Citrus Sinensis ID: 034525


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90--
MMKECDLNLDGELDHEEFVKFIQKLTSDTFIVVSQGLLITLVVAPTVAMATKRATEGVPHVGKVVQRVPNSIYASLVTLAVVWFQNSGRQID
ccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHccccccc
cccHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHEccccHHHHHHHHHHHHHHHHHccccc
mmkecdlnldgeldHEEFVKFIQKLTSDTFIVVSQGLLITLVVAPTVAMATkrategvphvgkvvqrvpnsIYASLVTLAVVWFQNSGRQID
mmkecdlnldgeLDHEEFVKFIQKLTSDTFIVVSQGLLITLVVAPTVAMATKrategvphvgkvVQRVPNSIYASLVTLAVVWFQNSGRQID
MMKECDLNLDGELDHEEFVKFIQKLTSDTFIVVSQGLLITLVVAPTVAMATKRATEGVPHVGKVVQRVPNSIYASLVTLAVVWFQNSGRQID
********LDGELDHEEFVKFIQKLTSDTFIVVSQGLLITLVVAPTVAMATKRATEGVPHVGKVVQRVPNSIYASLVTLAVVWFQ*******
*******NLDGELDHEEFVKFIQKLTSDTFIVVSQGLLITLVVAPTVAMATKRATEGVPHVGKVVQRVPNSIYASLVTLAVVWFQNSG****
MMKECDLNLDGELDHEEFVKFIQKLTSDTFIVVSQGLLITLVVAPTVAMATKRATEGVPHVGKVVQRVPNSIYASLVTLAVVWFQNSGRQID
*MKECDLNLDGELDHEEFVKFIQKLTSDTFIVVSQGLLITLVVAPTVAMATKRATEGVPHVGKVVQRVPNSIYASLVTLAVVWFQNSG****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiii
oooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiihhhhhhhhhhhhhhhhooooooooooooohhhhhhhhhhhhhhhhiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMKECDLNLDGELDHEEFVKFIQKLTSDTFIVVSQGLLITLVVAPTVAMATKRATEGVPHVGKVVQRVPNSIYASLVTLAVVWFQNSGRQID
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query92
255566026165 calcium ion binding protein, putative [R 1.0 0.557 0.815 1e-38
224124022165 predicted protein [Populus trichocarpa] 0.967 0.539 0.811 1e-35
388510056166 unknown [Medicago truncatula] 0.978 0.542 0.755 9e-34
147796361165 hypothetical protein VITISV_013662 [Viti 0.978 0.545 0.744 1e-31
225463836165 PREDICTED: uncharacterized protein LOC10 0.934 0.521 0.779 2e-31
18408144162 calcium-binding EF-hand-containing prote 0.902 0.512 0.746 1e-29
297840817162 calcium-binding EF hand family protein [ 0.934 0.530 0.697 5e-29
351720841166 uncharacterized protein LOC100526914 [Gl 0.945 0.524 0.632 3e-27
351727371166 uncharacterized protein LOC100527595 [Gl 0.923 0.512 0.647 6e-27
346469871170 hypothetical protein [Amblyomma maculatu 0.956 0.517 0.647 3e-26
>gi|255566026|ref|XP_002524001.1| calcium ion binding protein, putative [Ricinus communis] gi|223536728|gb|EEF38369.1| calcium ion binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  163 bits (412), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 75/92 (81%), Positives = 88/92 (95%)

Query: 1   MMKECDLNLDGELDHEEFVKFIQKLTSDTFIVVSQGLLITLVVAPTVAMATKRATEGVPH 60
           MM++CDLN DGE+DHEEFV+FI+KLT+DTFIVVSQGL+ITLVVAPTVAMATK+ATEGVP 
Sbjct: 74  MMQDCDLNFDGEIDHEEFVRFIRKLTADTFIVVSQGLMITLVVAPTVAMATKKATEGVPG 133

