Citrus Sinensis ID: 034290
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 99 | ||||||
| 409168205 | 122 | autophagy 8c [Petunia x hybrida] | 0.858 | 0.696 | 0.825 | 7e-33 | |
| 351727823 | 122 | uncharacterized protein LOC100499835 [Gl | 0.858 | 0.696 | 0.813 | 2e-32 | |
| 356540577 | 123 | PREDICTED: autophagy-related protein 8f- | 0.858 | 0.691 | 0.813 | 2e-32 | |
| 356497149 | 123 | PREDICTED: autophagy-related protein 8f- | 0.858 | 0.691 | 0.813 | 3e-32 | |
| 357476885 | 122 | Autophagy-related protein 8f [Medicago t | 0.858 | 0.696 | 0.813 | 3e-32 | |
| 21615419 | 121 | microtubule associated protein [Cicer ar | 0.858 | 0.702 | 0.813 | 3e-32 | |
| 388516607 | 122 | unknown [Lotus japonicus] | 0.858 | 0.696 | 0.813 | 3e-32 | |
| 359806567 | 122 | uncharacterized protein LOC100818620 [Gl | 0.858 | 0.696 | 0.813 | 3e-32 | |
| 350540670 | 122 | autophagy 8f [Solanum lycopersicum] gi|3 | 0.858 | 0.696 | 0.802 | 4e-32 | |
| 301601262 | 122 | autophagy 8 [Ipomoea nil] | 0.858 | 0.696 | 0.813 | 4e-32 |
| >gi|409168205|dbj|BAM62966.1| autophagy 8c [Petunia x hybrida] | Back alignment and taxonomy information |
|---|
Score = 144 bits (363), Expect = 7e-33, Method: Compositional matrix adjust.
Identities = 71/86 (82%), Positives = 75/86 (87%), Gaps = 1/86 (1%)
Query: 14 ICMNSHKFYIPTCLQCCRYLVPADLTVGQFVYVIRKRIKLSAEKAIFIFVDNVLPPTGAI 73
I + K IP + +YLVPADLTVGQFVYVIRKRIKLSAEKAIFIFVDNVLPPTGAI
Sbjct: 33 IVEKAEKSDIPN-IDKKKYLVPADLTVGQFVYVIRKRIKLSAEKAIFIFVDNVLPPTGAI 91
Query: 74 MSTIYDEKKDEDGFLYVTYSGENTFG 99
MS+IYDEKKDEDGFLYVTYSGENTFG
Sbjct: 92 MSSIYDEKKDEDGFLYVTYSGENTFG 117
|
Source: Petunia x hybrida Species: Petunia x hybrida Genus: Petunia Family: Solanaceae Order: Solanales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|351727823|ref|NP_001236662.1| uncharacterized protein LOC100499835 [Glycine max] gi|255627035|gb|ACU13862.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356540577|ref|XP_003538764.1| PREDICTED: autophagy-related protein 8f-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356497149|ref|XP_003517425.1| PREDICTED: autophagy-related protein 8f-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357476885|ref|XP_003608728.1| Autophagy-related protein 8f [Medicago truncatula] gi|355509783|gb|AES90925.1| Autophagy-related protein 8f [Medicago truncatula] gi|388516669|gb|AFK46396.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|21615419|emb|CAD33929.1| microtubule associated protein [Cicer arietinum] | Back alignment and taxonomy information |
|---|
| >gi|388516607|gb|AFK46365.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|359806567|ref|NP_001241265.1| uncharacterized protein LOC100818620 [Glycine max] gi|255638500|gb|ACU19559.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|350540670|ref|NP_001234634.1| autophagy 8f [Solanum lycopersicum] gi|324029062|gb|ADY16678.1| autophagy 8f [Solanum lycopersicum] | Back alignment and taxonomy information |
|---|
| >gi|301601262|dbj|BAJ13303.1| autophagy 8 [Ipomoea nil] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 99 | ||||||
| TAIR|locus:2101816 | 121 | ATG8G "AUTOPHAGY 8G" [Arabidop | 0.858 | 0.702 | 0.802 | 1.4e-30 | |
| TAIR|locus:2130759 | 121 | ATG8F "AT4G16520" [Arabidopsis | 0.858 | 0.702 | 0.779 | 1.8e-30 | |
| TAIR|locus:2055537 | 122 | ATG8E "AUTOPHAGY 8E" [Arabidop | 0.696 | 0.565 | 0.869 | 1.6e-29 | |
| ASPGD|ASPL0000029812 | 118 | atgH [Emericella nidulans (tax | 0.858 | 0.720 | 0.755 | 9.1e-29 | |
| POMBASE|SPBP8B7.24c | 121 | atg8 "autophagy associated pro | 0.696 | 0.570 | 0.826 | 1.3e-27 | |
| TAIR|locus:2058939 | 164 | ATG8D [Arabidopsis thaliana (t | 0.696 | 0.420 | 0.840 | 1.7e-27 | |
| TAIR|locus:2120618 | 137 | APG8A "AT4G21980" [Arabidopsis | 0.696 | 0.503 | 0.826 | 2.2e-27 | |
| TAIR|locus:2125791 | 122 | ATG8B "AT4G04620" [Arabidopsis | 0.696 | 0.565 | 0.811 | 2.8e-27 | |
| UNIPROTKB|Q51MW4 | 123 | ATG8 "Autophagy-related protei | 0.858 | 0.691 | 0.720 | 5.7e-27 | |
| CGD|CAF0006954 | 135 | AUT7 [Candida albicans (taxid: | 0.858 | 0.629 | 0.697 | 1.2e-26 |
| TAIR|locus:2101816 ATG8G "AUTOPHAGY 8G" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 337 (123.7 bits), Expect = 1.4e-30, P = 1.4e-30
Identities = 69/86 (80%), Positives = 74/86 (86%)
Query: 14 ICMNSHKFYIPTCLQCCRYLVPADLTVGQFVYVIRKRIKLSAEKAIFIFVDNVLPPTGAI 73
I S K IP + +YLVPADLTVGQFVYVIRKRI+LSAEKAIFIFVDNVLPPTGA+
Sbjct: 33 IVEKSEKSDIPN-IDKKKYLVPADLTVGQFVYVIRKRIQLSAEKAIFIFVDNVLPPTGAM 91
Query: 74 MSTIYDEKKDEDGFLYVTYSGENTFG 99
MSTIYDE K+EDGFLYVTYSGENTFG
Sbjct: 92 MSTIYDENKEEDGFLYVTYSGENTFG 117
|
|
| TAIR|locus:2130759 ATG8F "AT4G16520" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2055537 ATG8E "AUTOPHAGY 8E" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000029812 atgH [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBP8B7.24c atg8 "autophagy associated protein Atg8" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2058939 ATG8D [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2120618 APG8A "AT4G21980" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2125791 ATG8B "AT4G04620" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q51MW4 ATG8 "Autophagy-related protein 8" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| CGD|CAF0006954 AUT7 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 99 | |||
| cd01611 | 112 | cd01611, GABARAP, Ubiquitin domain of GABA-recepto | 1e-42 | |
| pfam02991 | 104 | pfam02991, Atg8, Autophagy protein Atg8 ubiquitin | 6e-41 | |
| PTZ00380 | 121 | PTZ00380, PTZ00380, microtubule-associated protein | 6e-06 |
| >gnl|CDD|176355 cd01611, GABARAP, Ubiquitin domain of GABA-receptor-associated protein | Back alignment and domain information |
|---|
Score = 134 bits (339), Expect = 1e-42
Identities = 50/70 (71%), Positives = 60/70 (85%)
Query: 30 CRYLVPADLTVGQFVYVIRKRIKLSAEKAIFIFVDNVLPPTGAIMSTIYDEKKDEDGFLY 89
+YLVP+DLTVGQFVY+IRKRI+L EKA+F+FV+N LPPT A MS +Y+E KDEDGFLY
Sbjct: 43 KKYLVPSDLTVGQFVYIIRKRIQLRPEKALFLFVNNSLPPTSATMSQLYEEHKDEDGFLY 102
Query: 90 VTYSGENTFG 99
+TYS E TFG
Sbjct: 103 MTYSSEETFG 112
|
GABARAP (GABA-receptor-associated protein) belongs ot a large family of proteins that mediate intracellular membrane trafficking and/or fusion. GABARAP binds not only to GABA, type A but also to tubulin, gephrin, and ULK1. Orthologues of GABARAP include Gate-16 (golgi-associated ATPase enhancer), LC3 (microtubule-associated protein light chain 3), and ATG8 (autophagy protein 8). ATG8 is a ubiquitin-like protein that is conjugated to the membrane phospholipid, phosphatidylethanolamine as part of a ubiquitin-like conjugation system essential for autophagosome-formation. Length = 112 |
| >gnl|CDD|111837 pfam02991, Atg8, Autophagy protein Atg8 ubiquitin like | Back alignment and domain information |
|---|
| >gnl|CDD|173572 PTZ00380, PTZ00380, microtubule-associated protein (MAP); Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 99 | |||
| PF02991 | 104 | Atg8: Autophagy protein Atg8 ubiquitin like; Inter | 100.0 | |
| KOG1654 | 116 | consensus Microtubule-associated anchor protein in | 100.0 | |
| cd01611 | 112 | GABARAP Ubiquitin domain of GABA-receptor-associat | 100.0 | |
| PTZ00380 | 121 | microtubule-associated protein (MAP); Provisional | 100.0 | |
| cd01612 | 87 | APG12_C Ubiquitin-like domain of APG12. APG12_C Th | 100.0 | |
| PF04110 | 87 | APG12: Ubiquitin-like autophagy protein Apg12 ; In | 99.89 | |
| KOG3439 | 116 | consensus Protein conjugation factor involved in a | 99.89 | |
| PF04106 | 197 | APG5: Autophagy protein Apg5 ; InterPro: IPR007239 | 95.92 | |
| PF11816 | 331 | DUF3337: Domain of unknown function (DUF3337); Int | 95.64 | |
| PF11976 | 72 | Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter | 94.45 | |
| cd06406 | 80 | PB1_P67 A PB1 domain is present in p67 proteins wh | 91.6 | |
| PF00240 | 69 | ubiquitin: Ubiquitin family; InterPro: IPR000626 U | 90.3 | |
| smart00213 | 64 | UBQ Ubiquitin homologues. Ubiquitin-mediated prote | 90.19 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 89.63 | |
| cd00196 | 69 | UBQ Ubiquitin-like proteins. Ubiquitin homologs; I | 87.21 | |
| PF03671 | 76 | Ufm1: Ubiquitin fold modifier 1 protein; InterPro: | 86.99 | |
| PF10302 | 97 | DUF2407: DUF2407 ubiquitin-like domain; InterPro: | 86.93 | |
| PF13019 | 162 | Telomere_Sde2: Telomere stability and silencing | 86.05 | |
| cd01763 | 87 | Sumo Small ubiquitin-related modifier (SUMO). Smal | 83.65 | |
| KOG2976 | 278 | consensus Protein involved in autophagy and nutrie | 82.77 | |
| cd01807 | 74 | GDX_N ubiquitin-like domain of GDX. GDX contains a | 82.59 | |
| cd01798 | 70 | parkin_N amino-terminal ubiquitin-like of parkin p | 82.48 | |
| cd01806 | 76 | Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn | 82.03 | |
| cd01813 | 74 | UBP_N UBP ubiquitin processing protease. The UBP ( | 81.29 |
| >PF02991 Atg8: Autophagy protein Atg8 ubiquitin like; InterPro: IPR004241 Autophagy is generally known as a process involved in the degradation of bulk cytoplasmic components that are non-specifically sequestered into an autophagosome, where they are sequestered into double-membrane vesicles and delivered to the degradative organelle, the lysosome/vacuole, for breakdown and eventual recycling of the resulting macromolecules | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.4e-47 Score=254.87 Aligned_cols=97 Identities=51% Similarity=0.818 Sum_probs=87.2
Q ss_pred cccccCCCc-eEEEEEecCCCCCCcccceeeEEecCCCchHHHHHHHHHhhccCccceEEEEEcCccCCCCchHHHHHhh
Q 034290 2 ETATMGIPF-FLFICMNSHKFYIPTCLQCCRYLVPADLTVGQFVYVIRKRIKLSAEKAIFIFVDNVLPPTGAIMSTIYDE 80 (99)
Q Consensus 2 ~~~~~~~p~-ipVIvE~~~~~~lp~l~~k~Kflvp~~~tv~~f~~~irk~l~l~~~~slfl~Vnn~lp~~~~~m~~lY~~ 80 (99)
+.+++|||+ |||||||++++++|+|| |+|||||.++||+||+.+||+||+|++++||||||||++|+++++||+||++
T Consensus 7 ~~ir~kyP~~IPVIvEr~~~s~lp~ld-k~KfLvp~~~tv~qf~~~ir~rl~l~~~~alfl~Vn~~lp~~s~tm~elY~~ 85 (104)
T PF02991_consen 7 ERIREKYPDKIPVIVERYPKSKLPDLD-KKKFLVPKDLTVGQFVYIIRKRLQLSPEQALFLFVNNTLPSTSSTMGELYEK 85 (104)
T ss_dssp HHHHHHSTTEEEEEEEE-TTSSS---S-SSEEEEETTSBHHHHHHHHHHHTT--TTS-EEEEBTTBESSTTSBHHHHHHH
T ss_pred HHHHHHCCCccEEEEEEccCCChhhcC-ccEEEEcCCCchhhHHHHhhhhhcCCCCceEEEEEcCcccchhhHHHHHHHH
Confidence 457899999 99999999999999999 9999999999999999999999999999999999999999999999999999
Q ss_pred hcCCCCeEEEEecCcccCC
Q 034290 81 KKDEDGFLYVTYSGENTFG 99 (99)
Q Consensus 81 ~kd~DGfLYl~Ys~~~~fG 99 (99)
|||+||||||+||+|+|||
T Consensus 86 ~kdeDGFLY~~Ys~e~tFG 104 (104)
T PF02991_consen 86 YKDEDGFLYMTYSSEETFG 104 (104)
T ss_dssp HB-TTSSEEEEEESSSSBC
T ss_pred hCCCCCeEEEEeccccccC
Confidence 9999999999999999999
|
The yeast proteins are involved in the autophagosome, and Atg8 binds Atg19, via its N terminus and the C terminus of Atg19. Light chain 3 is proposed to function primarily as a subunit of microtubule associated proteins 1A and 1B and that its expression may regulate microtubule binding activity [] Related proteins that belong to this group include the human ganglioside expression factor and a symbiosis-related fungal protein.; PDB: 3ECI_A 3D32_B 1GNU_A 1KM7_A 1KLV_A 1KOT_A 3DOW_A 1KJT_A 1V49_A 2ZJD_C .... |
| >KOG1654 consensus Microtubule-associated anchor protein involved in autophagy and membrane trafficking [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01611 GABARAP Ubiquitin domain of GABA-receptor-associated protein | Back alignment and domain information |
|---|
| >PTZ00380 microtubule-associated protein (MAP); Provisional | Back alignment and domain information |
|---|
| >cd01612 APG12_C Ubiquitin-like domain of APG12 | Back alignment and domain information |
|---|
| >PF04110 APG12: Ubiquitin-like autophagy protein Apg12 ; InterPro: IPR007242 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG3439 consensus Protein conjugation factor involved in autophagy [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04106 APG5: Autophagy protein Apg5 ; InterPro: IPR007239 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF11816 DUF3337: Domain of unknown function (DUF3337); InterPro: IPR021772 This family of proteins are functionally uncharacterised | Back alignment and domain information |
|---|
| >PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins | Back alignment and domain information |
|---|
| >cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of NADPH oxidase during phagocytosis | Back alignment and domain information |
|---|
| >PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade | Back alignment and domain information |
|---|
| >smart00213 UBQ Ubiquitin homologues | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >cd00196 UBQ Ubiquitin-like proteins | Back alignment and domain information |
|---|
| >PF03671 Ufm1: Ubiquitin fold modifier 1 protein; InterPro: IPR005375 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade | Back alignment and domain information |
|---|
| >PF10302 DUF2407: DUF2407 ubiquitin-like domain; InterPro: IPR019413 This entry represents a family of proteins of unknown function found in fungi | Back alignment and domain information |
|---|
| >PF13019 Telomere_Sde2: Telomere stability and silencing | Back alignment and domain information |
|---|
| >cd01763 Sumo Small ubiquitin-related modifier (SUMO) | Back alignment and domain information |
|---|
| >KOG2976 consensus Protein involved in autophagy and nutrient starvation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01807 GDX_N ubiquitin-like domain of GDX | Back alignment and domain information |
|---|
| >cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein | Back alignment and domain information |
|---|
| >cd01806 Nedd8 Nebb8-like ubiquitin protein | Back alignment and domain information |
|---|
| >cd01813 UBP_N UBP ubiquitin processing protease | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 99 | ||||
| 3rui_B | 118 | Crystal Structure Of Atg7c-Atg8 Complex Length = 11 | 4e-29 | ||
| 2kwc_A | 116 | The Nmr Structure Of The Autophagy-Related Protein | 4e-29 | ||
| 2kq7_A | 119 | Solution Structure Of The Autophagy-Related Protein | 4e-29 | ||
| 2zpn_A | 119 | The Crystal Structure Of Saccharomyces Cerevisiae A | 4e-29 | ||
| 2li5_A | 117 | Nmr Structure Of Atg8-Atg7c30 Complex Length = 117 | 5e-29 | ||
| 3vh3_B | 119 | Crystal Structure Of Atg7ctd-Atg8 Complex Length = | 5e-29 | ||
| 1eo6_A | 117 | Crystal Structure Of Gate-16 Length = 117 | 8e-23 | ||
| 3h9d_A | 119 | Crystal Structure Of Trypanosoma Brucei Atg8 Length | 3e-21 | ||
| 3m95_A | 125 | Crystal Structure Of Autophagy-Related Protein Atg8 | 1e-20 | ||
| 1gnu_A | 117 | Gaba(a) Receptor Associated Protein Gabarap Length | 3e-20 | ||
| 1kjt_A | 119 | Crystal Structure Of The Gaba(A) Receptor Associate | 3e-20 | ||
| 1kot_A | 119 | Solution Structure Of Human Gaba Receptor Associate | 3e-20 | ||
| 2l8j_A | 119 | Gabarapl-1 Nbr1-Lir Complex Structure Length = 119 | 3e-18 | ||
| 2r2q_A | 110 | Crystal Structure Of Human Gamma-Aminobutyric Acid | 2e-17 | ||
| 4eoy_A | 128 | Plasmodium Falciparum Atg8 In Complex With Plasmodi | 2e-13 | ||
| 3vvw_B | 128 | Ndp52 In Complex With Lc3c Length = 128 | 1e-12 | ||
| 1v49_A | 120 | Solution Structure Of Microtubule-Associated Protei | 5e-11 | ||
| 2zjd_A | 130 | Crystal Structure Of Lc3-P62 Complex Length = 130 | 5e-11 | ||
| 2k6q_A | 121 | Lc3 P62 Complex Structure Length = 121 | 9e-11 | ||
| 2z0e_B | 129 | The Crystal Structure Of Human Atg4b- Lc3(1-124) Co | 1e-10 | ||
| 1ugm_A | 125 | Crystal Structure Of Lc3 Length = 125 | 1e-10 | ||
| 3eci_A | 122 | Microtubule-Associated Protein 1 Light Chain 3 Alph | 3e-10 |
| >pdb|3RUI|B Chain B, Crystal Structure Of Atg7c-Atg8 Complex Length = 118 | Back alignment and structure |
|
| >pdb|2KWC|A Chain A, The Nmr Structure Of The Autophagy-Related Protein Atg8 Length = 116 | Back alignment and structure |
| >pdb|2KQ7|A Chain A, Solution Structure Of The Autophagy-Related Protein Atg8 Length = 119 | Back alignment and structure |
| >pdb|2ZPN|A Chain A, The Crystal Structure Of Saccharomyces Cerevisiae Atg8- Atg19(412-415) Complex Length = 119 | Back alignment and structure |
| >pdb|2LI5|A Chain A, Nmr Structure Of Atg8-Atg7c30 Complex Length = 117 | Back alignment and structure |
| >pdb|3VH3|B Chain B, Crystal Structure Of Atg7ctd-Atg8 Complex Length = 119 | Back alignment and structure |
| >pdb|1EO6|A Chain A, Crystal Structure Of Gate-16 Length = 117 | Back alignment and structure |
| >pdb|3H9D|A Chain A, Crystal Structure Of Trypanosoma Brucei Atg8 Length = 119 | Back alignment and structure |
| >pdb|3M95|A Chain A, Crystal Structure Of Autophagy-Related Protein Atg8 From The Silkworm Bombyx Mori Length = 125 | Back alignment and structure |
| >pdb|1GNU|A Chain A, Gaba(a) Receptor Associated Protein Gabarap Length = 117 | Back alignment and structure |
| >pdb|1KJT|A Chain A, Crystal Structure Of The Gaba(A) Receptor Associated Protein, Gabarap Length = 119 | Back alignment and structure |
| >pdb|1KOT|A Chain A, Solution Structure Of Human Gaba Receptor Associated Protein Gabarap Length = 119 | Back alignment and structure |
| >pdb|2L8J|A Chain A, Gabarapl-1 Nbr1-Lir Complex Structure Length = 119 | Back alignment and structure |
| >pdb|2R2Q|A Chain A, Crystal Structure Of Human Gamma-Aminobutyric Acid Receptor- Associated Protein-Like 1 (Gabarap1), Isoform Cra_a Length = 110 | Back alignment and structure |
| >pdb|4EOY|A Chain A, Plasmodium Falciparum Atg8 In Complex With Plasmodium Falciparum Atg3 Peptide Length = 128 | Back alignment and structure |
| >pdb|3VVW|B Chain B, Ndp52 In Complex With Lc3c Length = 128 | Back alignment and structure |
| >pdb|1V49|A Chain A, Solution Structure Of Microtubule-Associated Protein Light Chain-3 Length = 120 | Back alignment and structure |
| >pdb|2ZJD|A Chain A, Crystal Structure Of Lc3-P62 Complex Length = 130 | Back alignment and structure |
| >pdb|2K6Q|A Chain A, Lc3 P62 Complex Structure Length = 121 | Back alignment and structure |
| >pdb|2Z0E|B Chain B, The Crystal Structure Of Human Atg4b- Lc3(1-124) Complex Length = 129 | Back alignment and structure |
| >pdb|1UGM|A Chain A, Crystal Structure Of Lc3 Length = 125 | Back alignment and structure |
| >pdb|3ECI|A Chain A, Microtubule-Associated Protein 1 Light Chain 3 Alpha Isoform A (Map1alc3) Length = 122 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 99 | |||
| 3rui_B | 118 | Autophagy-related protein 8; autophagosome formati | 2e-32 | |
| 3h9d_A | 119 | ATG8, microtubule-associated protein 1A/1B, light | 2e-31 | |
| 3m95_A | 125 | Autophagy related protein ATG8; alpha slash beta, | 5e-31 | |
| 1eo6_A | 117 | GATE-16, golgi-associated ATPase enhancer of 16 KD | 1e-30 | |
| 2r2q_A | 110 | Gamma-aminobutyric acid receptor-associated protei | 5e-28 | |
| 2zjd_A | 130 | Microtubule-associated proteins 1A/1B light chain | 6e-28 |
| >3rui_B Autophagy-related protein 8; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 2kq7_A 2zpn_A 2kwc_A 2li5_A 3vh3_B 3vh4_B* Length = 118 | Back alignment and structure |
|---|
Score = 108 bits (270), Expect = 2e-32
Identities = 56/73 (76%), Positives = 62/73 (84%)
Query: 27 LQCCRYLVPADLTVGQFVYVIRKRIKLSAEKAIFIFVDNVLPPTGAIMSTIYDEKKDEDG 86
+ +YLVPADLTVGQFVYVIRKRI L EKAIFIFV++ LPPT A+MS IY E KD+DG
Sbjct: 46 IDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDG 105
Query: 87 FLYVTYSGENTFG 99
FLYVTYSGENTFG
Sbjct: 106 FLYVTYSGENTFG 118
|
| >3h9d_A ATG8, microtubule-associated protein 1A/1B, light chain putative; autophagy, lipidation, ubiquitin-like, S protein; 2.30A {Trypanosoma brucei} Length = 119 | Back alignment and structure |
|---|
| >3m95_A Autophagy related protein ATG8; alpha slash beta, receptor, transport protein; 2.40A {Bombyx mori} Length = 125 | Back alignment and structure |
|---|
| >1eo6_A GATE-16, golgi-associated ATPase enhancer of 16 KD; ubiquitin fold, protein binding; 1.80A {Bos taurus} SCOP: d.15.1.3 Length = 117 | Back alignment and structure |
|---|
| >2r2q_A Gamma-aminobutyric acid receptor-associated protein-like 1; autophagy, ubiquitin homolog, structural genomics consortium, SGC, microtubule; 1.65A {Homo sapiens} PDB: 2l8j_A 1kjt_A 1kot_A 3d32_A 3dow_A 1gnu_A 1klv_A 1km7_A Length = 110 | Back alignment and structure |
|---|
| >2zjd_A Microtubule-associated proteins 1A/1B light chain 3B precursor; autophagy, LC3, microtubule-associated protein 1 light chain 3, cytoplasm, cytoplasmic vesicle, lipoprotein; 1.56A {Homo sapiens} SCOP: d.15.1.3 PDB: 2z0e_B 2zzp_B 2z0d_B 1ugm_A 1v49_A 2k6q_A 3eci_A Length = 130 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 99 | |||
| 3m95_A | 125 | Autophagy related protein ATG8; alpha slash beta, | 100.0 | |
| 3rui_B | 118 | Autophagy-related protein 8; autophagosome formati | 100.0 | |
| 3h9d_A | 119 | ATG8, microtubule-associated protein 1A/1B, light | 100.0 | |
| 1eo6_A | 117 | GATE-16, golgi-associated ATPase enhancer of 16 KD | 100.0 | |
| 2zjd_A | 130 | Microtubule-associated proteins 1A/1B light chain | 100.0 | |
| 2r2q_A | 110 | Gamma-aminobutyric acid receptor-associated protei | 100.0 | |
| 4gdk_A | 91 | Ubiquitin-like protein ATG12; protein-protein conj | 100.0 | |
| 1wz3_A | 96 | Autophagy 12B, ATG12B, APG12B; ubiquitin-fold, pla | 100.0 | |
| 3w1s_C | 91 | Ubiquitin-like protein ATG12; ubiquitin fold, E3-l | 99.98 | |
| 3goe_A | 82 | DNA repair protein RAD60; SUMO-like domain, sumoyl | 95.19 | |
| 2dyo_A | 297 | Autophagy protein 5; ubiquitin-fold, herix-bundle, | 92.96 | |
| 3vqi_A | 274 | ATG5; autophagy, E3-like, ubiquitin-fold, PRE-auto | 92.82 | |
| 4gdk_B | 275 | Autophagy protein 5; protein-protein conjugate, pr | 92.63 | |
| 2uyz_B | 79 | Small ubiquitin-related modifier 1; sumoylation, c | 89.16 | |
| 1wh3_A | 87 | 59 kDa 2'-5'-oligoadenylate synthetase like protei | 88.36 | |
| 3a4r_A | 79 | Nfatc2-interacting protein; ubiquitin fold, coiled | 87.99 | |
| 1ndd_A | 76 | NEDD8, protein (ubiquitin-like protein NEDD8); pro | 87.83 | |
| 3mtn_B | 85 | UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit | 87.4 | |
| 3n3k_B | 85 | Ubiquitin; hydrolase, protease, thiol protease, DU | 87.25 | |
| 1wy8_A | 89 | NP95-like ring finger protein, isoform A; ubiquiti | 87.17 | |
| 3a9j_A | 76 | Ubiquitin; protein complex, cytoplasm, isopeptide | 87.11 | |
| 2kvr_A | 130 | Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubi | 86.77 | |
| 1uh6_A | 100 | Ubiquitin-like 5; beta-grAsp fold, structural geno | 85.84 | |
| 3phx_B | 79 | Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu | 85.18 | |
| 2dzi_A | 81 | Ubiquitin-like protein 4A; GDX, structural genomic | 84.6 | |
| 1wyw_B | 97 | Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho | 84.26 | |
| 2hj8_A | 88 | Interferon-induced 17 kDa protein; HR2873B, human | 83.83 | |
| 1vd2_A | 89 | Protein kinase C, IOTA type; PB1 domain, OPCA moti | 83.81 | |
| 1wm3_A | 72 | Ubiquitin-like protein SMT3B; ubiquitin fold, half | 83.74 | |
| 2bwf_A | 77 | Ubiquitin-like protein DSK2; signaling protein, UB | 83.49 | |
| 2kk8_A | 84 | Uncharacterized protein AT4G05270; solution arabid | 83.47 | |
| 3k9o_B | 96 | Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b | 83.24 | |
| 2l7r_A | 93 | Ubiquitin-like protein FUBI; structural genomics, | 83.22 | |
| 1yqb_A | 100 | Ubiquilin 3; structural genomics consortium, ubiqu | 82.76 | |
| 1wx7_A | 106 | Ubiquilin 3; ubiquitin-like domain, structural gen | 82.31 | |
| 4dwf_A | 90 | HLA-B-associated transcript 3; ubiquitin-like doma | 82.15 | |
| 1yx5_B | 98 | Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s | 81.92 | |
| 3dbh_I | 88 | NEDD8; cell cycle, activating enzyme, apoptosis, m | 80.86 | |
| 3plu_A | 93 | Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- | 80.58 | |
| 2io0_B | 91 | Small ubiquitin-related modifier 2 precursor; SUMO | 80.43 | |
| 2faz_A | 78 | Ubiquitin-like containing PHD and ring finger DOM | 80.36 | |
| 2k8h_A | 110 | Small ubiquitin protein; SUMO, post-translational | 80.32 |
| >3m95_A Autophagy related protein ATG8; alpha slash beta, receptor, transport protein; 2.40A {Bombyx mori} SCOP: d.15.1.3 | Back alignment and structure |
|---|
Probab=100.00 E-value=1.2e-46 Score=259.92 Aligned_cols=97 Identities=46% Similarity=0.756 Sum_probs=94.2
Q ss_pred cccccCCCc-eEEEEEecCCCCCCcccceeeEEecCCCchHHHHHHHHHhhccCccceEEEEEcCccCCCCchHHHHHhh
Q 034290 2 ETATMGIPF-FLFICMNSHKFYIPTCLQCCRYLVPADLTVGQFVYVIRKRIKLSAEKAIFIFVDNVLPPTGAIMSTIYDE 80 (99)
Q Consensus 2 ~~~~~~~p~-ipVIvE~~~~~~lp~l~~k~Kflvp~~~tv~~f~~~irk~l~l~~~~slfl~Vnn~lp~~~~~m~~lY~~ 80 (99)
+.+++|||+ |||||||++++++|.|| |+|||||+++||+||+.+||+||+|++++||||||||++|+++++||+||++
T Consensus 27 ~~ir~kyP~rIPVIvEr~~~s~lP~Ld-K~KflVp~~~tv~qf~~~IRkrl~L~~~~alFl~Vnn~lPs~s~~m~~lY~~ 105 (125)
T 3m95_A 27 EKIRRKYPDRVPVIVEKAPKARLGDLD-KKKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQE 105 (125)
T ss_dssp HHHHHHCTTEEEEEEEECTTCSSCCCS-CCEEEEETTSBHHHHHHHHHHHTTCCTTSCCEEEBTTBCCCTTSBHHHHHHH
T ss_pred HHHHHHCCCeEEEEEEecCCCCCcccc-CCEEEcCCCCEeeeehhhhHhhcCCCccccEEEEECCccCCccchHHHHHHH
Confidence 457899999 99999999999999999 9999999999999999999999999999999999999999999999999999
Q ss_pred hcCCCCeEEEEecCcccCC
Q 034290 81 KKDEDGFLYVTYSGENTFG 99 (99)
Q Consensus 81 ~kd~DGfLYl~Ys~~~~fG 99 (99)
|||+||||||+||+++|||
T Consensus 106 ~kdeDGfLY~~Ys~e~tfG 124 (125)
T 3m95_A 106 HHDEDFFLYIAFSDENVYG 124 (125)
T ss_dssp HCCTTSCEEEEEESSSCC-
T ss_pred cCCCCCeEEEEecCccccC
Confidence 9999999999999999999
|
| >3rui_B Autophagy-related protein 8; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} SCOP: d.15.1.3 PDB: 2kq7_A 2zpn_A 3vxw_A 2kwc_A 2li5_A 3vh3_B 3vh4_B* | Back alignment and structure |
|---|
| >3h9d_A ATG8, microtubule-associated protein 1A/1B, light chain putative; autophagy, lipidation, ubiquitin-like, S protein; 2.30A {Trypanosoma brucei} SCOP: d.15.1.0 | Back alignment and structure |
|---|
| >1eo6_A GATE-16, golgi-associated ATPase enhancer of 16 KD; ubiquitin fold, protein binding; 1.80A {Bos taurus} SCOP: d.15.1.3 | Back alignment and structure |
|---|
| >2zjd_A Microtubule-associated proteins 1A/1B light chain 3B precursor; autophagy, LC3, microtubule-associated protein 1 light chain 3, cytoplasm, cytoplasmic vesicle, lipoprotein; 1.56A {Homo sapiens} SCOP: d.15.1.3 PDB: 2z0e_B 2zzp_B 2z0d_B 1ugm_A 1v49_A 2k6q_A 3eci_A | Back alignment and structure |
|---|
| >2r2q_A Gamma-aminobutyric acid receptor-associated protein-like 1; autophagy, ubiquitin homolog, structural genomics consortium, SGC, microtubule; 1.65A {Homo sapiens} PDB: 2l8j_A 1kjt_A 1kot_A 3d32_A 3dow_A 1gnu_A 1klv_A 1km7_A | Back alignment and structure |
|---|
| >4gdk_A Ubiquitin-like protein ATG12; protein-protein conjugate, protein-protein complex, ubiquiti protein, E3 ligase, ubiquitin-like fold; 2.70A {Homo sapiens} PDB: 4gdl_A | Back alignment and structure |
|---|
| >1wz3_A Autophagy 12B, ATG12B, APG12B; ubiquitin-fold, plant protein; 1.80A {Arabidopsis thaliana} SCOP: d.15.1.7 | Back alignment and structure |
|---|
| >3w1s_C Ubiquitin-like protein ATG12; ubiquitin fold, E3-like, ATG3 binding, isopeptide bond betwe Gly186 and ATG5 Lys149, ligase; 2.60A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* | Back alignment and structure |
|---|
| >2dyo_A Autophagy protein 5; ubiquitin-fold, herix-bundle, protein turnover/protein turnover complex; 1.97A {Saccharomyces cerevisiae} PDB: 2dym_A | Back alignment and structure |
|---|
| >3vqi_A ATG5; autophagy, E3-like, ubiquitin-fold, PRE-autoph structure, protein turnover, protein transport; HET: EPE; 2.50A {Kluyveromyces marxianus} | Back alignment and structure |
|---|
| >4gdk_B Autophagy protein 5; protein-protein conjugate, protein-protein complex, ubiquiti protein, E3 ligase, ubiquitin-like fold; 2.70A {Homo sapiens} PDB: 4gdl_B | Back alignment and structure |
|---|
| >2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B | Back alignment and structure |
|---|
| >1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A | Back alignment and structure |
|---|
| >1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A | Back alignment and structure |
|---|
| >3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... | Back alignment and structure |
|---|
| >2kvr_A Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubiquitin-like domain, UBL, ubiquitin specific protease, HOST-virus interaction, nucleus, protease; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C | Back alignment and structure |
|---|
| >2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vd2_A Protein kinase C, IOTA type; PB1 domain, OPCA motif, APKC, ZIP/P62, MEK5, molecular recognition, transferase; NMR {Homo sapiens} SCOP: d.15.2.2 PDB: 1wmh_A | Back alignment and structure |
|---|
| >1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B | Back alignment and structure |
|---|
| >2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S | Back alignment and structure |
|---|
| >2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A | Back alignment and structure |
|---|
| >2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A | Back alignment and structure |
|---|
| >1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B | Back alignment and structure |
|---|
| >3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I | Back alignment and structure |
|---|
| >3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A | Back alignment and structure |
|---|
| >2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 99 | ||||
| d1eo6a_ | 116 | d.15.1.3 (A:) Golgi-associated ATPase enhancer of | 3e-36 | |
| d3d32a1 | 118 | d.15.1.3 (A:1-118) GABA(A) receptor associated pro | 9e-35 | |
| d2zjda1 | 119 | d.15.1.3 (A:2-120) Microtubule-associated proteins | 9e-30 |
| >d1eo6a_ d.15.1.3 (A:) Golgi-associated ATPase enhancer of 16 kD, Gate-16 {Cow (Bos taurus) [TaxId: 9913]} Length = 116 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-Grasp (ubiquitin-like) superfamily: Ubiquitin-like family: GABARAP-like domain: Golgi-associated ATPase enhancer of 16 kD, Gate-16 species: Cow (Bos taurus) [TaxId: 9913]
Score = 116 bits (293), Expect = 3e-36
Identities = 45/86 (52%), Positives = 61/86 (70%), Gaps = 1/86 (1%)
Query: 14 ICMNSHKFYIPTCLQCCRYLVPADLTVGQFVYVIRKRIKLSAEKAIFIFVDNVLPPTGAI 73
I I + +YLVP+D+TV QF+++IRKRI+L +EKAIF+FVD +P +
Sbjct: 32 IVEKVSGSQIVD-IDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLT 90
Query: 74 MSTIYDEKKDEDGFLYVTYSGENTFG 99
M +Y+++KDEDGFLYV YSGENTFG
Sbjct: 91 MGQLYEKEKDEDGFLYVAYSGENTFG 116
|
| >d3d32a1 d.15.1.3 (A:1-118) GABA(A) receptor associated protein GABARAP {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d2zjda1 d.15.1.3 (A:2-120) Microtubule-associated proteins 1A/1B light chain 3B {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 99 | |||
| d3d32a1 | 118 | GABA(A) receptor associated protein GABARAP {Human | 100.0 | |
| d1eo6a_ | 116 | Golgi-associated ATPase enhancer of 16 kD, Gate-16 | 100.0 | |
| d2zjda1 | 119 | Microtubule-associated proteins 1A/1B light chain | 100.0 | |
| d1wz3a1 | 84 | Autophagy-related protein 12b (APG12b) {Thale cres | 99.85 | |
| d1m94a_ | 73 | Ubiquitin-like modifier protein hub1 {Baker's yeas | 92.58 | |
| d1euvb_ | 79 | SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy | 92.22 | |
| d1ip9a_ | 85 | Bud emergence mediator Bemp1 {Baker's yeast (Sacch | 90.11 | |
| d2uyzb1 | 77 | SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax | 88.87 | |
| d1z2ma2 | 76 | Interferon-induced 15 kDa protein {Human (Homo sap | 88.76 | |
| d1ttna1 | 80 | Dendritic cell-derived ubiquitin-like protein {Hum | 87.85 | |
| d1uh6a_ | 100 | Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu | 87.0 | |
| d1wh3a_ | 87 | 2'-5'-oligoadenylate synthetase-like protein, OASL | 86.85 | |
| d1ogwa_ | 76 | Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} | 86.69 | |
| d1zkha1 | 86 | Splicing factor 3 subunit 1, C-terminal domain {Hu | 86.03 | |
| d2zeqa1 | 78 | Ubiquitin-like domain of parkin {Mouse (Mus muscul | 85.74 | |
| d1wy8a1 | 76 | Ubiquitin-like PHD and RING finger domain-containi | 85.31 | |
| d1wjna_ | 97 | Tubulin-folding protein TbcE {Mouse (Mus musculus) | 84.58 | |
| d1wjua_ | 100 | NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens | 84.58 | |
| d1v5oa_ | 102 | 1700011n24rik protein {Mouse (Mus musculus) [TaxId | 84.41 | |
| d1bt0a_ | 73 | Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI | 83.18 | |
| d1wx8a1 | 83 | 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] | 82.89 | |
| d1wx9a1 | 73 | Large proline-rich protein BAT3 {Human (Homo sapie | 82.47 | |
| d1j8ca_ | 103 | Ubiquitin-like N-terminal domain of PLIC-2 {Human | 82.13 | |
| d2faza1 | 76 | Ubiquitin-like PHD and RING finger domain-containi | 81.22 |
| >d3d32a1 d.15.1.3 (A:1-118) GABA(A) receptor associated protein GABARAP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-Grasp (ubiquitin-like) superfamily: Ubiquitin-like family: GABARAP-like domain: GABA(A) receptor associated protein GABARAP species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=4.1e-45 Score=248.44 Aligned_cols=97 Identities=47% Similarity=0.755 Sum_probs=94.7
Q ss_pred cccccCCCc-eEEEEEecCCCCCCcccceeeEEecCCCchHHHHHHHHHhhccCccceEEEEEcCccCCCCchHHHHHhh
Q 034290 2 ETATMGIPF-FLFICMNSHKFYIPTCLQCCRYLVPADLTVGQFVYVIRKRIKLSAEKAIFIFVDNVLPPTGAIMSTIYDE 80 (99)
Q Consensus 2 ~~~~~~~p~-ipVIvE~~~~~~lp~l~~k~Kflvp~~~tv~~f~~~irk~l~l~~~~slfl~Vnn~lp~~~~~m~~lY~~ 80 (99)
+.++.|||+ ||||||+++++++|.|| ++|||||.++||+||+.+||+||+|++++||||||||++|+++++||+||++
T Consensus 21 ~~i~~KyPdriPVIve~~~~s~lp~ld-k~KflVp~d~tv~qf~~~iRkrl~l~~~~alflfvn~~~~~~~~ti~~lY~~ 99 (118)
T d3d32a1 21 EKIRKKYPDRVPVIVEKAPKARIGDLD-KKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQE 99 (118)
T ss_dssp HHHHHHCTTEEEEEEEECTTCCSCCCS-CSEEEEETTCBHHHHHHHHHHHHTCCTTSCCEEEBTTBCCCTTCBHHHHHHH
T ss_pred HHHHHHCCCCceEEEEEcCCCCCcccc-cceEEecCCccHHHHHHHHHHHhCCCccceEEEEECCcccCccccHHHHHHH
Confidence 357899999 99999999999999999 9999999999999999999999999999999999999999999999999999
Q ss_pred hcCCCCeEEEEecCcccCC
Q 034290 81 KKDEDGFLYVTYSGENTFG 99 (99)
Q Consensus 81 ~kd~DGfLYl~Ys~~~~fG 99 (99)
|||+||||||+||+|+|||
T Consensus 100 ~kdeDGfLYi~Ys~entFG 118 (118)
T d3d32a1 100 HHEEDFFLYIAYSDESVYG 118 (118)
T ss_dssp HCCTTSCEEEEEESCTTCC
T ss_pred hCCCCcEEEEEEecccccC
Confidence 9999999999999999999
|
| >d1eo6a_ d.15.1.3 (A:) Golgi-associated ATPase enhancer of 16 kD, Gate-16 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2zjda1 d.15.1.3 (A:2-120) Microtubule-associated proteins 1A/1B light chain 3B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wz3a1 d.15.1.7 (A:10-93) Autophagy-related protein 12b (APG12b) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ip9a_ d.15.2.2 (A:) Bud emergence mediator Bemp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|