Citrus Sinensis ID: 034263


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
MSGGGIARGRLTEERKAWRKNHPHGFVAKPETKDGSVNLMIWECIIPGKTGTDWEGGYFPLTLYFSEDYPSKPPKWVETCHYCEANFSGHSGFAGSTQSC
ccccHHHHHHHHHHHHHHHHcccccEEEEEccccccccEEEEEEEccccccccccccEEEEEEEccccccccccEEEEcccccccccccccccccccccc
ccccccHHHHHHHHHHHHHHccccccEEEEccccccEEEEEEEEEEEccccccccccEEEEEEEccccccccccEcEcccccccccEEcccccccccccc
msgggiargrLTEERKAwrknhphgfvakpetkdgsvnLMIWECiipgktgtdweggyfpltlyfsedypskppkwvetchyceanfsghsgfagstqsc
msgggiargrlteerkawrknhphgfvakpetkdgsvnLMIWECIIPGKTGTDWEGGYFPLTLYFSEDYPSKPPKWVETCHYCEANFsghsgfagstqsc
MSGGGIARGRLTEERKAWRKNHPHGFVAKPETKDGSVNLMIWECIIPGKTGTDWEGGYFPLTLYFSEDYPSKPPKWVETCHYCEANFSGHSGFAGSTQSC
**********************************GSVNLMIWECIIPGKTGTDWEGGYFPLTLYFSEDYPSKPPKWVETCHYCEANFS************
******A***LTEERKAWRKNHPHGFVAKPETKDGSVNLMIWECIIPGKTGTDWEGGYFPLTLYFSEDYPSKPPKWVETCHYCEANFSGHSGFAGSTQSC
MSGGGIARGRLTEERKAWRKNHPHGFVAKPETKDGSVNLMIWECIIPGKTGTDWEGGYFPLTLYFSEDYPSKPPKWVETCHYCEANFSGHS*********
*****IARGRLTEERKAWRKNHPHGFVAKPETKDGSVNLMIWECIIPGKTGTDWEGGYFPLTLYFSEDYPSKPPKWVETCHYCEANFSGHSGF*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGGGIARGRLTEERKAWRKNHPHGFVAKPETKDGSVNLMIWECIIPGKTGTDWEGGYFPLTLYFSEDYPSKPPKWVETCHYCEANFSGHSGFAGSTQSC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query100 2.2.26 [Sep-21-2011]
Q42551160 SUMO-conjugating enzyme S yes no 0.73 0.456 0.810 4e-31
Q9NGP4159 Sumo-conjugating enzyme u yes no 0.72 0.452 0.630 2e-22
Q9W6H5158 SUMO-conjugating enzyme U yes no 0.72 0.455 0.643 2e-21
Q28CQ4158 SUMO-conjugating enzyme U yes no 0.72 0.455 0.643 2e-21
P63282158 SUMO-conjugating enzyme U N/A no 0.72 0.455 0.643 2e-21
Q2EF73158 SUMO-conjugating enzyme U N/A no 0.72 0.455 0.643 2e-21
P63281158 SUMO-conjugating enzyme U yes no 0.72 0.455 0.643 2e-21
P63280158 SUMO-conjugating enzyme U yes no 0.72 0.455 0.643 2e-21
P63279158 SUMO-conjugating enzyme U yes no 0.72 0.455 0.643 2e-21
P63283158 SUMO-conjugating enzyme U yes no 0.72 0.455 0.643 2e-21
>sp|Q42551|SCE1_ARATH SUMO-conjugating enzyme SCE1 OS=Arabidopsis thaliana GN=SCE1 PE=1 SV=1 Back     alignment and function desciption
 Score =  133 bits (334), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 67/74 (90%), Gaps = 1/74 (1%)

Query: 3  GGGIARGRLTEERKAWRKNHPHGFVAKPET-KDGSVNLMIWECIIPGKTGTDWEGGYFPL 61
            GIARGRL EERK+WRKNHPHGFVAKPET +DG+VNLM+W C IPGK GTDWEGG+FPL
Sbjct: 2  ASGIARGRLAEERKSWRKNHPHGFVAKPETGQDGTVNLMVWHCTIPGKAGTDWEGGFFPL 61

Query: 62 TLYFSEDYPSKPPK 75
          T++FSEDYPSKPPK
Sbjct: 62 TMHFSEDYPSKPPK 75




SUMO-conjugating enzyme that accepts the SUMO proteins from the E1 SUMO-activating heterodimer SAE1/SAE2 and catalyzes its covalent attachment to other proteins with the E3 SUMO ligases SIZ1 and MMS21. Associates with SIZ1 for sumoylation of the transcription factor GTE3.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q9NGP4|UBC9_DICDI Sumo-conjugating enzyme ubc9 OS=Dictyostelium discoideum GN=ubc9 PE=3 SV=1 Back     alignment and function description
>sp|Q9W6H5|UBC9A_DANRE SUMO-conjugating enzyme UBC9-A OS=Danio rerio GN=ube2ia PE=1 SV=1 Back     alignment and function description
>sp|Q28CQ4|UBC9_XENTR SUMO-conjugating enzyme UBC9 OS=Xenopus tropicalis GN=ube2i PE=2 SV=1 Back     alignment and function description
>sp|P63282|UBC9_XENLA SUMO-conjugating enzyme UBC9 OS=Xenopus laevis GN=ube2i PE=1 SV=1 Back     alignment and function description
>sp|Q2EF73|UBC9_SPETR SUMO-conjugating enzyme UBC9 OS=Spermophilus tridecemlineatus GN=UBE2I PE=1 SV=1 Back     alignment and function description
>sp|P63281|UBC9_RAT SUMO-conjugating enzyme UBC9 OS=Rattus norvegicus GN=Ube2i PE=1 SV=1 Back     alignment and function description
>sp|P63280|UBC9_MOUSE SUMO-conjugating enzyme UBC9 OS=Mus musculus GN=Ube2i PE=1 SV=1 Back     alignment and function description
>sp|P63279|UBC9_HUMAN SUMO-conjugating enzyme UBC9 OS=Homo sapiens GN=UBE2I PE=1 SV=1 Back     alignment and function description
>sp|P63283|UBC9_CHICK SUMO-conjugating enzyme UBC9 OS=Gallus gallus GN=UBE2I PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query100
357147197161 PREDICTED: SUMO-conjugating enzyme SCE1- 0.75 0.465 0.894 1e-32
326508977161 predicted protein [Hordeum vulgare subsp 0.75 0.465 0.881 4e-32
110628146161 putative E2 SUMO conjugating enzyme [Tri 0.75 0.465 0.868 7e-32
224063487161 predicted protein [Populus trichocarpa] 0.75 0.465 0.855 1e-31
351726411160 uncharacterized protein LOC100500268 [Gl 0.72 0.45 0.890 2e-31
449484112 272 PREDICTED: SUMO-conjugating enzyme SCE1- 0.8 0.294 0.776 2e-31
224137616161 predicted protein [Populus trichocarpa] 0.75 0.465 0.828 3e-31
225458690160 PREDICTED: SUMO-conjugating enzyme SCE1 0.72 0.45 0.890 3e-31
116784141160 unknown [Picea sitchensis] gi|116792676| 0.72 0.45 0.849 4e-31
147790674160 hypothetical protein VITISV_001138 [Viti 0.72 0.45 0.890 4e-31
>gi|357147197|ref|XP_003574257.1| PREDICTED: SUMO-conjugating enzyme SCE1-like isoform 1 [Brachypodium distachyon] Back     alignment and taxonomy information
 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 69/76 (90%), Gaps = 1/76 (1%)

Query: 1  MSGGGIARGRLTEERKAWRKNHPHGFVAKPET-KDGSVNLMIWECIIPGKTGTDWEGGYF 59
          MSGGGIARGRL EERKAWRKNHPHGFVAKPET  DGSVNLM+W C IPGK GTDWEGGYF
Sbjct: 1  MSGGGIARGRLAEERKAWRKNHPHGFVAKPETVADGSVNLMVWHCTIPGKQGTDWEGGYF 60