Query: 61  VGKVVQRVPNSIYASLVTLAVVWFQNSGRQID 92
           VGKVVQ++P SIYASLVTLA+VWFQ SG++ID
Sbjct: 134 VGKVVQKLPTSIYASLVTLAIVWFQTSGQEID 165




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224124022|ref|XP_002319225.1| predicted protein [Populus trichocarpa] gi|222857601|gb|EEE95148.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388510056|gb|AFK43094.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|147796361|emb|CAN70389.1| hypothetical protein VITISV_013662 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225463836|ref|XP_002264359.1| PREDICTED: uncharacterized protein LOC100255239 [Vitis vinifera] gi|296088758|emb|CBI38208.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|18408144|ref|NP_564841.1| calcium-binding EF-hand-containing protein [Arabidopsis thaliana] gi|5042420|gb|AAD38259.1|AC006193_15 Unknown protein [Arabidopsis thaliana] gi|17979274|gb|AAL49953.1| At1g64850/F13O11_15 [Arabidopsis thaliana] gi|20856383|gb|AAM26663.1| At1g64850/F13O11_15 [Arabidopsis thaliana] gi|21592643|gb|AAM64592.1| unknown [Arabidopsis thaliana] gi|332196176|gb|AEE34297.1| calcium-binding EF-hand-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297840817|ref|XP_002888290.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. lyrata] gi|297334131|gb|EFH64549.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|351720841|ref|NP_001235910.1| uncharacterized protein LOC100526914 [Glycine max] gi|255631139|gb|ACU15935.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|351727371|ref|NP_001238438.1| uncharacterized protein LOC100527595 [Glycine max] gi|255632713|gb|ACU16708.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|346469871|gb|AEO34780.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query92
TAIR|locus:2010821162 AT1G64850 "AT1G64850" [Arabido 0.902 0.512 0.746 1e-29
TAIR|locus:505006567161 AT4G37445 "AT4G37445" [Arabido 0.760 0.434 0.351 3.9e-05
TAIR|locus:2010821 AT1G64850 "AT1G64850" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 329 (120.9 bits), Expect = 1.0e-29, P = 1.0e-29
 Identities = 62/83 (74%), Positives = 77/83 (92%)

Query:     1 MMKECDLNLDGELDHEEFVKFIQKLTSDTFIVVSQGLLITLVVAPTVAMATKRATEGVPH 60
             +M +CD+NLDGELD EEFVKFI+++T++TF VVSQGL+I L+VAPTVA+ATK+ATEGVP 
Sbjct:    74 IMTDCDINLDGELDREEFVKFIEQITAETFNVVSQGLIIALIVAPTVAIATKKATEGVPG 133

Query:    61 VGKVVQRVPNSIYASLVTLAVVW 83
             VGKVVQ++P SIYASLVTLAV+W
Sbjct:   134 VGKVVQKLPTSIYASLVTLAVMW 156




GO:0005509 "calcium ion binding" evidence=ISS
GO:0008150 "biological_process" evidence=ND
GO:0009536 "plastid" evidence=IDA
TAIR|locus:505006567 AT4G37445 "AT4G37445" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_Genewise1_v1.C_LG_XIII2390
hypothetical protein (165 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query92
cd0021388 cd00213, S-100, S-100: S-100 domain, which represe 0.002
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 0.002
smart0005429 smart00054, EFh, EF-hand, calcium binding motif 0.003
>gnl|CDD|238131 cd00213, S-100, S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
 Score = 34.0 bits (79), Expect = 0.002
 Identities = 12/26 (46%), Positives = 19/26 (73%)

Query: 1  MMKECDLNLDGELDHEEFVKFIQKLT 26
          +MK+ D+N DG++D +EF+  I KL 
Sbjct: 56 IMKDLDVNKDGKVDFQEFLVLIGKLA 81


Note that this S-100 hierarchy contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins are expressed exclusively in vertebrates, and are implicated in intracellular and extracellular regulatory activities. Intracellularly, S100 proteins act as Ca-signaling or Ca-buffering proteins. The most unusual characteristic of certain S100 proteins is their occurrence in extracellular space, where they act in a cytokine-like manner through RAGE, the receptor for advanced glycation products. Structural data suggest that many S100 members exist within cells as homo- or heterodimers and even oligomers; oligomerization contributes to their functional diversification. Upon binding calcium, most S100 proteins change conformation to a more open structure exposing a hydrophobic cleft. This hydrophobic surface represents the interaction site of S100 proteins with their target proteins. There is experimental evidence showing that many S100 proteins have multiple binding partners with diverse mode of interaction with different targets. In addition to S100 proteins (such as S100A1,-3,-4,-6,-7,-10,-11,and -13), this group includes the ''fused'' gene family, a group of calcium binding S100-related proteins. The ''fused'' gene family includes multifunctional epidermal differentiation proteins - profilaggrin, trichohyalin, repetin, hornerin, and cornulin; functionally these proteins are associated with keratin intermediate filaments and partially crosslinked to the cell envelope. These ''fused'' gene proteins contain N-terminal sequence with two Ca-binding EF-hands motif, which may be associated with calcium signaling in epidermal cells and autoprocessing in a calcium-dependent manner. In contrast to S100 proteins, "fused" gene family proteins contain an extraordinary high number of almost perfect peptide repeats with regular array of polar and charged residues similar to many known cell envelope proteins. Length = 88

>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|197492 smart00054, EFh, EF-hand, calcium binding motif Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 92
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 98.55
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 98.34
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 98.2
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.11
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 97.97
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 97.92
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 97.74
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 97.64
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 97.43
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 97.41
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 97.4
cd0503088 calgranulins Calgranulins: S-100 domain found in p 97.39
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 97.18
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 96.94
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 96.93
cd0005267 EH Eps15 homology domain; found in proteins implic 96.63
cd0021388 S-100 S-100: S-100 domain, which represents the la 96.6
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 96.46
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 96.27
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 96.11
KOG0034187 consensus Ca2+/calmodulin-dependent protein phosph 95.94
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 95.78
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 95.72
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 95.59
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 95.07
KOG4223325 consensus Reticulocalbin, calumenin, DNA supercoil 94.39
PTZ00183158 centrin; Provisional 94.01
cd0005267 EH Eps15 homology domain; found in proteins implic 93.97
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 93.8
PTZ00184149 calmodulin; Provisional 93.64
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 93.03
PTZ00184149 calmodulin; Provisional 91.67
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 91.45
PTZ00183158 centrin; Provisional 91.35
PLN02964 644 phosphatidylserine decarboxylase 90.51
KOG0036 463 consensus Predicted mitochondrial carrier protein 90.23
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 89.26
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 88.34
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 88.19
cd0021388 S-100 S-100: S-100 domain, which represents the la 87.12
KOG0034187 consensus Ca2+/calmodulin-dependent protein phosph 87.1
KOG0041244 consensus Predicted Ca2+-binding protein, EF-Hand 85.96
KOG0038189 consensus Ca2+-binding kinase interacting protein 85.06
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 84.46
KOG2643489 consensus Ca2+ binding protein, contains EF-hand m 84.39
PF1465866 EF-hand_9: EF-hand domain 84.31
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 83.8
PRK12309391 transaldolase/EF-hand domain-containing protein; P 82.76
KOG2643 489 consensus Ca2+ binding protein, contains EF-hand m 82.28
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 82.08
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 80.63
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 80.58
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
Probab=98.55  E-value=4.1e-08  Score=65.88  Aligned_cols=28  Identities=29%  Similarity=0.437  Sum_probs=25.9

Q ss_pred             CcccccccCCCCcCHHHHHHHHHHHHhh
Q 034525            1 MMKECDLNLDGELDHEEFVKFIQKLTSD   28 (92)
Q Consensus         1 imk~lD~N~DgeIdfeEF~~fi~~l~~~   28 (92)
                      +|+++|.|+||+|||+||+.||+.++..
T Consensus        53 im~~LD~n~Dg~vdF~EF~~Lv~~l~~a   80 (91)
T cd05024          53 IMKDLDDCRDGKVGFQSFFSLIAGLLIA   80 (91)
T ss_pred             HHHHhCCCCCCcCcHHHHHHHHHHHHHH
Confidence            5899999999999999999999998765



S100A10 is a member of the S100 family of EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A10 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins are expressed exclusively in vertebrates, and are implicated in intracellular and extracellular regulatory activities. A unique feature of S100A10 is that it contains mutation in both of the calcium binding sites, making it calcium insensitive. S100A10 has been detected in brain, heart, gastrointestinal tract, kidney, liver, lung, spleen, testes, epidermis, aorta, and thymus. Structural data supports the homo- and hetero-dimeric as well as hetero-tetrameric nature of the protein. S100A10 has multiple binding partners in its calcium free state and is therefore involved in many diverse biological functions.

>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] Back     alignment and domain information
>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query92
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 2e-06
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 5e-06
3lij_A494 Calcium/calmodulin dependent protein kinase with A 5e-06
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 7e-06
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 1e-05
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 3e-05
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 3e-05
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 4e-05
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 4e-05
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 5e-05
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 7e-05
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 8e-05
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 9e-05
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 1e-04
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 1e-04
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 1e-04
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 1e-04
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 2e-04
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 2e-04
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 3e-04
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 3e-04
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 3e-04
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 3e-04
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 3e-04
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 3e-04
2hps_A186 Coelenterazine-binding protein with bound coelent; 3e-04
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 3e-04
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 4e-04
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 4e-04
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 4e-04
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 4e-04
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 4e-04
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 4e-04
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 4e-04
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 5e-04
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 5e-04
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 5e-04
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 6e-04
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 6e-04
3a4u_B143 Multiple coagulation factor deficiency protein 2; 6e-04
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 6e-04
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 7e-04
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 7e-04
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 7e-04
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 8e-04
2jnf_A158 Troponin C; stretch activated muscle contraction, 8e-04
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 9e-04
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
 Score = 43.1 bits (102), Expect = 2e-06
 Identities = 11/28 (39%), Positives = 18/28 (64%)

Query: 1   MMKECDLNLDGELDHEEFVKFIQKLTSD 28
           ++ E D N DGE+D +EF + + KL  +
Sbjct: 457 VLSEVDKNNDGEVDFDEFQQMLLKLCGN 484


>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Length = 76 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Length = 78 Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Length = 96 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Length = 81 Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Length = 95 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Length = 100 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Length = 100 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Length = 92 Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Length = 93 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Length = 92 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Length = 106 Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Length = 93 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Length = 143 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Length = 113 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query92
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 98.27
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 98.16
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 98.14
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 98.12
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 98.11
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 98.1
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 98.01
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 97.75
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 97.75
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 97.71
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 97.69
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 97.68
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 97.67
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 97.64
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 97.63
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 97.6
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 97.56
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 97.54
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 97.48
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 97.47
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 97.47
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 97.47
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 97.47
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 97.42
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 97.38
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 97.37
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 97.35
3li6_A66 Calcium-binding protein; calcium signaling protein 97.25
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 97.24
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 97.23
1avs_A90 Troponin C; muscle contraction, calcium-activated, 97.22
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 97.15
1qjt_A99 EH1, epidermal growth factor receptor substrate su 97.12
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 97.12
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 97.09
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 97.08
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 97.06
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 97.0
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 96.95
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 96.94
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 96.88
1c07_A95 Protein (epidermal growth factor receptor pathway 96.88
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 96.86
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 96.82
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 96.79
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 96.77
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 96.76
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 96.76
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 96.71
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 96.7
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 96.7
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 96.7
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 96.69
2jq6_A139 EH domain-containing protein 1; metal binding prot 96.65
3li6_A66 Calcium-binding protein; calcium signaling protein 96.58
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 96.57
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 96.52
2hps_A186 Coelenterazine-binding protein with bound coelent; 96.51
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 96.48
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 96.46
1y1x_A191 Leishmania major homolog of programmed cell death 96.44
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 96.42
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 96.39
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 96.38
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 96.32
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 96.32
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 96.32
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 96.28
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 96.27
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 96.27
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 96.26
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 96.25
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 96.24
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 96.23
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 96.23
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 96.21
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 96.21
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 96.2
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 96.19
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 96.17
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 96.17
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 96.14
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 96.14
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 96.14
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 96.13
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 96.13
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 96.11
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 96.11
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 96.11
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 96.1
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 96.09
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 96.08
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 96.04
1exr_A148 Calmodulin; high resolution, disorder, metal trans 96.04
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 96.01
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 95.98
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 95.94
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 95.93
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 95.92
2jnf_A158 Troponin C; stretch activated muscle contraction, 95.92
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 95.91
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 95.9
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 95.88
3akb_A166 Putative calcium binding protein; EF-hand, metal b 95.87
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 95.87
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 95.84
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 95.82
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 95.81
3a4u_B143 Multiple coagulation factor deficiency protein 2; 95.79
3fwb_A161 Cell division control protein 31; gene gating, com 95.79
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 95.78
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 95.76
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 95.73
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 95.73
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 95.7
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 95.67
1y1x_A191 Leishmania major homolog of programmed cell death 95.65
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 95.65
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 95.64
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 95.62
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 95.58
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 95.57
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 95.56
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 95.54
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 95.53
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 95.5
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 95.46
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 95.43
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 95.43
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 95.43
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 95.41
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 95.4
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 95.38
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 95.38
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 95.38
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 95.37
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 95.34
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 95.34
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 95.33
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 95.33
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 95.22
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 95.19
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 95.17
2lv7_A100 Calcium-binding protein 7; metal binding protein; 95.17
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 95.14
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 95.14
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 95.13
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 95.04
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 95.03
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 94.99
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 94.96
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 94.95
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 94.92
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 94.87
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 94.81
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 94.79
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 94.78
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 94.77
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 94.72
3akb_A166 Putative calcium binding protein; EF-hand, metal b 94.66
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 94.65
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 94.62
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 94.62
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 94.61
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 94.56
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 94.55
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 94.48
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 94.41
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 94.39
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 94.38
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 94.36
1avs_A90 Troponin C; muscle contraction, calcium-activated, 94.34
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 94.33
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 94.28
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 94.27
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 94.26
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 94.25
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 94.24
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 94.24
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 94.23
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 94.2
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 94.18
2hps_A186 Coelenterazine-binding protein with bound coelent; 94.16
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 94.15
2f33_A 263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 94.12
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 94.05
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 94.03
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 94.03
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 94.03
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 93.99
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 93.99
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 93.98
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 93.98
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 93.97
1c07_A95 Protein (epidermal growth factor receptor pathway 93.97
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 93.92
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 93.91
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 93.89
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 93.89
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 93.84
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 93.76
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 93.74
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 93.69
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 93.65
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 93.58
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 93.57
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 93.57
3lij_A494 Calcium/calmodulin dependent protein kinase with A 93.47
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 93.4
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 93.37
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 93.36
3fwb_A161 Cell division control protein 31; gene gating, com 93.35
2be4_A 272 Hypothetical protein LOC449832; DR.36843, BC083168 93.33
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 93.32
1exr_A148 Calmodulin; high resolution, disorder, metal trans 93.29
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 93.24
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 93.2
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 93.09
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 93.08
2jnf_A158 Troponin C; stretch activated muscle contraction, 93.0
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 92.98
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 92.96
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 92.96
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 92.89
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 92.86
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 92.86
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 92.85
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 92.83
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 92.83
3a4u_B143 Multiple coagulation factor deficiency protein 2; 92.78
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 92.75
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 92.75
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 92.74
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 92.71
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 92.7
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 92.7
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 92.7
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 92.58
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 92.53
1qjt_A99 EH1, epidermal growth factor receptor substrate su 92.46
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 92.42
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 92.42
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 92.41
1nub_A229 Basement membrane protein BM-40; extracellular mod 92.38
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 92.37
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 92.33
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 92.33
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 92.14
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 92.11
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 92.1
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 92.08
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 92.08
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 92.08
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 92.02
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 91.94
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 91.94
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 91.86
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 91.83
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 91.69
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 91.54
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 91.49
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 91.31
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 91.26
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 91.11
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 91.0
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 90.91
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 90.87
3lij_A494 Calcium/calmodulin dependent protein kinase with A 90.16
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 90.03
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 89.92
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 89.7
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 89.68
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 88.22
1ij5_A 323 Plasmodial specific LAV1-2 protein; fourty kDa cal 87.99
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 87.29
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 85.85
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 85.71
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 85.58
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 85.57
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 85.53
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 85.47
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 85.47
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 84.77
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 84.05
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 83.89
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 83.69
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 83.69
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 83.46
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 82.94
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 82.79
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 82.36
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 81.98
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 81.19
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
Probab=98.27  E-value=2.8e-07  Score=62.40  Aligned_cols=28  Identities=32%  Similarity=0.510  Sum_probs=25.6

Q ss_pred             CcccccccCCCCcCHHHHHHHHHHHHhh
Q 034525            1 MMKECDLNLDGELDHEEFVKFIQKLTSD   28 (92)
Q Consensus         1 imk~lD~N~DgeIdfeEF~~fi~~l~~~   28 (92)
                      +|+++|.|+||+|||+||+.+|.+++..
T Consensus        60 ~i~~~D~d~DG~IdF~EF~~lm~~l~~~   87 (121)
T 4drw_A           60 IMKDLDQCRDGKVGFQSFFSLIAGLTIA   87 (121)
T ss_dssp             HHHHHCTTCSSCCCHHHHHHHHHHHHHH
T ss_pred             HHHHHcCCCCCcCcHHHHHHHHHHHHHH
Confidence            4789999999999999999999998765



>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 92
d3c1va193 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sa 3e-06
d1cb1a_78 a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax 4e-06
d1a4pa_92 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 5e-06
d1k8ua_89 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 5e-06
d1zfsa193 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus no 6e-06
d1ksoa_93 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 7e-06
d1xk4a187 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sa 1e-05
d1e8aa_87 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 2e-05
d1yuta198 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sa 3e-05
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 4e-05
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 5e-05
d1bjfa_181 a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId 6e-05
d1j55a_94 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 6e-05
d1snla_99 a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo 7e-05
d1xo5a_180 a.39.1.5 (A:) Calcium- and integrin-binding protei 7e-05
d3cr5x190 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos tauru 7e-05
d1qlsa_95 a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), 8e-05
d1psra_100 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 8e-05
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 8e-05
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 1e-04
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 1e-04
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 1e-04
d1xk4c183 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sa 1e-04
d1s6ca_178 a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera 2e-04
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 2e-04
d1m45a_146 a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's ye 2e-04
d2zfda1183 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 { 2e-04
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 2e-04
d1dtla_156 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 2e-04
d1jbaa_189 a.39.1.5 (A:) Guanylate cyclase activating protein 2e-04
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 4e-04
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 4e-04
d1uhka1187 a.39.1.5 (A:3-189) Calcium-regulated photoprotein 4e-04
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 4e-04
d1omra_201 a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 4e-04
d1jfja_134 a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histoly 4e-04
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 5e-04
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 5e-04
d1auib_165 a.39.1.5 (B:) Calcineurin regulatory subunit (B-ch 6e-04
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 6e-04
d1qv0a_189 a.39.1.5 (A:) Calcium-regulated photoprotein {Hydr 7e-04
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 0.001
d2fcea161 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ 0.001
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 0.001
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 0.001
d1nyaa_176 a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth 0.001
d1wdcb_142 a.39.1.5 (B:) Myosin Essential Chain {Bay scallop 0.002
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 0.002
d1fw4a_65 a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 0.003
d1w7jb1139 a.39.1.5 (B:11-149) Myosin Essential Chain {Human 0.004
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Length = 93 Back     information, alignment and structure

class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: S100 proteins
domain: Calcyclin (S100)
species: Human (Homo sapiens), s100a4 [TaxId: 9606]
 Score = 39.5 bits (92), Expect = 3e-06
 Identities = 8/26 (30%), Positives = 14/26 (53%)

Query: 1  MMKECDLNLDGELDHEEFVKFIQKLT 26
          +M   D N D E+D +E+  F+  + 
Sbjct: 57 LMSNLDSNRDNEVDFQEYCVFLSCIA 82


>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Length = 90 Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Length = 95 Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 183 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Length = 134 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Length = 189 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 142 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query92
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.49
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 98.46
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 98.45
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.39
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.39
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.37
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 98.32
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.29
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.29
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.28
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.27
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.22
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.08
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 98.03
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 97.59
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 97.55
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 97.52
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 97.43
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 97.4
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 97.34
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 97.31
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.27
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.24
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 97.09
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 97.07
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 97.01
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 96.91
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 96.85
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 96.8
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 96.77
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 96.75
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 96.67
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 96.66
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 96.66
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 96.61
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 96.58
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 96.58
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 96.55
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 96.43
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 96.27
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 96.17
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 96.1
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 95.95
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 95.9
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 95.77
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 95.77
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 95.73
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 95.69
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 95.63
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 95.61
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 95.57
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 95.54
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 95.52
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 95.52
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 95.51
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 95.33
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 95.28
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 95.27
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 95.25
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 95.23
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 95.19
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 95.15
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 95.1
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 95.06
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 95.05
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 94.75
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 94.71
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 94.63
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 94.61
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 94.48
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 94.42
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 94.38
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 94.21
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 94.17
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 94.12
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 94.06
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 94.02
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 94.01
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 93.85
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 93.83
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 93.78
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 93.67
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 93.63
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 93.42
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 93.34
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 93.32
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 93.32
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 93.2
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 93.11
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 93.09
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 92.69
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 92.66
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 92.61
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 92.59
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 92.38
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 92.32
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 92.32
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 92.15
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 92.15
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 91.89
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 91.67
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 91.42
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 91.2
d1ij5a_ 321 Cbp40 (plasmodial specific CaII-binding protein LA 90.87
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 90.56
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 90.48
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 90.4
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 89.86
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 89.64
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 89.46
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 89.18
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 88.94
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 88.85
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 88.82
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 88.74
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 88.12
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 87.29
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 86.77
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 86.58
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 86.11
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 85.9
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 85.38
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 84.96
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 84.69
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 84.44
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 84.3
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 83.69
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 83.66
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 82.53
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 82.03
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: S100 proteins
domain: Calcyclin (S100)
species: Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]
Probab=98.49  E-value=1.5e-08  Score=64.06  Aligned_cols=28  Identities=21%  Similarity=0.437  Sum_probs=25.6

Q ss_pred             CcccccccCCCCcCHHHHHHHHHHHHhh
Q 034525            1 MMKECDLNLDGELDHEEFVKFIQKLTSD   28 (92)
Q Consensus         1 imk~lD~N~DgeIdfeEF~~fi~~l~~~   28 (92)
                      +|+++|.|+||+|||+||+.+|++++..
T Consensus        56 ~~~~lD~n~Dg~idF~EF~~li~~l~~~   83 (87)
T d1e8aa_          56 IFQGLDANQDEQVDFQEFISLVAIALKA   83 (87)
T ss_dssp             HHHHHCTTCSSCEEHHHHHHHHHHHHHH
T ss_pred             HHHHHcCCCCCcCCHHHHHHHHHHHHHH
Confidence            4789999999999999999999998765



>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure