|
| >3ul4_B Cellulosome enzyme, dockerin type I; cohesin, type I cohesin-dockerin COMP protein-protein interaction, cell adhesion; HET: PEG; 1.95A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >2ccl_B Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/dockerin complex, cellulosome, cohesi dockerin, scaffolding, cellulose degradation; 2.03A {Clostridium thermocellum} SCOP: a.139.1.1 PDB: 1ohz_B | Back alignment and structure |
|---|
| >1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* | Back alignment and structure |
|---|
| >2vn6_B Endoglucanase A; cell adhesion, carbohydrate metabolism, polysaccharide degradation, hydrolase, glycosidase, cellulose degradation; 1.49A {Clostridium cellulolyticum} PDB: 2vn5_B | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >4dxt_A SUN domain-containing protein 2; beta-sandwich, LINC complex, structural protein; 2.22A {Homo sapiens} PDB: 3unp_A 4dxr_A* 4dxs_A* 4fi9_A | Back alignment and structure |
|---|
| >2y3n_B Cellulosomal family-48 processive glycoside hydro; structrual protein-hydrolase complex, cellulosome; 1.90A {Bacteroides cellulosolvens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 106 | ||||
| d1xo5a_ | 180 | a.39.1.5 (A:) Calcium- and integrin-binding protei | 2e-10 | |
| d5pala_ | 109 | a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis | 2e-05 | |
| d1ij5a_ | 321 | a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind | 3e-05 | |
| d1pvaa_ | 109 | a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax | 5e-05 | |
| d1c7va_ | 68 | a.39.1.5 (A:) Calcium vector protein {Amphioxus (B | 2e-04 | |
| d1rwya_ | 109 | a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta | 3e-04 | |
| d2pvba_ | 107 | a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax | 7e-04 | |
| d1auib_ | 165 | a.39.1.5 (B:) Calcineurin regulatory subunit (B-ch | 9e-04 | |
| d1snla_ | 99 | a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo | 0.001 | |
| d1oqpa_ | 77 | a.39.1.5 (A:) Caltractin (centrin 2) {Green algae | 0.003 | |
| d1rroa_ | 108 | a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) | 0.003 | |
| d1fpwa_ | 190 | a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 | 0.004 |
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: EF Hand-like superfamily: EF-hand family: Calmodulin-like domain: Calcium- and integrin-binding protein, CIB species: Human (Homo sapiens) [TaxId: 9606]
Score = 52.5 bits (125), Expect = 2e-10
Identities = 26/97 (26%), Positives = 51/97 (52%), Gaps = 4/97 (4%)
Query: 3 DGLNFKDFVAFLSVFSAKASMQQKVQLIFKVYDSDCNGKVSFNDILEVLRDL----SGSF 58
D L+F+DF+ LSVFS A+ K F+++D D +G ++ D+ ++ L +
Sbjct: 73 DSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDDGTLNREDLSRLVNCLTGEGEDTR 132
Query: 59 MSDEQREQVLTQVFKDAGYTRDSYLTLGDFIKVFGNS 95
+S + +Q++ + +++ RD + L +F V S
Sbjct: 133 LSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRS 169
|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 165 | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 106 | |||
| d5pala_ | 109 | Parvalbumin {Leopard shark (Triakis semifasciata) | 99.81 | |
| d1xo5a_ | 180 | Calcium- and integrin-binding protein, CIB {Human | 99.8 | |
| d1pvaa_ | 109 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 99.79 | |
| d1auib_ | 165 | Calcineurin regulatory subunit (B-chain) {Human (H | 99.76 | |
| d1rwya_ | 109 | Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | 99.75 | |
| d1wdcb_ | 142 | Myosin Essential Chain {Bay scallop (Aequipecten i | 99.74 | |
| d2zfda1 | 183 | Calcineurin B-like protein 2 {Thale cress (Arabido | 99.74 | |
| d1jc2a_ | 75 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.74 | |
| d1oqpa_ | 77 | Caltractin (centrin 2) {Green algae (Chlamydomonas | 99.72 | |
| d2pvba_ | 107 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 99.71 | |
| d1fw4a_ | 65 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 99.71 | |
| d1fi5a_ | 81 | Troponin C {Chicken (Gallus gallus), cardiac isofo | 99.7 | |
| d1rroa_ | 108 | Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 | 99.69 | |
| d1lkja_ | 146 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 99.69 | |
| d1exra_ | 146 | Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI | 99.68 | |
| d2mysb_ | 145 | Myosin Essential Chain {Chicken (Gallus gallus) [T | 99.68 | |
| d1tiza_ | 67 | Calmodulin-related protein T21P5.17 {Thale cress ( | 99.68 | |
| d2fcea1 | 61 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 99.67 | |
| d1c7va_ | 68 | Calcium vector protein {Amphioxus (Branchiostoma l | 99.66 | |
| d1wdcc_ | 152 | Myosin Regulatory Chain {Bay scallop (Aequipecten | 99.66 | |
| d1g8ia_ | 187 | Frequenin (neuronal calcium sensor 1) {Human (Homo | 99.66 | |
| d1avsa_ | 81 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.66 | |
| d1f54a_ | 77 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 99.65 | |
| d2pq3a1 | 73 | Calmodulin {Rattus norvegicus [TaxId: 10116]} | 99.64 | |
| d1fpwa_ | 190 | Frequenin (neuronal calcium sensor 1) {Baker's yea | 99.64 | |
| d1bjfa_ | 181 | Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | 99.63 | |
| d1wrka1 | 82 | Troponin C {Human (Homo sapiens), cardiac isoform | 99.63 | |
| d1ggwa_ | 140 | Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ | 99.63 | |
| d2opoa1 | 81 | Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta | 99.63 | |
| d2obha1 | 141 | Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | 99.62 | |
| d2mysc_ | 145 | Myosin Regulatory Chain {Chicken (Gallus gallus) [ | 99.62 | |
| d1omra_ | 201 | Recoverin {Cow (Bos taurus) [TaxId: 9913]} | 99.6 | |
| d1m45a_ | 146 | Myosin Light Chain Mlc1p {Baker's yeast (Saccharom | 99.6 | |
| d1s6ca_ | 178 | Kchip1, Kv4 potassium channel-interacting protein | 99.58 | |
| d1wlza1 | 83 | DJ-1-binding protein, DJBP {Human (Homo sapiens) [ | 99.56 | |
| d1dtla_ | 156 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.56 | |
| d1jbaa_ | 189 | Guanylate cyclase activating protein 2, GCAP-2 {Co | 99.55 | |
| d1topa_ | 162 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.55 | |
| d1s6ja_ | 87 | Calcium-dependent protein kinase sk5 CLD {Soybean | 99.54 | |
| d1qx2a_ | 76 | Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | 99.52 | |
| d1k94a_ | 165 | Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | 99.51 | |
| d1snla_ | 99 | Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax | 99.5 | |
| d1w7jb1 | 139 | Myosin Essential Chain {Human (Homo sapiens) [TaxI | 99.49 | |
| d1qv0a_ | 189 | Calcium-regulated photoprotein {Hydrozoa (Obelia l | 99.48 | |
| d1df0a1 | 186 | Calpain large subunit, C-terminal domain (domain I | 99.47 | |
| d1hqva_ | 181 | Apoptosis-linked protein alg-2 {Mouse (Mus musculu | 99.47 | |
| d1y1xa_ | 182 | Programmed cell death 6 protein-like protein {Leis | 99.47 | |
| d1uhka1 | 187 | Calcium-regulated photoprotein {Jellyfish (Aequore | 99.45 | |
| d1qxpa2 | 188 | Calpain large subunit, C-terminal domain (domain I | 99.45 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 99.44 | |
| d1alva_ | 173 | Calpain small (regulatory) subunit (domain VI) {Pi | 99.41 | |
| d1juoa_ | 172 | Sorcin {Human (Homo sapiens) [TaxId: 9606]} | 99.39 | |
| d1zfsa1 | 93 | Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 | 99.39 | |
| d2scpa_ | 174 | Sarcoplasmic calcium-binding protein {Sandworm (Ne | 99.37 | |
| d1nyaa_ | 176 | Calerythrin {Saccharopolyspora erythraea [TaxId: 1 | 99.37 | |
| d3c1va1 | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta | 99.37 | |
| d2sasa_ | 185 | Sarcoplasmic calcium-binding protein {Amphioxus (B | 99.36 | |
| d1s6ia_ | 182 | Calcium-dependent protein kinase sk5 CLD {Soybean | 99.35 | |
| d1c07a_ | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 99.35 | |
| d1ksoa_ | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta | 99.34 | |
| d1a4pa_ | 92 | Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 | 99.34 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 99.34 | |
| d1cb1a_ | 78 | Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | 99.33 | |
| d1yuta1 | 98 | Calcyclin (S100) {Human (Homo sapiens), s100a13 [T | 99.33 | |
| d1fi6a_ | 92 | Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | 99.32 | |
| d1fpwa_ | 190 | Frequenin (neuronal calcium sensor 1) {Baker's yea | 99.32 | |
| d1xk4a1 | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 99.31 | |
| d1omra_ | 201 | Recoverin {Cow (Bos taurus) [TaxId: 9913]} | 99.27 | |
| d1k8ua_ | 89 | Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta | 99.25 | |
| d1jbaa_ | 189 | Guanylate cyclase activating protein 2, GCAP-2 {Co | 99.24 | |
| d1ij5a_ | 321 | Cbp40 (plasmodial specific CaII-binding protein LA | 99.21 | |
| d1wdcb_ | 142 | Myosin Essential Chain {Bay scallop (Aequipecten i | 99.2 | |
| d1exra_ | 146 | Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI | 99.19 | |
| d1s6ca_ | 178 | Kchip1, Kv4 potassium channel-interacting protein | 99.18 | |
| d2jxca1 | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 99.17 | |
| d1qjta_ | 99 | Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | 99.17 | |
| d1e8aa_ | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 99.15 | |
| d2obha1 | 141 | Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | 99.15 | |
| d2mysc_ | 145 | Myosin Regulatory Chain {Chicken (Gallus gallus) [ | 99.14 | |
| d1iq3a_ | 110 | Pob1 {Human (Homo sapiens) [TaxId: 9606]} | 99.13 | |
| d1hqva_ | 181 | Apoptosis-linked protein alg-2 {Mouse (Mus musculu | 99.12 | |
| d1ggwa_ | 140 | Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ | 99.11 | |
| d1bjfa_ | 181 | Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | 99.11 | |
| d1lkja_ | 146 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 99.1 | |
| d1k94a_ | 165 | Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | 99.1 | |
| d1g8ia_ | 187 | Frequenin (neuronal calcium sensor 1) {Human (Homo | 99.09 | |
| d1y1xa_ | 182 | Programmed cell death 6 protein-like protein {Leis | 99.09 | |
| d1psra_ | 100 | Calcyclin (S100) {Human (Homo sapiens), psoriasin | 99.08 | |
| d1w7jb1 | 139 | Myosin Essential Chain {Human (Homo sapiens) [TaxI | 99.05 | |
| d2zfda1 | 183 | Calcineurin B-like protein 2 {Thale cress (Arabido | 99.05 | |
| d2hf5a1 | 33 | Troponin C {Human (Homo sapiens), cardiac isoform | 99.05 | |
| d2zkmx1 | 170 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 99.04 | |
| d1s6ia_ | 182 | Calcium-dependent protein kinase sk5 CLD {Soybean | 99.03 | |
| d1wdcc_ | 152 | Myosin Regulatory Chain {Bay scallop (Aequipecten | 99.0 | |
| d1topa_ | 162 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.95 | |
| d1m45a_ | 146 | Myosin Light Chain Mlc1p {Baker's yeast (Saccharom | 98.95 | |
| d1juoa_ | 172 | Sorcin {Human (Homo sapiens) [TaxId: 9606]} | 98.88 | |
| d3cr5x1 | 90 | Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: | 98.86 | |
| d1auib_ | 165 | Calcineurin regulatory subunit (B-chain) {Human (H | 98.86 | |
| d2mysb_ | 145 | Myosin Essential Chain {Chicken (Gallus gallus) [T | 98.84 | |
| d1df0a1 | 186 | Calpain large subunit, C-terminal domain (domain I | 98.81 | |
| d1ij5a_ | 321 | Cbp40 (plasmodial specific CaII-binding protein LA | 98.81 | |
| d1dtla_ | 156 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.79 | |
| d1alva_ | 173 | Calpain small (regulatory) subunit (domain VI) {Pi | 98.78 | |
| d1ctda_ | 34 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.78 | |
| d1j55a_ | 94 | Calcyclin (S100) {Human (Homo sapiens), s100p [Tax | 98.74 | |
| d1xk4c1 | 83 | Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr | 98.7 | |
| d1nyaa_ | 176 | Calerythrin {Saccharopolyspora erythraea [TaxId: 1 | 98.69 | |
| d1qlsa_ | 95 | Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 | 98.69 | |
| d1uhka1 | 187 | Calcium-regulated photoprotein {Jellyfish (Aequore | 98.66 | |
| d1xo5a_ | 180 | Calcium- and integrin-binding protein, CIB {Human | 98.61 | |
| d1tiza_ | 67 | Calmodulin-related protein T21P5.17 {Thale cress ( | 98.54 | |
| d2scpa_ | 174 | Sarcoplasmic calcium-binding protein {Sandworm (Ne | 98.53 | |
| d1qxpa2 | 188 | Calpain large subunit, C-terminal domain (domain I | 98.52 | |
| d2sasa_ | 185 | Sarcoplasmic calcium-binding protein {Amphioxus (B | 98.38 | |
| d1oqpa_ | 77 | Caltractin (centrin 2) {Green algae (Chlamydomonas | 98.34 | |
| d1fw4a_ | 65 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 98.26 | |
| d1c7va_ | 68 | Calcium vector protein {Amphioxus (Branchiostoma l | 98.25 | |
| d1qv0a_ | 189 | Calcium-regulated photoprotein {Hydrozoa (Obelia l | 98.23 | |
| d2opoa1 | 81 | Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta | 98.22 | |
| d1jc2a_ | 75 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.21 | |
| d1wrka1 | 82 | Troponin C {Human (Homo sapiens), cardiac isoform | 98.21 | |
| d1fi5a_ | 81 | Troponin C {Chicken (Gallus gallus), cardiac isofo | 98.19 | |
| d1avsa_ | 81 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.16 | |
| d2pq3a1 | 73 | Calmodulin {Rattus norvegicus [TaxId: 10116]} | 98.14 | |
| d1rroa_ | 108 | Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 | 98.08 | |
| d2zkmx1 | 170 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 98.08 | |
| d2fcea1 | 61 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 98.06 | |
| d1pvaa_ | 109 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 98.06 | |
| d3c1va1 | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta | 98.06 | |
| d1rwya_ | 109 | Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | 98.05 | |
| d1qx2a_ | 76 | Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | 98.04 | |
| d1wlza1 | 83 | DJ-1-binding protein, DJBP {Human (Homo sapiens) [ | 98.02 | |
| d5pala_ | 109 | Parvalbumin {Leopard shark (Triakis semifasciata) | 98.02 | |
| d1f54a_ | 77 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 97.97 | |
| d1zfsa1 | 93 | Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 | 97.96 | |
| d2hf5a1 | 33 | Troponin C {Human (Homo sapiens), cardiac isoform | 97.89 | |
| d1s6ja_ | 87 | Calcium-dependent protein kinase sk5 CLD {Soybean | 97.85 | |
| d1c07a_ | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 97.84 | |
| d2pvba_ | 107 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 97.84 | |
| d1a4pa_ | 92 | Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 | 97.84 | |
| d1cb1a_ | 78 | Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | 97.78 | |
| d1qjta_ | 99 | Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | 97.77 | |
| d1yuta1 | 98 | Calcyclin (S100) {Human (Homo sapiens), s100a13 [T | 97.76 | |
| d1sraa_ | 151 | C-terminal (EC) domain of BM-40/SPARC/osteonectin | 97.75 | |
| d1fi6a_ | 92 | Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | 97.69 | |
| d1ctda_ | 34 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 97.66 | |
| d1snla_ | 99 | Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax | 97.66 | |
| d1ksoa_ | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta | 97.64 | |
| d2jxca1 | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 97.63 | |
| d1tuza_ | 118 | Diacylglycerol kinase alpha, N-terminal domain {Hu | 97.61 | |
| d1tuza_ | 118 | Diacylglycerol kinase alpha, N-terminal domain {Hu | 97.59 | |
| d1e8aa_ | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 97.59 | |
| d3cr5x1 | 90 | Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: | 97.51 | |
| d1xk4a1 | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 97.47 | |
| d1psra_ | 100 | Calcyclin (S100) {Human (Homo sapiens), psoriasin | 97.31 | |
| d1k8ua_ | 89 | Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta | 97.25 | |
| d1qlsa_ | 95 | Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 | 97.2 | |
| d1iq3a_ | 110 | Pob1 {Human (Homo sapiens) [TaxId: 9606]} | 97.12 | |
| d1j55a_ | 94 | Calcyclin (S100) {Human (Homo sapiens), s100p [Tax | 97.06 | |
| d1xk4c1 | 83 | Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr | 97.02 | |
| d1j7qa_ | 86 | Calcium vector protein {Amphioxus (Branchiostoma l | 96.49 | |
| d1qasa1 | 94 | Phosphoinositide-specific phospholipase C, isozyme | 96.3 | |
| d1h8ba_ | 73 | alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} | 93.62 | |
| d2cclb1 | 59 | Endo-1,4-beta-xylanase Y {Clostridium thermocellum | 93.25 | |
| d1eg3a2 | 97 | Dystrophin {Human (Homo sapiens) [TaxId: 9606]} | 92.22 | |
| d1pula1 | 103 | Hypothetical protein c32e8.3 {Caenorhabditis elega | 92.19 | |
| d1dava_ | 71 | Cellulosome endoglucanase SS {Clostridium thermoce | 91.96 | |
| d1wlma1 | 138 | Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090 | 90.85 | |
| d1qasa1 | 94 | Phosphoinositide-specific phospholipase C, isozyme | 81.52 | |
| d2b59b1 | 60 | Cellulosomal scaffolding protein A {Clostridium th | 81.21 |
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: EF Hand-like superfamily: EF-hand family: Parvalbumin domain: Parvalbumin species: Leopard shark (Triakis semifasciata) [TaxId: 30493]
Probab=99.81 E-value=1.7e-19 Score=104.41 Aligned_cols=85 Identities=18% Similarity=0.414 Sum_probs=74.0
Q ss_pred CcccHHHHHHHHhhhccCCCHHHHHHHHHHhhcCCCCCceeHHHHHHHHHHh--cCCCCCHHHHHHHHHHHHHHhcCCCC
Q 034012 3 DGLNFKDFVAFLSVFSAKASMQQKVQLIFKVYDSDCNGKVSFNDILEVLRDL--SGSFMSDEQREQVLTQVFKDAGYTRD 80 (106)
Q Consensus 3 ~~i~~~eF~~~~~~~~~~~~~~~~~~~~F~~~D~d~~g~i~~~el~~~l~~~--~~~~l~~~~~~~~~~~~~~~~d~~~~ 80 (106)
+.|+|.||+..+.. ...+.+.++.+|+.||+|++|+|+.+||+.+++.+ .|..+++++++.+ ++.+|.+++
T Consensus 22 G~idf~eF~~~~~~---~~~~~~~l~~~F~~~D~d~~G~I~~~El~~~l~~l~~~g~~~~~~e~~~~----~~~~D~d~d 94 (109)
T d5pala_ 22 GTFDYKRFFHLVGL---KGKTDAQVKEVFEILDKDQSGFIEEEELKGVLKGFSAHGRDLNDTETKAL----LAAGDSDHD 94 (109)
T ss_dssp TCCCHHHHHHHHTC---TTCCHHHHHHHHHHHCTTCSSEECHHHHHTHHHHHCTTCCCCCHHHHHHH----HHHHCTTCS
T ss_pred CcCcHHHHHHHHHh---cCCCHHHHHHHHhhhcCCCCCeEcHHHHHHHHHHhhhccCcCCHHHHHHH----HHHhCCCCC
Confidence 47999999987753 34566899999999999999999999999999875 2568899888877 799999999
Q ss_pred CcccHHHHHHHHhc
Q 034012 81 SYLTLGDFIKVFGN 94 (106)
Q Consensus 81 g~I~~~ef~~~l~~ 94 (106)
|+|+|+||+.++++
T Consensus 95 G~I~~~EF~~~m~~ 108 (109)
T d5pala_ 95 GKIGADEFAKMVAQ 108 (109)
T ss_dssp SSEEHHHHHHHHHH
T ss_pred CCEeHHHHHHHHHh
Confidence 99999999998875
|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} | Back information, alignment and structure |
|---|
| >d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} | Back information, alignment and structure |
|---|
| >d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} | Back information, alignment and structure |
|---|
| >d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} | Back information, alignment and structure |
|---|
| >d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cclb1 a.139.1.1 (B:1-59) Endo-1,4-beta-xylanase Y {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1eg3a2 a.39.1.7 (A:210-306) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pula1 a.39.1.11 (A:18-120) Hypothetical protein c32e8.3 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1dava_ a.139.1.1 (A:) Cellulosome endoglucanase SS {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1wlma1 a.39.1.11 (A:8-145) Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2b59b1 a.139.1.1 (B:104-163) Cellulosomal scaffolding protein A {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|