Query: 60 PLTLYFSEDYPSKPPK 75
          PLTL FSEDYPSKPPK
Sbjct: 61 PLTLQFSEDYPSKPPK 76




Source: Brachypodium distachyon

Species: Brachypodium distachyon

Genus: Brachypodium

Family: Poaceae

Order: Poales

Class: Liliopsida

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|326508977|dbj|BAJ86881.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|110628146|gb|ABG79538.1| putative E2 SUMO conjugating enzyme [Triticum durum] Back     alignment and taxonomy information
>gi|224063487|ref|XP_002301168.1| predicted protein [Populus trichocarpa] gi|118485912|gb|ABK94802.1| unknown [Populus trichocarpa] gi|118488765|gb|ABK96193.1| unknown [Populus trichocarpa] gi|222842894|gb|EEE80441.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|351726411|ref|NP_001235590.1| uncharacterized protein LOC100500268 [Glycine max] gi|356511865|ref|XP_003524642.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Glycine max] gi|255629881|gb|ACU15291.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449484112|ref|XP_004156788.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224137616|ref|XP_002327170.1| predicted protein [Populus trichocarpa] gi|222835485|gb|EEE73920.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225458690|ref|XP_002284949.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Vitis vinifera] gi|302142282|emb|CBI19485.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|116784141|gb|ABK23228.1| unknown [Picea sitchensis] gi|116792676|gb|ABK26454.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|147790674|emb|CAN61018.1| hypothetical protein VITISV_001138 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query100
TAIR|locus:2095838160 SCE1 "sumo conjugation enzyme 0.71 0.443 0.833 3.7e-32
DICTYBASE|DDB_G0287693159 ubc9 "SUMO-conjugating enzyme 0.71 0.446 0.638 1.8e-23
UNIPROTKB|F1P5D0162 UBE2I "SUMO-conjugating enzyme 0.71 0.438 0.652 1.3e-22
UNIPROTKB|P63283158 UBE2I "SUMO-conjugating enzyme 0.71 0.449 0.652 1.3e-22
UNIPROTKB|A6H744158 UBE2I "Uncharacterized protein 0.71 0.449 0.652 1.3e-22
UNIPROTKB|J9NWL1141 UBE2I "Uncharacterized protein 0.71 0.503 0.652 1.3e-22
UNIPROTKB|B0QYN7184 UBE2I "SUMO-conjugating enzyme 0.71 0.385 0.652 1.3e-22
UNIPROTKB|H3BQQ9137 UBE2I "SUMO-conjugating enzyme 0.71 0.518 0.652 1.3e-22
UNIPROTKB|P63279158 UBE2I "SUMO-conjugating enzyme 0.71 0.449 0.652 1.3e-22
UNIPROTKB|I3LSZ1158 UBE2I "Uncharacterized protein 0.71 0.449 0.652 1.3e-22
TAIR|locus:2095838 SCE1 "sumo conjugation enzyme 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 352 (129.0 bits), Expect = 3.7e-32, P = 3.7e-32
 Identities = 60/72 (83%), Positives = 67/72 (93%)

Query:     5 GIARGRLTEERKAWRKNHPHGFVAKPET-KDGSVNLMIWECIIPGKTGTDWEGGYFPLTL 63
             GIARGRL EERK+WRKNHPHGFVAKPET +DG+VNLM+W C IPGK GTDWEGG+FPLT+
Sbjct:     4 GIARGRLAEERKSWRKNHPHGFVAKPETGQDGTVNLMVWHCTIPGKAGTDWEGGFFPLTM 63

Query:    64 YFSEDYPSKPPK 75
             +FSEDYPSKPPK
Sbjct:    64 HFSEDYPSKPPK 75




GO:0005634 "nucleus" evidence=ISM;IDA
GO:0009793 "embryo development ending in seed dormancy" evidence=IMP;NAS
GO:0009737 "response to abscisic acid stimulus" evidence=IMP
GO:0019789 "SUMO ligase activity" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0016925 "protein sumoylation" evidence=IDA
DICTYBASE|DDB_G0287693 ubc9 "SUMO-conjugating enzyme UBC9" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|F1P5D0 UBE2I "SUMO-conjugating enzyme UBC9" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P63283 UBE2I "SUMO-conjugating enzyme UBC9" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A6H744 UBE2I "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9NWL1 UBE2I "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|B0QYN7 UBE2I "SUMO-conjugating enzyme UBC9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H3BQQ9 UBE2I "SUMO-conjugating enzyme UBC9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P63279 UBE2I "SUMO-conjugating enzyme UBC9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LSZ1 UBE2I "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q42551SCE1_ARATH6, ., 3, ., 2, ., -0.81080.730.4562yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
BRADI3G32080.1
annotation not avaliable (161 aa)
(Brachypodium distachyon)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query100
COG5078153 COG5078, COG5078, Ubiquitin-protein ligase [Posttr 1e-22
pfam00179139 pfam00179, UQ_con, Ubiquitin-conjugating enzyme 1e-22
smart00212145 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, 3e-22
cd00195141 cd00195, UBCc, Ubiquitin-conjugating enzyme E2, ca 1e-18
PTZ00390152 PTZ00390, PTZ00390, ubiquitin-conjugating enzyme; 6e-07
PLN00172147 PLN00172, PLN00172, ubiquitin conjugating enzyme; 8e-05
>gnl|CDD|227410 COG5078, COG5078, Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
 Score = 85.0 bits (211), Expect = 1e-22
 Identities = 34/69 (49%), Positives = 38/69 (55%), Gaps = 3/69 (4%)

Query: 7  ARGRLTEERKAWRKNHPHGFVAKPETKDGSVNLMIWECIIPGKTGTDWEGGYFPLTLYFS 66
          A  RL +E K  +K+ P G  A P   D   NL  WE  I G   T +EGG F LTL F 
Sbjct: 6  ALKRLLKELKKLQKDPPPGISAGPVDDD---NLFHWEATITGPPDTPYEGGIFKLTLEFP 62

Query: 67 EDYPSKPPK 75
          EDYP KPPK
Sbjct: 63 EDYPFKPPK 71


Length = 153

>gnl|CDD|215772 pfam00179, UQ_con, Ubiquitin-conjugating enzyme Back     alignment and domain information
>gnl|CDD|214562 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, catalytic domain homologues Back     alignment and domain information
>gnl|CDD|238117 cd00195, UBCc, Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain Back     alignment and domain information
>gnl|CDD|240397 PTZ00390, PTZ00390, ubiquitin-conjugating enzyme; Provisional Back     alignment and domain information
>gnl|CDD|177768 PLN00172, PLN00172, ubiquitin conjugating enzyme; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 100
KOG0417148 consensus Ubiquitin-protein ligase [Posttranslatio 100.0
COG5078153 Ubiquitin-protein ligase [Posttranslational modifi 100.0
KOG0419152 consensus Ubiquitin-protein ligase [Posttranslatio 99.97
PTZ00390152 ubiquitin-conjugating enzyme; Provisional 99.97
PLN00172147 ubiquitin conjugating enzyme; Provisional 99.97
KOG0418 200 consensus Ubiquitin-protein ligase [Posttranslatio 99.96
KOG0425171 consensus Ubiquitin-protein ligase [Posttranslatio 99.96
PF00179140 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IP 99.95
KOG0426165 consensus Ubiquitin-protein ligase [Posttranslatio 99.95
cd00195141 UBCc Ubiquitin-conjugating enzyme E2, catalytic (U 99.95
KOG0424158 consensus Ubiquitin-protein ligase [Posttranslatio 99.94
KOG0421175 consensus Ubiquitin-protein ligase [Posttranslatio 99.94
KOG0422153 consensus Ubiquitin-protein ligase [Posttranslatio 99.93
smart00212145 UBCc Ubiquitin-conjugating enzyme E2, catalytic do 99.93
KOG0416189 consensus Ubiquitin-protein ligase [Posttranslatio 99.9
KOG0894 244 consensus Ubiquitin-protein ligase [Posttranslatio 99.89
KOG0427161 consensus Ubiquitin conjugating enzyme [Posttransl 99.86
KOG0423 223 consensus Ubiquitin-protein ligase [Posttranslatio 99.82
KOG0420184 consensus Ubiquitin-protein ligase [Posttranslatio 99.81
KOG0428 314 consensus Non-canonical ubiquitin conjugating enzy 99.78
KOG0429 258 consensus Ubiquitin-conjugating enzyme-related pro 99.46
KOG0896138 consensus Ubiquitin-conjugating enzyme E2 [Posttra 99.42
KOG0895 1101 consensus Ubiquitin-conjugating enzyme [Posttransl 99.18
KOG0895 1101 consensus Ubiquitin-conjugating enzyme [Posttransl 99.15
PF05773113 RWD: RWD domain; InterPro: IPR006575 The RWD eukar 96.93
smart00591107 RWD domain in RING finger and WD repeat containing 96.34
PF14461133 Prok-E2_B: Prokaryotic E2 family B 95.98
PF08694161 UFC1: Ubiquitin-fold modifier-conjugating enzyme 1 94.52
PF05743121 UEV: UEV domain; InterPro: IPR008883 The N-termina 93.92
KOG0897122 consensus Predicted ubiquitin-conjugating enzyme [ 91.81
KOG3357167 consensus Uncharacterized conserved protein [Funct 90.73
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 90.41
PF14462122 Prok-E2_E: Prokaryotic E2 family E 88.57
PF14457162 Prok-E2_A: Prokaryotic E2 family A 85.4
KOG2391 365 consensus Vacuolar sorting protein/ubiquitin recep 84.0
KOG4018 215 consensus Uncharacterized conserved protein, conta 83.18
>KOG0417 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=1.2e-34  Score=192.23  Aligned_cols=80  Identities=35%  Similarity=0.595  Sum_probs=76.6

Q ss_pred             HHHHHHHHHHHHHHcCCCCeEEEeCCCCCCCCcceEEEEEeCCCCCCCCCCEEEEEEEcCCCCCCCCCeEEEecccccCC
Q 034263            7 ARGRLTEERKAWRKNHPHGFVAKPETKDGSVNLMIWECIIPGKTGTDWEGGYFPLTLYFSEDYPSKPPKWVETCHYCEAN   86 (100)
Q Consensus         7 a~~RL~~El~~l~~~~~~~~~~~~~~~~g~~~l~~w~~~i~gp~~t~y~gg~f~~~i~fp~~YP~~pP~v~f~t~i~HPn   86 (100)
                      |.+||.||+++|+++++++|++.+.++    |+++|+++|.||.+||||||+|++.|.||++||++||+|+|.|+|||||
T Consensus         2 a~~RI~kE~~~l~~dp~~~~~~~~~~d----nl~~w~a~I~GP~~SpYEgG~F~l~I~~p~~YP~~PPkV~F~TkIyHPN   77 (148)
T KOG0417|consen    2 ASKRIIKELQDLLRDPPPGCSAGPVGD----NLFHWQATILGPPGSPYEGGVFFLEIHFPEDYPFKPPKVRFLTKIYHPN   77 (148)
T ss_pred             cHHHHHHHHHHHhcCCCCCCccCCCCC----ceeeEEEEEECCCCCCcCCCEEEEEEECCCCCCCCCCceEeecccccCC
Confidence            467999999999999999999998887    9999999999999999999999999999999999999999999999999


Q ss_pred             CCCC
Q 034263           87 FSGH   90 (100)
Q Consensus        87 v~~~   90 (100)
                      |+..
T Consensus        78 I~~~   81 (148)
T KOG0417|consen   78 IDSN   81 (148)
T ss_pred             cCcc
Confidence            9954



>COG5078 Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0419 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00390 ubiquitin-conjugating enzyme; Provisional Back     alignment and domain information
>PLN00172 ubiquitin conjugating enzyme; Provisional Back     alignment and domain information
>KOG0418 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0425 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00179 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IPR000608 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] Back     alignment and domain information
>KOG0426 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00195 UBCc Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain Back     alignment and domain information
>KOG0424 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0421 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0422 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00212 UBCc Ubiquitin-conjugating enzyme E2, catalytic domain homologues Back     alignment and domain information
>KOG0416 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0894 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0427 consensus Ubiquitin conjugating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0423 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0420 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0428 consensus Non-canonical ubiquitin conjugating enzyme 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0429 consensus Ubiquitin-conjugating enzyme-related protein Ft1, involved in programmed cell death [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0896 consensus Ubiquitin-conjugating enzyme E2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0895 consensus Ubiquitin-conjugating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0895 consensus Ubiquitin-conjugating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05773 RWD: RWD domain; InterPro: IPR006575 The RWD eukaryotic domain is found in RING finger (IPR001841 from INTERPRO) and WD repeat (IPR001680 from INTERPRO) containing proteins and DEXDc-like helicase (IPR001410 from INTERPRO) subfamily related to the ubiquitin-conjugating enzymes domain (IPR000608 from INTERPRO) Back     alignment and domain information
>smart00591 RWD domain in RING finger and WD repeat containing proteins and DEXDc-like helicases subfamily related to the UBCc domain Back     alignment and domain information
>PF14461 Prok-E2_B: Prokaryotic E2 family B Back     alignment and domain information
>PF08694 UFC1: Ubiquitin-fold modifier-conjugating enzyme 1; InterPro: IPR014806 Ubiquitin-like (UBL) post-translational modifiers are covalently linked to most, if not all, target protein(s) through an enzymatic cascade analogous to ubiquitylation, consisting of E1 (activating), E2 (conjugating), and E3 (ligating) enzymes Back     alignment and domain information
>PF05743 UEV: UEV domain; InterPro: IPR008883 The N-terminal ubiquitin E2 variant (UEV) domain is ~145 amino acid residues in length and shows significant sequence similarity to E2 ubiquitin ligases but is unable to catalyze ubiquitin transfer as it lacks the active site cysteine that forms the transient thioester bond with the C terminus of ubiquitin (Ub) Back     alignment and domain information
>KOG0897 consensus Predicted ubiquitin-conjugating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3357 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF14462 Prok-E2_E: Prokaryotic E2 family E Back     alignment and domain information
>PF14457 Prok-E2_A: Prokaryotic E2 family A Back     alignment and domain information
>KOG2391 consensus Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4018 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query100
1kps_A159 Structural Basis For E2-Mediated Sumo Conjugation R 7e-23
1u9a_A160 Human Ubiquitin-Conjugating Enzyme Ubc9 Length = 16 8e-23
2o25_C160 Ubiquitin-Conjugating Enzyme E2-25 Kda Complexed Wi 8e-23
3a4s_A163 The Crystal Structure Of The Sld2:ubc9 Complex Leng 9e-23
2uyz_A158 Non-Covalent Complex Between Ubc9 And Sumo1 Length 1e-22
3uio_A158 Complex Between Human Rangap1-Sumo2, Ubc9 And The I 1e-22
2grp_A161 Crystal Structure Of Human Rangap1-Ubc9-Y87a Length 1e-22
2grr_A161 Crystal Structure Of Human Rangap1-Ubc9-D127s Lengt 1e-22
2grq_A161 Crystal Structure Of Human Rangap1-Ubc9-D127a Lengt 1e-22
1z5s_A158 Crystal Structure Of A Complex Between Ubc9, Sumo-1 1e-22
2gro_A161 Crystal Structure Of Human Rangap1-Ubc9-N85q Length 1e-22
2grn_A161 Crystal Structure Of Human Rangap1-Ubc9 Length = 16 1e-22
3ong_B159 Crystal Structure Of Uba2ufd-ubc9: Insights Into E1 2e-18
2gjd_A157 Distinct Functional Domains Of Ubc9 Dictate Cell Su 2e-18
3rcz_B163 Rad60 Sld2 Ubc9 Complex Length = 163 1e-17
2aak_A152 Ubiquitin Conjugating Enzyme From Arabidopsis Thali 1e-10
2ucz_A165 Ubiquitin Conjugating Enzyme (Ubc7) From Saccharomy 7e-09
2cyx_A170 Structure Of Human Ubiquitin-Conjugating Enzyme E2 8e-09
3fsh_A168 Crystal Structure Of The Ubiquitin Conjugating Enzy 9e-09
2kly_A167 Solution Structure Of Human Ubiquitin Conjugating E 9e-09
3h8k_A164 Crystal Structure Of Ube2g2 Complxed With The G2br 1e-08
1ayz_A169 Crystal Structure Of The Saccharomyces Cerevisiae U 8e-08
1jas_A152 Hsubc2b Length = 152 1e-07
1q34_A163 Crystal Structures Of Two Ubc (E2) Enzymes Of The U 1e-07
1z3d_A157 Protein Crystal Growth Improvement Leading To The 2 1e-07
2oxq_A152 Structure Of The Ubch5 :chip U-Box Complex Length = 3e-06
4ddg_A 399 Crystal Structure Of Human Otub1UBCH5B~UBUB Length 9e-06
2yho_B149 The Idol-Ube2d Complex Mediates Sterol-Dependent De 1e-05
2c4p_A165 Crystal Structure Of Human Ubiquitin-Conjugating En 1e-05
4ap4_B153 Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Le 1e-05
3a33_A150 Ubch5b~ubiquitin Conjugate Length = 150 2e-05
2esp_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta 2e-05
2esq_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta 2e-05
2esk_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b, Wil 3e-05
3tgd_A152 Crystal Structure Of The Human Ubiquitin-Conjugatin 3e-05
2c4o_A165 Crystal Structure Of Human Ubiquitin-Conjugating En 3e-05
2c4o_B165 Crystal Structure Of Human Ubiquitin-Conjugating En 3e-05
3eb6_B149 Structure Of The Ciap2 Ring Domain Bound To Ubch5b 3e-05
1z2u_A150 The 1.1a Crystallographic Structure Of Ubiquitin- C 4e-05
3rpg_A149 Bmi1RING1B-Ubch5c Complex Structure Length = 149 6e-05
3l1z_A157 Crystal Structure Of The U-Box Domain Of Human E4b 6e-05
3oj4_A153 Crystal Structure Of The A20 Znf4, Ubiquitin And Ub 7e-05
3ugb_A147 Ubch5c~ubiquitin Conjugate Length = 147 7e-05
1x23_A155 Crystal Structure Of Ubch5c Length = 155 7e-05
2r0j_A149 Crystal Structure Of The Putative Ubiquitin Conjuga 8e-05
3e95_A151 Crystal Structure Of The Plasmodium Falciparum Ubiq 8e-05
3l1y_A157 Crystal Structure Of Human Ubc4 E2 Conjugating Enzy 1e-04
2fuh_A146 Solution Structure Of The Ubch5cUB NON-Covalent Com 1e-04
2eso_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta 1e-04
2awf_A172 Structure Of Human Ubiquitin-Conjugating Enzyme E2 2e-04
1ur6_A147 Nmr Based Structural Model Of The Ubch5b-Cnot4 Comp 2e-04
3jvz_A146 E2~ubiquitin-Hect Length = 146 2e-04
1y6l_A149 Human Ubiquitin Conjugating Enzyme E2e2 Length = 14 2e-04
4ii2_C163 Crystal Structure Of Ubiquitin Activating Enzyme 1 2e-04
1pzv_A164 Crystal Structures Of Two Ubc (E2) Enzymes Of The U 2e-04
1yrv_A169 Novel Ubiquitin-Conjugating Enzyme Length = 169 3e-04
2f4z_A193 Toxoplasma Gondii Ubiquitin Conjugating Enzyme Tgtw 4e-04
2ayv_A166 Crystal Structure Of A Putative Ubiquitin-Conjugati 5e-04
4auq_A147 Structure Of Birc7-Ubch5b-Ub Complex. Length = 147 6e-04
2pwq_A 216 Crystal Structure Of A Putative Ubiquitin Conjugati 8e-04
>pdb|1KPS|A Chain A, Structural Basis For E2-Mediated Sumo Conjugation Revealed By A Complex Between Ubiquitin Conjugating Enzyme Ubc9 And Rangap1 Length = 159 Back     alignment and structure

Iteration: 1

Score = 102 bits (253), Expect = 7e-23, Method: Compositional matrix adjust. Identities = 48/75 (64%), Positives = 55/75 (73%), Gaps = 1/75 (1%) Query: 2 SGGGIARGRLTEERKAWRKNHPHGFVAKP-ETKDGSVNLMIWECIIPGKTGTDWEGGYFP 60 S GIA RL +ERKAWRK+HP GFVA P + DG++NLM WEC IPGK GT WEGG F Sbjct: 1 SMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFK 60 Query: 61 LTLYFSEDYPSKPPK 75 L + F +DYPS PPK Sbjct: 61 LRMLFKDDYPSSPPK 75
>pdb|1U9A|A Chain A, Human Ubiquitin-Conjugating Enzyme Ubc9 Length = 160 Back     alignment and structure
>pdb|2O25|C Chain C, Ubiquitin-Conjugating Enzyme E2-25 Kda Complexed With Sumo-1- Conjugating Enzyme Ubc9 Length = 160 Back     alignment and structure
>pdb|3A4S|A Chain A, The Crystal Structure Of The Sld2:ubc9 Complex Length = 163 Back     alignment and structure
>pdb|2UYZ|A Chain A, Non-Covalent Complex Between Ubc9 And Sumo1 Length = 158 Back     alignment and structure
>pdb|3UIO|A Chain A, Complex Between Human Rangap1-Sumo2, Ubc9 And The Ir1 Domain From Ranbp2 Containing Ir2 Motif Ii Length = 158 Back     alignment and structure
>pdb|2GRP|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-Y87a Length = 161 Back     alignment and structure
>pdb|2GRR|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-D127s Length = 161 Back     alignment and structure
>pdb|2GRQ|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-D127a Length = 161 Back     alignment and structure
>pdb|1Z5S|A Chain A, Crystal Structure Of A Complex Between Ubc9, Sumo-1, Rangap1 And Nup358RANBP2 Length = 158 Back     alignment and structure
>pdb|2GRO|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-N85q Length = 161 Back     alignment and structure
>pdb|2GRN|A Chain A, Crystal Structure Of Human Rangap1-Ubc9 Length = 161 Back     alignment and structure
>pdb|3ONG|B Chain B, Crystal Structure Of Uba2ufd-ubc9: Insights Into E1-e2 Interactions In Sumo Pathways Length = 159 Back     alignment and structure
>pdb|2GJD|A Chain A, Distinct Functional Domains Of Ubc9 Dictate Cell Survival And Resistance To Genotoxic Stress Length = 157 Back     alignment and structure
>pdb|3RCZ|B Chain B, Rad60 Sld2 Ubc9 Complex Length = 163 Back     alignment and structure
>pdb|2AAK|A Chain A, Ubiquitin Conjugating Enzyme From Arabidopsis Thaliana Length = 152 Back     alignment and structure
>pdb|2UCZ|A Chain A, Ubiquitin Conjugating Enzyme (Ubc7) From Saccharomyces Cerevisiae Length = 165 Back     alignment and structure
>pdb|2CYX|A Chain A, Structure Of Human Ubiquitin-Conjugating Enzyme E2 G2 (Ube2g2UBC7) Length = 170 Back     alignment and structure
>pdb|3FSH|A Chain A, Crystal Structure Of The Ubiquitin Conjugating Enzyme Ube2g2 Bound To The G2br Domain Of Ubiquitin Ligase Gp78 Length = 168 Back     alignment and structure
>pdb|2KLY|A Chain A, Solution Structure Of Human Ubiquitin Conjugating Enzyme Ube2g2 Length = 167 Back     alignment and structure
>pdb|3H8K|A Chain A, Crystal Structure Of Ube2g2 Complxed With The G2br Domain Of Gp78 At 1.8-A Resolution Length = 164 Back     alignment and structure
>pdb|1AYZ|A Chain A, Crystal Structure Of The Saccharomyces Cerevisiae Ubiquitin- Conjugating Enzyme Rad6 (Ubc2) At 2.6a Resolution Length = 169 Back     alignment and structure
>pdb|1JAS|A Chain A, Hsubc2b Length = 152 Back     alignment and structure
>pdb|1Q34|A Chain A, Crystal Structures Of Two Ubc (E2) Enzymes Of The Ubiquitin- Conjugating System In Caenorhabditis Elegans Length = 163 Back     alignment and structure
>pdb|1Z3D|A Chain A, Protein Crystal Growth Improvement Leading To The 2.5a Crystallographic Structure Of Ubiquitin-Conjugating Enzyme (Ubc-1) From Caenorhabditis Elegans Length = 157 Back     alignment and structure
>pdb|2OXQ|A Chain A, Structure Of The Ubch5 :chip U-Box Complex Length = 152 Back     alignment and structure
>pdb|4DDG|A Chain A, Crystal Structure Of Human Otub1UBCH5B~UBUB Length = 399 Back     alignment and structure
>pdb|2YHO|B Chain B, The Idol-Ube2d Complex Mediates Sterol-Dependent Degradation Of The Ldl Receptor Length = 149 Back     alignment and structure
>pdb|2C4P|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5a Length = 165 Back     alignment and structure
>pdb|4AP4|B Chain B, Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Length = 153 Back     alignment and structure
>pdb|3A33|A Chain A, Ubch5b~ubiquitin Conjugate Length = 150 Back     alignment and structure
>pdb|2ESP|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ile88ala Length = 149 Back     alignment and structure
>pdb|2ESQ|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ser94gly Length = 149 Back     alignment and structure
>pdb|2ESK|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b, Wild-Type Length = 149 Back     alignment and structure
>pdb|3TGD|A Chain A, Crystal Structure Of The Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Length = 152 Back     alignment and structure
>pdb|2C4O|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b Length = 165 Back     alignment and structure
>pdb|2C4O|B Chain B, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b Length = 165 Back     alignment and structure
>pdb|3EB6|B Chain B, Structure Of The Ciap2 Ring Domain Bound To Ubch5b Length = 149 Back     alignment and structure
>pdb|1Z2U|A Chain A, The 1.1a Crystallographic Structure Of Ubiquitin- Conjugating Enzyme (Ubc-2) From Caenorhabditis Elegans: Functional And Evolutionary Significance Length = 150 Back     alignment and structure
>pdb|3RPG|A Chain A, Bmi1RING1B-Ubch5c Complex Structure Length = 149 Back     alignment and structure
>pdb|3L1Z|A Chain A, Crystal Structure Of The U-Box Domain Of Human E4b Ubiquitin Ligase In Complex With Ubch5c E2 Ubiquitin Conjugating Enzyme Length = 157 Back     alignment and structure
>pdb|3OJ4|A Chain A, Crystal Structure Of The A20 Znf4, Ubiquitin And Ubch5a Complex Length = 153 Back     alignment and structure
>pdb|3UGB|A Chain A, Ubch5c~ubiquitin Conjugate Length = 147 Back     alignment and structure
>pdb|1X23|A Chain A, Crystal Structure Of Ubch5c Length = 155 Back     alignment and structure
>pdb|2R0J|A Chain A, Crystal Structure Of The Putative Ubiquitin Conjugating Enzyme, Pfe1350c, From Plasmodium Falciparum Length = 149 Back     alignment and structure
>pdb|3E95|A Chain A, Crystal Structure Of The Plasmodium Falciparum Ubiquitin Conjugating Enzyme Complex, Pfubc13-Pfuev1a Length = 151 Back     alignment and structure
>pdb|3L1Y|A Chain A, Crystal Structure Of Human Ubc4 E2 Conjugating Enzyme Length = 157 Back     alignment and structure
>pdb|2FUH|A Chain A, Solution Structure Of The Ubch5cUB NON-Covalent Complex Length = 146 Back     alignment and structure
>pdb|2ESO|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ile37ala Length = 149 Back     alignment and structure
>pdb|2AWF|A Chain A, Structure Of Human Ubiquitin-Conjugating Enzyme E2 G1 Length = 172 Back     alignment and structure
>pdb|1UR6|A Chain A, Nmr Based Structural Model Of The Ubch5b-Cnot4 Complex Length = 147 Back     alignment and structure
>pdb|3JVZ|A Chain A, E2~ubiquitin-Hect Length = 146 Back     alignment and structure
>pdb|1Y6L|A Chain A, Human Ubiquitin Conjugating Enzyme E2e2 Length = 149 Back     alignment and structure
>pdb|4II2|C Chain C, Crystal Structure Of Ubiquitin Activating Enzyme 1 (uba1) In Complex With The Ub E2 Ubc4, Ubiquitin, And Atp/mg Length = 163 Back     alignment and structure
>pdb|1PZV|A Chain A, Crystal Structures Of Two Ubc (E2) Enzymes Of The Ubiquitin- Conjugating System In Caenorhabditis Elegans Length = 164 Back     alignment and structure
>pdb|1YRV|A Chain A, Novel Ubiquitin-Conjugating Enzyme Length = 169 Back     alignment and structure
>pdb|2F4Z|A Chain A, Toxoplasma Gondii Ubiquitin Conjugating Enzyme Tgtwinscan_2721- E2 Domain Length = 193 Back     alignment and structure
>pdb|2AYV|A Chain A, Crystal Structure Of A Putative Ubiquitin-Conjugating Enzyme E2 From Toxoplasma Gondii Length = 166 Back     alignment and structure
>pdb|4AUQ|A Chain A, Structure Of Birc7-Ubch5b-Ub Complex. Length = 147 Back     alignment and structure
>pdb|2PWQ|A Chain A, Crystal Structure Of A Putative Ubiquitin Conjugating Enzyme From Plasmodium Yoelii Length = 216 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query100
2gjd_A157 Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT 3e-35
3rcz_B163 SUMO-conjugating enzyme UBC9; SUMO-like domain, pr 4e-34
2grr_A161 Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj 7e-33
2ucz_A165 UBC7, ubiquitin conjugating enzyme; ubiquitin conj 2e-31
3h8k_A164 Ubiquitin-conjugating enzyme E2 G2; alpha beta, al 2e-29
2aak_A152 UBC1, ubiquitin conjugating enzyme; ubiquitin conj 4e-29
1ayz_A169 UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin 6e-29
1yrv_A169 Ubiquitin-conjugating ligase MGC351130; structural 9e-29
2q0v_A156 Ubiquitin-conjugating enzyme E2, putative; malaria 4e-28
2h2y_A136 Ubiquitin-conjugating enzyme; structural genomics, 3e-23
2a7l_A136 Hypothetical ubiquitin-conjugating enzyme LOC55284 4e-23
3rz3_A183 Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj 1e-21
2fo3_A125 Ubiquitin-conjugating enzyme; SGC, UBC, structural 3e-21
2a4d_A160 Ubiquitin-conjugating enzyme E2 variant 1; alterna 1e-20
2awf_A172 Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co 2e-20
1jat_B138 Ubiquitin-conjugating enzyme variant MMS2; UEV, li 3e-20
2hlw_A170 Ubiquitin-conjugating enzyme E2 variant 1; ubiquit 5e-19
2e2c_A156 Ubiquitin conjugating enzyme; ubiquitin conjugatio 1e-17
2f4w_A187 Ubiquitin-conjugating enzyme E2, J2; endoplasmic r 6e-16
4ddg_A 399 Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI 8e-16
2c4o_A165 Ubiquitin-conjugating enzyme E2 D2; thioesterifica 9e-16
3ceg_A 323 Baculoviral IAP repeat-containing protein 6; apopt 9e-16
1i7k_A179 Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A 1e-15
1z2u_A150 Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro 1e-15
1fxt_A149 Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM 3e-15
2y9m_A172 Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra 4e-15
2ayv_A166 Ubiquitin-conjugating enzyme E2; structural genomi 4e-15
1zdn_A158 Ubiquitin-conjugating enzyme E2S; structural genom 5e-15
2c2v_B154 Ubiquitin-conjugating enzyme E2 N; chaperone, heat 6e-15
1tte_A 215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 7e-15
1yh2_A169 HSPC150 protein similar to ubiquitin-conjugating e 9e-15
3bzh_A194 Ubiquitin-conjugating enzyme E2 E1; structural gen 1e-14
1jat_A155 Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig 1e-14
2r0j_A149 Ubiquitin carrier protein; ubiquitin conjugating, 1e-14
2pwq_A 216 Ubiquitin conjugating enzyme; structural genomics 6e-14
1wzv_A155 Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A 8e-14
2bep_A159 Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 8e-14
1c4z_D154 UBCH7, ubiquitin conjugating enzyme E2; bilobal st 1e-13
2f4z_A193 Tgtwinscan_2721 - E2 domain; ubiquitin conjugating 1e-12
3k9o_A 201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 1e-12
3fn1_B167 NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin 1e-12
2z5d_A179 Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig 2e-12
2onu_A152 Ubiquitin-conjugating enzyme, putative; UBC, plasm 2e-12
4ds2_A167 Ubiquitin-conjugating enzyme E2, putative; structu 6e-12
3o2u_A190 NEDD8-conjugating enzyme UBC12; E2 conjugase, liga 6e-12
3e46_A 253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 1e-11
2nvu_C180 NEDD8-conjugating enzyme UBC12; multifunction macr 1e-11
1yf9_A171 Ubiquitin carrier protein 4; SGPP, structural geno 4e-10
1y8x_A160 Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju 9e-10
1zuo_A186 Hypothetical protein LOC92912; ligase, ubiquitin-c 2e-08
>2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Length = 157 Back     alignment and structure
 Score =  116 bits (293), Expect = 3e-35
 Identities = 42/76 (55%), Positives = 53/76 (69%), Gaps = 3/76 (3%)

Query: 1  MSGGGIARGRLTEERKAWRKNHPHGFVAKP-ETKDGSVNLMIWECIIPGKTGTDWEGGYF 59
          MS   +   RL EERK WRK+HP GF AKP +  DGS++L  WE  IPGK GT+W GG +
Sbjct: 1  MSS--LCLQRLQEERKKWRKDHPFGFYAKPVKKADGSMDLQKWEAGIPGKEGTNWAGGVY 58

Query: 60 PLTLYFSEDYPSKPPK 75
          P+T+ +  +YPSKPPK
Sbjct: 59 PITVEYPNEYPSKPPK 74


>3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} Length = 163 Back     alignment and structure
>2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Length = 161 Back     alignment and structure
>2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 165 Back     alignment and structure
>3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} PDB: 3fsh_A 2cyx_A 2kly_A Length = 164 Back     alignment and structure
>2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Length = 152 Back     alignment and structure
>1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Length = 156 Back     alignment and structure
>2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} Length = 136 Back     alignment and structure
>2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 Length = 136 Back     alignment and structure
>3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Length = 183 Back     alignment and structure
>2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 Length = 125 Back     alignment and structure
>2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Length = 160 Back     alignment and structure
>2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Length = 172 Back     alignment and structure
>1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Length = 138 Back     alignment and structure
>2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} Length = 170 Back     alignment and structure
>2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Length = 156 Back     alignment and structure
>2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 187 Back     alignment and structure
>4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Length = 399 Back     alignment and structure
>2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Length = 165 Back     alignment and structure
>3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} Length = 323 Back     alignment and structure
>1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Length = 179 Back     alignment and structure
>1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Length = 150 Back     alignment and structure
>1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Length = 149 Back     alignment and structure
>2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Length = 172 Back     alignment and structure
>2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 166 Back     alignment and structure
>1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Length = 158 Back     alignment and structure
>2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Length = 154 Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Length = 215 Back     alignment and structure
>1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Length = 194 Back     alignment and structure
>1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Length = 155 Back     alignment and structure
>2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Length = 149 Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Length = 216 Back     alignment and structure
>1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Length = 155 Back     alignment and structure
>2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Length = 159 Back     alignment and structure
>1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Length = 154 Back     alignment and structure
>2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 193 Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Length = 201 Back     alignment and structure
>3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Length = 167 Back     alignment and structure
>2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Length = 179 Back     alignment and structure
>2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Length = 152 Back     alignment and structure
>4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Length = 167 Back     alignment and structure
>3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Length = 190 Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Length = 253 Back     alignment and structure
>2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Length = 180 Back     alignment and structure
>1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Length = 171 Back     alignment and structure
>1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Length = 160 Back     alignment and structure
>1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A Length = 186 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query100
2ucz_A165 UBC7, ubiquitin conjugating enzyme; ubiquitin conj 100.0
1ayz_A169 UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin 100.0
2aak_A152 UBC1, ubiquitin conjugating enzyme; ubiquitin conj 99.98
1yrv_A169 Ubiquitin-conjugating ligase MGC351130; structural 99.98
1zdn_A158 Ubiquitin-conjugating enzyme E2S; structural genom 99.98
1jat_B138 Ubiquitin-conjugating enzyme variant MMS2; UEV, li 99.98
2bep_A159 Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 99.98
2fo3_A125 Ubiquitin-conjugating enzyme; SGC, UBC, structural 99.98
2gjd_A157 Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT 99.97
2c2v_B154 Ubiquitin-conjugating enzyme E2 N; chaperone, heat 99.97
4gpr_A151 Ubiquitin-conjugating enzyme family protein; ubiqu 99.97
3rz3_A183 Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj 99.97
3h8k_A164 Ubiquitin-conjugating enzyme E2 G2; alpha beta, al 99.97
3rcz_B163 SUMO-conjugating enzyme UBC9; SUMO-like domain, pr 99.97
2pwq_A 216 Ubiquitin conjugating enzyme; structural genomics 99.97
2e2c_A156 Ubiquitin conjugating enzyme; ubiquitin conjugatio 99.97
1fxt_A149 Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM 99.97
3k9o_A 201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 99.97
1z2u_A150 Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro 99.97
1yh2_A169 HSPC150 protein similar to ubiquitin-conjugating e 99.97
2h2y_A136 Ubiquitin-conjugating enzyme; structural genomics, 99.97
2grr_A161 Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj 99.97
2ayv_A166 Ubiquitin-conjugating enzyme E2; structural genomi 99.97
1i7k_A179 Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A 99.97
2awf_A172 Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co 99.97
2c4o_A165 Ubiquitin-conjugating enzyme E2 D2; thioesterifica 99.97
2a7l_A136 Hypothetical ubiquitin-conjugating enzyme LOC55284 99.97
1jat_A155 Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig 99.97
2r0j_A149 Ubiquitin carrier protein; ubiquitin conjugating, 99.97
2a4d_A160 Ubiquitin-conjugating enzyme E2 variant 1; alterna 99.97
3e46_A 253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 99.97
2f4z_A193 Tgtwinscan_2721 - E2 domain; ubiquitin conjugating 99.97
3bzh_A194 Ubiquitin-conjugating enzyme E2 E1; structural gen 99.97
2q0v_A156 Ubiquitin-conjugating enzyme E2, putative; malaria 99.97
2y9m_A172 Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra 99.97
1tte_A 215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 99.96
1wzv_A155 Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A 99.96
4ds2_A167 Ubiquitin-conjugating enzyme E2, putative; structu 99.96
2hlw_A170 Ubiquitin-conjugating enzyme E2 variant 1; ubiquit 99.96
2z5d_A179 Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig 99.96
3fn1_B167 NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin 99.96
2onu_A152 Ubiquitin-conjugating enzyme, putative; UBC, plasm 99.96
1c4z_D154 UBCH7, ubiquitin conjugating enzyme E2; bilobal st 99.96
1y8x_A160 Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju 99.96
1yf9_A171 Ubiquitin carrier protein 4; SGPP, structural geno 99.96
4ddg_A 399 Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI 99.96
2nvu_C180 NEDD8-conjugating enzyme UBC12; multifunction macr 99.95
2f4w_A187 Ubiquitin-conjugating enzyme E2, J2; endoplasmic r 99.94
1zuo_A186 Hypothetical protein LOC92912; ligase, ubiquitin-c 99.94
3ceg_A 323 Baculoviral IAP repeat-containing protein 6; apopt 99.94
3o2u_A190 NEDD8-conjugating enzyme UBC12; E2 conjugase, liga 99.94
2z6o_A172 UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, p 99.85
3kpa_A168 Probable ubiquitin fold modifier conjugating ENZY; 99.42
3r3q_A162 Suppressor protein STP22 of temperature-sensitive 99.18
3obq_A146 Tumor susceptibility gene 101 protein; protein tra 98.68
2ebm_A128 RWD domain-containing protein 1; alpha+beta sandwi 96.93
2day_A128 Ring finger protein 25; ligase, metal-binding, UB1 96.28
2yz0_A138 Serine/threonine-protein kinase GCN2; A-B-B-B-B-A- 96.17
2ebk_A128 RWD domain-containing protein 3; alpha+beta sandwi 94.69
1ukx_A137 GCN2, GCN2 EIF2alpha kinase; UBC-like fold, triple 94.58
2daw_A154 RWD domain containing protein 2; alpha+beta sandwi 93.43
2dax_A152 Protein C21ORF6; RWD domain, alpha+beta sandwich f 92.52
3zqs_A 186 E3 ubiquitin-protein ligase fancl; HET: P6G; 2.00A 88.24
>2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Back     alignment and structure
Probab=100.00  E-value=2.1e-32  Score=185.16  Aligned_cols=85  Identities=36%  Similarity=0.649  Sum_probs=80.1

Q ss_pred             CCchhHHHHHHHHHHHHHHHcCCCCeEEEeCCCCCCCCcceEEEEEeCCCCCCCCCCEEEEEEEcCCCCCCCCCeEEEec
Q 034263            1 MSGGGIARGRLTEERKAWRKNHPHGFVAKPETKDGSVNLMIWECIIPGKTGTDWEGGYFPLTLYFSEDYPSKPPKWVETC   80 (100)
Q Consensus         1 Ms~~~~a~~RL~~El~~l~~~~~~~~~~~~~~~~g~~~l~~w~~~i~gp~~t~y~gg~f~~~i~fp~~YP~~pP~v~f~t   80 (100)
                      ||  +.|.+||++|+++|++++++++++.+.+++   |+++|+++|.||++|||+||+|+++|.||++||++||+|+|.|
T Consensus         1 M~--~~a~~RL~kEl~~l~~~~~~gi~~~~~~~~---~l~~w~~~i~GP~~tpYegg~f~~~i~fp~~YP~~PP~v~f~t   75 (165)
T 2ucz_A            1 MS--KTAQKRLLKELQQLIKDSPPGIVAGPKSEN---NIFIWDCLIQGPPDTPYADGVFNAKLEFPKDYPLSPPKLTFTP   75 (165)
T ss_dssp             -C--HHHHHHHHHHHHHHHHSCCTTEEEEESSSS---CCSEEEEEEECCTTSTTTTCEEEEEEECCTTTTTSCCEEEESS
T ss_pred             CC--hHHHHHHHHHHHHHHhCCCCCEEEEECCCC---CccEEEEEEECCCCCCccCcEEEEEEECCccCCCCCCEEEEeC
Confidence            88  789999999999999999999999987643   9999999999999999999999999999999999999999999


Q ss_pred             ccccCCCCCC
Q 034263           81 HYCEANFSGH   90 (100)
Q Consensus        81 ~i~HPnv~~~   90 (100)
                      ++|||||+..
T Consensus        76 ~i~HPNv~~~   85 (165)
T 2ucz_A           76 SILHPNIYPN   85 (165)
T ss_dssp             CCSCTTBCTT
T ss_pred             CCccCCCCCC
Confidence            9999999875



>1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Back     alignment and structure
>2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Back     alignment and structure
>1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Back     alignment and structure
>2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Back     alignment and structure
>2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 Back     alignment and structure
>2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Back     alignment and structure
>2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>4gpr_A Ubiquitin-conjugating enzyme family protein; ubiquitin conjugation, EHU ehring1, thiol esterification, ligase; 1.60A {Entamoeba histolytica} Back     alignment and structure
>3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Back     alignment and structure
>3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 3fsh_A 2cyx_A 2kly_A Back     alignment and structure
>3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} SCOP: d.20.1.1 Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Back     alignment and structure
>2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Back     alignment and structure
>1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Back     alignment and structure
>1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Back     alignment and structure
>1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} Back     alignment and structure
>2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Back     alignment and structure
>2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Back     alignment and structure
>1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Back     alignment and structure
>2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Back     alignment and structure
>2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Back     alignment and structure
>2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Back     alignment and structure
>2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Back     alignment and structure
>2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Back     alignment and structure
>3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Back     alignment and structure
>2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Back     alignment and structure
>2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Back     alignment and structure
>1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Back     alignment and structure
>4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Back     alignment and structure
>2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Back     alignment and structure
>3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Back     alignment and structure
>2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Back     alignment and structure
>1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Back     alignment and structure
>1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Back     alignment and structure
>4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Back     alignment and structure
>2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A Back     alignment and structure
>3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} Back     alignment and structure
>3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Back     alignment and structure
>2z6o_A UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, polymorphism, UBL conjugation pathway, ligase; 1.60A {Homo sapiens} PDB: 2z6p_A 1ywz_A 2in1_A 2k07_A 3e2g_A 3evx_A Back     alignment and structure
>3kpa_A Probable ubiquitin fold modifier conjugating ENZY; UBL conjugation pathway, ligase, structural genomics, PSI; 2.20A {Leishmania major} SCOP: d.20.1.4 Back     alignment and structure
>3r3q_A Suppressor protein STP22 of temperature-sensitive factor receptor and arginine permease...; endosomal sorting, ESCRT-I; 1.45A {Saccharomyces cerevisiae} SCOP: d.20.1.2 PDB: 3r42_A 1uzx_A* Back     alignment and structure
>3obq_A Tumor susceptibility gene 101 protein; protein transprot, ubiquitin binding, protein transport; 1.40A {Homo sapiens} SCOP: d.20.1.2 PDB: 3obs_A 3obu_A 3obx_A 3p9g_A* 3p9h_A* 2f0r_A 1kpp_A 1kpq_A 1m4p_A 1m4q_A 1s1q_A Back     alignment and structure
>2ebm_A RWD domain-containing protein 1; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2day_A Ring finger protein 25; ligase, metal-binding, UB1 conjugation, UB1 conjugation pathway, RWD domain, alpha+beta sandwich fold, structural genomics; NMR {Homo sapiens} SCOP: d.20.1.3 PDB: 2dmf_A Back     alignment and structure
>2yz0_A Serine/threonine-protein kinase GCN2; A-B-B-B-B-A-A, amino acid starvation signal response, EIF2alpha kinase, transferase; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ebk_A RWD domain-containing protein 3; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ukx_A GCN2, GCN2 EIF2alpha kinase; UBC-like fold, triple beta-turns, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.20.1.3 Back     alignment and structure
>2daw_A RWD domain containing protein 2; alpha+beta sandwich fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.20.1.3 Back     alignment and structure
>2dax_A Protein C21ORF6; RWD domain, alpha+beta sandwich fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.20.1.3 Back     alignment and structure
>3zqs_A E3 ubiquitin-protein ligase fancl; HET: P6G; 2.00A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 100
d2uyza1156 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, U 3e-21
d1yrva1148 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, U 1e-13
d2a4da1139 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, 1e-13
d1ayza_153 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 5e-13
d2ucza_164 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 7e-12
d1jatb_136 d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {B 1e-11
d2e2ca_156 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {C 1e-11
d1pzva_161 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {N 2e-11
d1z2ua1147 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, U 2e-11
d1z3da1149 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, U 1e-10
d2awfa1125 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, U 1e-10
d2a7la1117 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 1e-10
d2bepa1154 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2 3e-10
d1y6la_148 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {H 3e-10
d2fo3a1109 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating 4e-10
d2f4wa1157 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, 2e-09
d2f4za1161 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinsca 2e-09
d1j7db_149 d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {H 3e-09
d1jata_152 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 4e-09
d1fzya_149 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 6e-09
d1wzva1150 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, U 6e-09
d1i7ka_146 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {H 1e-08
d1c4zd_144 d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {H 1e-08
d2z5da1152 d.20.1.1 (A:23-174) Ubiquitin conjugating enzyme, 7e-08
d1yh2a1154 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, U 2e-07
d1zdna1151 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, U 1e-06
d1y8xa1157 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, 2e-06
d1yf9a1158 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, 2e-06
d1s1qa_141 d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG10 2e-05
>d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Length = 156 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: UBC-like
superfamily: UBC-like
family: UBC-related
domain: Ubiquitin conjugating enzyme, UBC
species: Human (Homo sapiens), ubc9 [TaxId: 9606]
 Score = 79.8 bits (196), Expect = 3e-21
 Identities = 48/87 (55%), Positives = 55/87 (63%), Gaps = 1/87 (1%)

Query: 5  GIARGRLTEERKAWRKNHPHGFVAKP-ETKDGSVNLMIWECIIPGKTGTDWEGGYFPLTL 63
          GIA  RL +ERKAWRK+HP GFVA P +  DG++NLM WEC IPGK GT WEGG F L +
Sbjct: 1  GIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRM 60

Query: 64 YFSEDYPSKPPKWVETCHYCEANFSGH 90
           F +DYPS PPK          N    
Sbjct: 61 LFKDDYPSSPPKCKFEPPLFHPNVYPS 87


>d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Length = 148 Back     information, alignment and structure
>d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} Length = 153 Back     information, alignment and structure
>d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Length = 164 Back     information, alignment and structure
>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Length = 136 Back     information, alignment and structure
>d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Length = 156 Back     information, alignment and structure
>d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Length = 161 Back     information, alignment and structure
>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Length = 147 Back     information, alignment and structure
>d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} Length = 149 Back     information, alignment and structure
>d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Length = 154 Back     information, alignment and structure
>d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} Length = 148 Back     information, alignment and structure
>d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Length = 109 Back     information, alignment and structure
>d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} Length = 157 Back     information, alignment and structure
>d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Length = 161 Back     information, alignment and structure
>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Length = 152 Back     information, alignment and structure
>d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Length = 149 Back     information, alignment and structure
>d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} Length = 146 Back     information, alignment and structure
>d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} Length = 144 Back     information, alignment and structure
>d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Length = 151 Back     information, alignment and structure
>d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Length = 157 Back     information, alignment and structure
>d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Length = 158 Back     information, alignment and structure
>d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query100
d1yrva1148 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.98
d2ucza_164 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.97
d1yh2a1154 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.97
d1y6la_148 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.97
d2bepa1154 Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain 99.97
d1z2ua1147 Ubiquitin conjugating enzyme, UBC {Caenorhabditis 99.97
d1z3da1149 Ubiquitin conjugating enzyme, UBC {Nematode (Caeno 99.97
d1ayza_153 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.97
d2e2ca_156 Ubiquitin conjugating enzyme, UBC {Clam (Spisula s 99.97
d1zdna1151 Ubiquitin conjugating enzyme, UBC {Human(Homo sapi 99.97
d2a7la1117 Ubiquitin-protein ligase W (E2 W) {Human (Homo sap 99.97
d2uyza1156 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.97
d1fzya_149 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.97
d1jata_152 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.97
d2a4da1139 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.97
d1i7ka_146 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.97
d2awfa1125 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.97
d1j7db_149 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.97
d2f4wa1157 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.97
d2fo3a1109 Putative ubiquitin-conjugating enzyme, E2 domain { 99.96
d1pzva_161 Ubiquitin conjugating enzyme, UBC {Nematode (Caeno 99.96
d1wzva1150 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.96
d1jatb_136 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.96
d1c4zd_144 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.96
d2f4za1161 Hypothetical protein Tgtwinscan_2721, E2 domain {T 99.96
d2z5da1152 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.95
d1y8xa1157 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.94
d1yf9a1158 Ubiquitin conjugating enzyme, UBC {Leishmania majo 99.94
d1zuoa1162 Ubiquitin-conjugating enzyme E2 Q2, C-terminal dom 99.92
d1s1qa_141 Tumor susceptibility gene 101 (TSG101) {Human (Hom 99.54
d1uzxa_152 Vacuolar protein sorting-associated {Baker's yeast 99.19
d2daya1115 E3 ubiquitin-protein ligase RNF25 {Human (Homo sap 96.69
d2in1a1162 Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapie 94.89
d1ukxa_137 EIF2-alpha kinase 4 (GCN2-like protein) {Mouse (Mu 92.79
d2daxa1140 Uncharacterized protein C21orf6 {Human (Homo sapie 91.92
d2dawa1141 RWD domain-containing protein 2 {Human (Homo sapie 91.58
>d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: UBC-like
superfamily: UBC-like
family: UBC-related
domain: Ubiquitin conjugating enzyme, UBC
species: Human (Homo sapiens), E2 U [TaxId: 9606]
Probab=99.98  E-value=2.8e-32  Score=180.41  Aligned_cols=87  Identities=30%  Similarity=0.456  Sum_probs=83.8

Q ss_pred             CCchhHHHHHHHHHHHHHHHcCCCCeEEEeCCCCCCCCcceEEEEEeCCCCCCCCCCEEEEEEEcCCCCCCCCCeEEEec
Q 034263            1 MSGGGIARGRLTEERKAWRKNHPHGFVAKPETKDGSVNLMIWECIIPGKTGTDWEGGYFPLTLYFSEDYPSKPPKWVETC   80 (100)
Q Consensus         1 Ms~~~~a~~RL~~El~~l~~~~~~~~~~~~~~~~g~~~l~~w~~~i~gp~~t~y~gg~f~~~i~fp~~YP~~pP~v~f~t   80 (100)
                      |+  +.|.+||+||+++|++++++|+++.+.++    |+++|.++|.||++|||+||+|+++|.||++||++||+|+|.|
T Consensus         1 m~--~~a~~~L~kE~~~l~~~~~~gi~v~p~~~----n~~~W~~~i~Gp~~t~yegg~f~~~i~fp~~YP~~pP~v~f~t   74 (148)
T d1yrva1           1 MH--GRAYLLLHRDFCDLKENNYKGITAKPVSE----DMMEWEVEIEGLQNSVWQGLVFQLTIHFTSEYNYAPPVVKFIT   74 (148)
T ss_dssp             GG--CHHHHHHHHHHHHHHHHCCTTEEEEECST----TSCEEEEEEECCTTSTTTTCEEEEEEECCTTBTTBCCEEEESS
T ss_pred             CC--HHHHHHHHHHHHHHHHCCCCCEEEEECCC----cccEEEEEEEeCCCCccCCCceEEEEEeccccccCCceeeecc
Confidence            77  78999999999999999999999999998    9999999999999999999999999999999999999999999


Q ss_pred             ccccCCCCCCCCC
Q 034263           81 HYCEANFSGHSGF   93 (100)
Q Consensus        81 ~i~HPnv~~~~g~   93 (100)
                      ++|||||+.++|.
T Consensus        75 ~i~HpnV~~~~G~   87 (148)
T d1yrva1          75 IPFHPNVDPHTGQ   87 (148)
T ss_dssp             CCCCTTBCTTTCC
T ss_pred             ccccCceecCccc
Confidence            9999999988774



>d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Back     information, alignment and structure
>d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Back     information, alignment and structure
>d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} Back     information, alignment and structure
>d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Back     information, alignment and structure
>d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} Back     information, alignment and structure
>d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} Back     information, alignment and structure
>d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Back     information, alignment and structure
>d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Back     information, alignment and structure
>d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Back     information, alignment and structure
>d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Back     information, alignment and structure
>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Back     information, alignment and structure
>d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Back     information, alignment and structure
>d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} Back     information, alignment and structure
>d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} Back     information, alignment and structure
>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Back     information, alignment and structure
>d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} Back     information, alignment and structure
>d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Back     information, alignment and structure
>d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Back     information, alignment and structure
>d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} Back     information, alignment and structure
>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Back     information, alignment and structure
>d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} Back     information, alignment and structure
>d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Back     information, alignment and structure
>d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2daya1 d.20.1.3 (A:8-122) E3 ubiquitin-protein ligase RNF25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2in1a1 d.20.1.4 (A:3-164) Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukxa_ d.20.1.3 (A:) EIF2-alpha kinase 4 (GCN2-like protein) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2daxa1 d.20.1.3 (A:8-147) Uncharacterized protein C21orf6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dawa1 d.20.1.3 (A:8-148) RWD domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure