Citrus Sinensis ID: 034552
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 91 | ||||||
| 302121708 | 178 | RimL/acetyltransferase-domain protein [H | 0.989 | 0.505 | 0.8 | 4e-36 | |
| 225447610 | 195 | PREDICTED: N-acetyltransferase 9-like pr | 0.967 | 0.451 | 0.772 | 1e-32 | |
| 255582437 | 197 | expressed protein, putative [Ricinus com | 0.967 | 0.446 | 0.738 | 3e-32 | |
| 224129110 | 196 | predicted protein [Populus trichocarpa] | 0.967 | 0.448 | 0.727 | 4e-31 | |
| 218192251 | 210 | hypothetical protein OsI_10366 [Oryza sa | 0.967 | 0.419 | 0.727 | 7e-31 | |
| 108706642 | 210 | acetyltransferase, GNAT family protein, | 0.967 | 0.419 | 0.727 | 7e-31 | |
| 242041903 | 215 | hypothetical protein SORBIDRAFT_01g04419 | 0.967 | 0.409 | 0.693 | 4e-30 | |
| 297835786 | 214 | hypothetical protein ARALYDRAFT_480115 [ | 0.967 | 0.411 | 0.738 | 5e-30 | |
| 449453590 | 201 | PREDICTED: N-acetyltransferase 9-like pr | 0.967 | 0.437 | 0.738 | 7e-30 | |
| 326532844 | 216 | predicted protein [Hordeum vulgare subsp | 0.967 | 0.407 | 0.693 | 1e-29 |
| >gi|302121708|gb|ADK92874.1| RimL/acetyltransferase-domain protein [Hypericum perforatum] | Back alignment and taxonomy information |
|---|
Score = 154 bits (390), Expect = 4e-36, Method: Compositional matrix adjust.
Identities = 72/90 (80%), Positives = 82/90 (91%)
Query: 1 MVGDVNIYMNDLDNLELAEVEIMIAEPKSRGKGLAKDAVLMMMAYAVENFGIHVFRAKIG 60
MVGDVNIYMNDLD+ +LAEVEIMIAEPKSRGKGL K+ VLMMMAYAV+N GIHVFR+KIG
Sbjct: 61 MVGDVNIYMNDLDDPQLAEVEIMIAEPKSRGKGLGKETVLMMMAYAVQNLGIHVFRSKIG 120
Query: 61 ESNGASLRLFQKLGFEDISYSEIFKEAVDS 90
E+NGASL+LF KLGF ++S SEIFKE +DS
Sbjct: 121 ETNGASLQLFHKLGFAEVSRSEIFKETLDS 150
|
Source: Hypericum perforatum Species: Hypericum perforatum Genus: Hypericum Family: Hypericaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225447610|ref|XP_002273149.1| PREDICTED: N-acetyltransferase 9-like protein [Vitis vinifera] gi|296084990|emb|CBI28405.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255582437|ref|XP_002532006.1| expressed protein, putative [Ricinus communis] gi|223528337|gb|EEF30379.1| expressed protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224129110|ref|XP_002320503.1| predicted protein [Populus trichocarpa] gi|222861276|gb|EEE98818.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|218192251|gb|EEC74678.1| hypothetical protein OsI_10366 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
| >gi|108706642|gb|ABF94437.1| acetyltransferase, GNAT family protein, expressed [Oryza sativa Japonica Group] gi|222624361|gb|EEE58493.1| hypothetical protein OsJ_09757 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|242041903|ref|XP_002468346.1| hypothetical protein SORBIDRAFT_01g044190 [Sorghum bicolor] gi|241922200|gb|EER95344.1| hypothetical protein SORBIDRAFT_01g044190 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|297835786|ref|XP_002885775.1| hypothetical protein ARALYDRAFT_480115 [Arabidopsis lyrata subsp. lyrata] gi|297331615|gb|EFH62034.1| hypothetical protein ARALYDRAFT_480115 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|449453590|ref|XP_004144539.1| PREDICTED: N-acetyltransferase 9-like protein-like [Cucumis sativus] gi|449506903|ref|XP_004162879.1| PREDICTED: N-acetyltransferase 9-like protein-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|326532844|dbj|BAJ89267.1| predicted protein [Hordeum vulgare subsp. vulgare] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 91 | ||||||
| TAIR|locus:505006237 | 218 | AT2G04845 "AT2G04845" [Arabido | 0.945 | 0.394 | 0.732 | 2.4e-28 | |
| UNIPROTKB|J3KT72 | 212 | NAT9 "N-acetyltransferase 9" [ | 0.945 | 0.405 | 0.534 | 1.9e-21 | |
| UNIPROTKB|J3QRC3 | 183 | NAT9 "N-acetyltransferase 9" [ | 0.945 | 0.469 | 0.534 | 1.9e-21 | |
| UNIPROTKB|J3QRL7 | 211 | NAT9 "N-acetyltransferase 9" [ | 0.945 | 0.407 | 0.534 | 1.9e-21 | |
| UNIPROTKB|Q9BTE0 | 207 | NAT9 "N-acetyltransferase 9" [ | 0.945 | 0.415 | 0.534 | 1.9e-21 | |
| UNIPROTKB|F1RV66 | 206 | NAT9 "Uncharacterized protein" | 0.945 | 0.417 | 0.511 | 1.7e-20 | |
| UNIPROTKB|F1NS03 | 212 | NAT9 "Uncharacterized protein" | 0.945 | 0.405 | 0.511 | 5.7e-20 | |
| UNIPROTKB|J3QQP3 | 202 | NAT9 "N-acetyltransferase 9" [ | 0.890 | 0.400 | 0.523 | 2.5e-19 | |
| UNIPROTKB|F6RX64 | 207 | NAT9 "Uncharacterized protein" | 0.945 | 0.415 | 0.505 | 4e-19 | |
| RGD|1307096 | 241 | Nat9 "N-acetyltransferase 9 (G | 0.945 | 0.356 | 0.476 | 1.1e-18 |
| TAIR|locus:505006237 AT2G04845 "AT2G04845" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 316 (116.3 bits), Expect = 2.4e-28, P = 2.4e-28
Identities = 63/86 (73%), Positives = 74/86 (86%)
Query: 1 MVGDVNIYMNDLDNLELAEVEIMIAEPKSRGKGLAKDAVLMMMAYAVENFGIHVFRAKIG 60
M GDVNIYMND+D+ ++AEVEIMIAEP+SRGKGL K++VL+MMAY V+N IH F AKIG
Sbjct: 90 MTGDVNIYMNDVDDPKVAEVEIMIAEPRSRGKGLGKESVLIMMAYGVKNLEIHKFTAKIG 149
Query: 61 ESNGASLRLFQKLGFEDISYSEIFKE 86
ESN ASL LF+KLGFE+ SYS IFKE
Sbjct: 150 ESNTASLSLFRKLGFEESSYSGIFKE 175
|
|
| UNIPROTKB|J3KT72 NAT9 "N-acetyltransferase 9" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3QRC3 NAT9 "N-acetyltransferase 9" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3QRL7 NAT9 "N-acetyltransferase 9" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9BTE0 NAT9 "N-acetyltransferase 9" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RV66 NAT9 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NS03 NAT9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3QQP3 NAT9 "N-acetyltransferase 9" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6RX64 NAT9 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|1307096 Nat9 "N-acetyltransferase 9 (GCN5-related, putative)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 91 | |||
| pfam13302 | 136 | pfam13302, Acetyltransf_3, Acetyltransferase (GNAT | 5e-14 | |
| COG1670 | 187 | COG1670, RimL, Acetyltransferases, including N-ace | 4e-10 | |
| pfam00583 | 80 | pfam00583, Acetyltransf_1, Acetyltransferase (GNAT | 1e-06 | |
| COG1247 | 169 | COG1247, COG1247, Sortase and related acyltransfer | 1e-06 | |
| pfam13420 | 154 | pfam13420, Acetyltransf_4, Acetyltransferase (GNAT | 4e-06 | |
| pfam08445 | 86 | pfam08445, FR47, FR47-like protein | 4e-05 | |
| TIGR02406 | 157 | TIGR02406, ectoine_EctA, diaminobutyrate acetyltra | 3e-04 | |
| PRK15130 | 186 | PRK15130, PRK15130, spermidine N1-acetyltransferas | 0.002 |
| >gnl|CDD|222034 pfam13302, Acetyltransf_3, Acetyltransferase (GNAT) domain | Back alignment and domain information |
|---|
Score = 62.0 bits (151), Expect = 5e-14
Identities = 24/76 (31%), Positives = 41/76 (53%), Gaps = 5/76 (6%)
Query: 1 MVGDVNIYMNDLDNLELAEVEIMIAEPKSRGKGLAKDAVLMMMAYAVENFGIHVFRAKIG 60
+G + +++ D + AE+ + P+ GKG A +A ++ YA E G+ A+I
Sbjct: 66 FIGTIGLHIPDDE----AEIGYWLG-PEYWGKGYATEAARALLDYAFEELGLDRIVARID 120
Query: 61 ESNGASLRLFQKLGFE 76
N AS R+ +KLGF+
Sbjct: 121 PENIASQRVLEKLGFK 136
|
This domain catalyzes N-acetyltransferase reactions. Length = 136 |
| >gnl|CDD|224584 COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|216007 pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family | Back alignment and domain information |
|---|
| >gnl|CDD|224168 COG1247, COG1247, Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|222116 pfam13420, Acetyltransf_4, Acetyltransferase (GNAT) domain | Back alignment and domain information |
|---|
| >gnl|CDD|117022 pfam08445, FR47, FR47-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|131459 TIGR02406, ectoine_EctA, diaminobutyrate acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|237916 PRK15130, PRK15130, spermidine N1-acetyltransferase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 91 | |||
| PF00583 | 83 | Acetyltransf_1: Acetyltransferase (GNAT) family; I | 99.81 | |
| KOG3139 | 165 | consensus N-acetyltransferase [General function pr | 99.81 | |
| TIGR02382 | 191 | wecD_rffC TDP-D-fucosamine acetyltransferase. This | 99.78 | |
| PRK10809 | 194 | ribosomal-protein-S5-alanine N-acetyltransferase; | 99.77 | |
| PRK10151 | 179 | ribosomal-protein-L7/L12-serine acetyltransferase; | 99.76 | |
| TIGR02406 | 157 | ectoine_EctA L-2,4-diaminobutyric acid acetyltrans | 99.75 | |
| PRK10975 | 194 | TDP-fucosamine acetyltransferase; Provisional | 99.74 | |
| PRK10146 | 144 | aminoalkylphosphonic acid N-acetyltransferase; Pro | 99.74 | |
| COG1670 | 187 | RimL Acetyltransferases, including N-acetylases of | 99.73 | |
| PRK10140 | 162 | putative acetyltransferase YhhY; Provisional | 99.73 | |
| PF13302 | 142 | Acetyltransf_3: Acetyltransferase (GNAT) domain; P | 99.73 | |
| TIGR01575 | 131 | rimI ribosomal-protein-alanine acetyltransferase. | 99.72 | |
| PRK15130 | 186 | spermidine N1-acetyltransferase; Provisional | 99.72 | |
| PF13420 | 155 | Acetyltransf_4: Acetyltransferase (GNAT) domain; P | 99.71 | |
| PRK09491 | 146 | rimI ribosomal-protein-alanine N-acetyltransferase | 99.71 | |
| PRK03624 | 140 | putative acetyltransferase; Provisional | 99.71 | |
| COG0456 | 177 | RimI Acetyltransferases [General function predicti | 99.71 | |
| TIGR03585 | 156 | PseH pseudaminic acid biosynthesis N-acetyl transf | 99.7 | |
| PF13523 | 152 | Acetyltransf_8: Acetyltransferase (GNAT) domain; P | 99.68 | |
| PTZ00330 | 147 | acetyltransferase; Provisional | 99.68 | |
| TIGR03448 | 292 | mycothiol_MshD mycothiol biosynthesis acetyltransf | 99.66 | |
| PLN02706 | 150 | glucosamine 6-phosphate N-acetyltransferase | 99.65 | |
| TIGR03827 | 266 | GNAT_ablB putative beta-lysine N-acetyltransferase | 99.64 | |
| PRK10314 | 153 | putative acyltransferase; Provisional | 99.64 | |
| PF08445 | 86 | FR47: FR47-like protein; InterPro: IPR013653 Prote | 99.6 | |
| TIGR03103 | 547 | trio_acet_GNAT GNAT-family acetyltransferase TIGR0 | 99.6 | |
| PF13508 | 79 | Acetyltransf_7: Acetyltransferase (GNAT) domain; P | 99.59 | |
| KOG4135 | 185 | consensus Predicted phosphoglucosamine acetyltrans | 99.57 | |
| PRK07757 | 152 | acetyltransferase; Provisional | 99.57 | |
| KOG3216 | 163 | consensus Diamine acetyltransferase [Amino acid tr | 99.56 | |
| PRK07922 | 169 | N-acetylglutamate synthase; Validated | 99.54 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 99.54 | |
| PF13673 | 117 | Acetyltransf_10: Acetyltransferase (GNAT) domain; | 99.53 | |
| PHA01807 | 153 | hypothetical protein | 99.53 | |
| PRK10514 | 145 | putative acetyltransferase; Provisional | 99.51 | |
| PHA00673 | 154 | acetyltransferase domain containing protein | 99.49 | |
| PRK10562 | 145 | putative acetyltransferase; Provisional | 99.49 | |
| COG1247 | 169 | Sortase and related acyltransferases [Cell envelop | 99.47 | |
| PRK12308 | 614 | bifunctional argininosuccinate lyase/N-acetylgluta | 99.47 | |
| PLN02825 | 515 | amino-acid N-acetyltransferase | 99.46 | |
| COG1246 | 153 | ArgA N-acetylglutamate synthase and related acetyl | 99.45 | |
| KOG2488 | 202 | consensus Acetyltransferase (GNAT) domain-containi | 99.44 | |
| PRK05279 | 441 | N-acetylglutamate synthase; Validated | 99.44 | |
| cd02169 | 297 | Citrate_lyase_ligase Citrate lyase ligase. Citrate | 99.43 | |
| TIGR03448 | 292 | mycothiol_MshD mycothiol biosynthesis acetyltransf | 99.42 | |
| TIGR01890 | 429 | N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi | 99.4 | |
| COG3393 | 268 | Predicted acetyltransferase [General function pred | 99.38 | |
| KOG3397 | 225 | consensus Acetyltransferases [General function pre | 99.36 | |
| PRK09831 | 147 | putative acyltransferase; Provisional | 99.36 | |
| PF13527 | 127 | Acetyltransf_9: Acetyltransferase (GNAT) domain; P | 99.36 | |
| PRK13688 | 156 | hypothetical protein; Provisional | 99.34 | |
| PF08444 | 89 | Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acylt | 99.34 | |
| KOG3138 | 187 | consensus Predicted N-acetyltransferase [General f | 99.29 | |
| KOG3396 | 150 | consensus Glucosamine-phosphate N-acetyltransferas | 99.27 | |
| COG3981 | 174 | Predicted acetyltransferase [General function pred | 99.24 | |
| KOG3235 | 193 | consensus Subunit of the major N alpha-acetyltrans | 99.23 | |
| TIGR00124 | 332 | cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP | 99.23 | |
| COG3153 | 171 | Predicted acetyltransferase [General function pred | 99.21 | |
| COG2153 | 155 | ElaA Predicted acyltransferase [General function p | 99.2 | |
| TIGR01211 | 522 | ELP3 histone acetyltransferase, ELP3 family. The S | 99.18 | |
| PRK01346 | 411 | hypothetical protein; Provisional | 99.17 | |
| KOG3234 | 173 | consensus Acetyltransferase, (GNAT) family [Genera | 99.16 | |
| cd04301 | 65 | NAT_SF N-Acyltransferase superfamily: Various enzy | 99.05 | |
| PF12746 | 265 | GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S | 99.0 | |
| PF13718 | 196 | GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2Z | 98.91 | |
| KOG4144 | 190 | consensus Arylalkylamine N-acetyltransferase [Gene | 98.79 | |
| COG3818 | 167 | Predicted acetyltransferase, GNAT superfamily [Gen | 98.71 | |
| COG1444 | 758 | Predicted P-loop ATPase fused to an acetyltransfer | 98.62 | |
| PF14542 | 78 | Acetyltransf_CG: GCN5-related N-acetyl-transferase | 98.58 | |
| COG0454 | 156 | WecD Histone acetyltransferase HPA2 and related ac | 98.36 | |
| COG4552 | 389 | Eis Predicted acetyltransferase involved in intrac | 98.33 | |
| PF12568 | 128 | DUF3749: Acetyltransferase (GNAT) domain; InterPro | 98.17 | |
| COG2388 | 99 | Predicted acetyltransferase [General function pred | 98.01 | |
| COG3053 | 352 | CitC Citrate lyase synthetase [Energy production a | 97.96 | |
| COG5628 | 143 | Predicted acetyltransferase [General function pred | 97.86 | |
| PF13880 | 70 | Acetyltransf_13: ESCO1/2 acetyl-transferase | 97.55 | |
| PF00765 | 182 | Autoind_synth: Autoinducer synthetase; InterPro: I | 97.4 | |
| PRK13834 | 207 | putative autoinducer synthesis protein; Provisiona | 97.38 | |
| TIGR03694 | 241 | exosort_acyl putative PEP-CTERM/exosortase system- | 97.35 | |
| PF05301 | 120 | Mec-17: Touch receptor neuron protein Mec-17; Inte | 97.24 | |
| COG1243 | 515 | ELP3 Histone acetyltransferase [Transcription / Ch | 97.21 | |
| PF06852 | 181 | DUF1248: Protein of unknown function (DUF1248); In | 97.2 | |
| KOG2535 | 554 | consensus RNA polymerase II elongator complex, sub | 97.13 | |
| COG3882 | 574 | FkbH Predicted enzyme involved in methoxymalonyl-A | 97.1 | |
| COG2401 | 593 | ABC-type ATPase fused to a predicted acetyltransfe | 96.87 | |
| cd04264 | 99 | DUF619-NAGS DUF619 domain of various N-acetylgluta | 96.75 | |
| cd04265 | 99 | DUF619-NAGS-U DUF619 domain of various N-acetylglu | 96.39 | |
| PF11039 | 151 | DUF2824: Protein of unknown function (DUF2824); In | 96.31 | |
| PF01853 | 188 | MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz i | 96.26 | |
| COG3375 | 266 | Uncharacterized conserved protein [Function unknow | 95.86 | |
| PF01233 | 162 | NMT: Myristoyl-CoA:protein N-myristoyltransferase, | 95.81 | |
| KOG4601 | 264 | consensus Uncharacterized conserved protein [Funct | 95.75 | |
| PF13480 | 142 | Acetyltransf_6: Acetyltransferase (GNAT) domain | 95.64 | |
| COG3916 | 209 | LasI N-acyl-L-homoserine lactone synthetase [Signa | 95.58 | |
| KOG2696 | 403 | consensus Histone acetyltransferase type b catalyt | 95.54 | |
| KOG2747 | 396 | consensus Histone acetyltransferase (MYST family) | 95.54 | |
| TIGR03827 | 266 | GNAT_ablB putative beta-lysine N-acetyltransferase | 95.31 | |
| KOG2036 | 1011 | consensus Predicted P-loop ATPase fused to an acet | 94.96 | |
| PHA01733 | 153 | hypothetical protein | 94.96 | |
| PLN03238 | 290 | probable histone acetyltransferase MYST; Provision | 94.94 | |
| PF11090 | 86 | DUF2833: Protein of unknown function (DUF2833); In | 94.79 | |
| PLN03239 | 351 | histone acetyltransferase; Provisional | 94.55 | |
| PF02474 | 196 | NodA: Nodulation protein A (NodA); InterPro: IPR00 | 93.92 | |
| PF04377 | 128 | ATE_C: Arginine-tRNA-protein transferase, C termin | 93.65 | |
| PTZ00064 | 552 | histone acetyltransferase; Provisional | 93.64 | |
| PHA00432 | 137 | internal virion protein A | 93.47 | |
| PLN00104 | 450 | MYST -like histone acetyltransferase; Provisional | 93.46 | |
| PRK14852 | 989 | hypothetical protein; Provisional | 92.87 | |
| TIGR03019 | 330 | pepcterm_femAB FemAB-related protein, PEP-CTERM sy | 92.59 | |
| PF04768 | 170 | DUF619: Protein of unknown function (DUF619); Inte | 92.46 | |
| PF04958 | 342 | AstA: Arginine N-succinyltransferase beta subunit; | 92.28 | |
| KOG3698 | 891 | consensus Hyaluronoglucosaminidase [Posttranslatio | 92.15 | |
| PRK01305 | 240 | arginyl-tRNA-protein transferase; Provisional | 91.57 | |
| TIGR03243 | 335 | arg_catab_AOST arginine and ornithine succinyltran | 91.26 | |
| PHA02769 | 154 | hypothetical protein; Provisional | 91.02 | |
| TIGR03245 | 336 | arg_AOST_alph arginine/ornithine succinyltransfera | 91.0 | |
| PF13444 | 101 | Acetyltransf_5: Acetyltransferase (GNAT) domain | 90.53 | |
| TIGR03244 | 336 | arg_catab_AstA arginine N-succinyltransferase. In | 90.52 | |
| PRK10456 | 344 | arginine succinyltransferase; Provisional | 90.48 | |
| COG2935 | 253 | Putative arginyl-tRNA:protein arginylyltransferase | 89.91 | |
| cd04266 | 108 | DUF619-NAGS-FABP DUF619 domain of N-acetylglutamat | 89.46 | |
| COG5027 | 395 | SAS2 Histone acetyltransferase (MYST family) [Chro | 89.11 | |
| PF12261 | 179 | T_hemolysin: Thermostable hemolysin; InterPro: IPR | 88.62 | |
| KOG4387 | 191 | consensus Ornithine decarboxylase antizyme [Amino | 87.85 | |
| PRK00756 | 196 | acyltransferase NodA; Provisional | 86.75 | |
| cd07235 | 122 | MRD Mitomycin C resistance protein (MRD). Mitomyci | 83.51 | |
| cd08356 | 113 | Glo_EDI_BRP_like_17 This conserved domain belongs | 82.27 | |
| cd08353 | 142 | Glo_EDI_BRP_like_7 This conserved domain belongs t | 80.15 |
| >PF00583 Acetyltransf_1: Acetyltransferase (GNAT) family; InterPro: IPR000182 The N-acetyltransferases (NAT) (EC 2 | Back alignment and domain information |
|---|
Probab=99.81 E-value=7.3e-19 Score=88.64 Aligned_cols=75 Identities=24% Similarity=0.357 Sum_probs=69.1
Q ss_pred CccceEEEeecCCC--cCceeeEEeeeCccccCcchHHHHHHHHHHHHHhhcCccEEEEEecCCcHHHHHHHHhcCce
Q 034552 1 MVGDVNIYMNDLDN--LELAEVEIMIAEPKSRGKGLAKDAVLMMMAYAVENFGIHVFRAKIGESNGASLRLFQKLGFE 76 (91)
Q Consensus 1 ~VG~~~~~~~~~~~--~~~~~i~~~~v~~~~r~~G~g~~l~~~~~~~~~~~~~~~~v~~~~~~~n~~~~~~~~~~Gf~ 76 (91)
+||++.+....... +..+.|..+.|+|+||++|+|+.|++.++++++ +.+++.+.+.+...|..+++||+++||+
T Consensus 7 ivg~~~~~~~~~~~~~~~~~~i~~~~v~~~~r~~Gig~~L~~~~~~~~~-~~g~~~i~~~~~~~n~~~~~~~~k~Gf~ 83 (83)
T PF00583_consen 7 IVGFASLRPPPEPFDHGNHAYIHRLAVDPEYRGQGIGSKLLQAAEEWAR-KRGIKRIYLDVSPDNPAARRFYEKLGFE 83 (83)
T ss_dssp EEEEEEEEEEETTTTTTTEEEEEEEEECGGGTTSSHHHHHHHHHHHHHH-HTTESEEEEEEETTGHHHHHHHHHTTEE
T ss_pred EEEEEEEEECCCccccCCEEEEEEEEEcHHHhhCCCchhhhhhhhhhHH-hcCccEEEEEEeCCCHHHHHHHHHcCCC
Confidence 58888888877542 478999999999999999999999999999999 6999999999999999999999999996
|
3.1.-) are enzymes that use acetyl coenzyme A (CoA) to transfer an acetyl group to a substrate, a reaction implicated in various functions from bacterial antibiotic resistance to mammalian circadian rhythm and chromatin remodeling. The Gcn5-related N-acetyltransferases (GNAT) catalyze the transfer of the acetyl from the CoA donor to a primary amine of the acceptor. The GNAT proteins share a domain composed of four conserved sequence motifs A-D [, ]. This GNAT domain is named after yeast GCN5 (from General Control Nonrepressed) and related histone acetyltransferases (HATs) like Hat1 and PCAF. HATs acetylate lysine residues of amino terminal histone tails, resulting in transcription activation. Another category of GNAT, the aminoglycoside N-acetyltransferases, confer antibiotic resistance by catalyzing the acetylation of amino groups in aminoglycoside antibiotics []. GNAT proteins can also have anabolic and catabolic functions in both prokaryotes and eukaryotes [, , , , ]. The acetyltransferase/GNAT domain forms a structurally conserved fold of 6 to 7 beta strands (B) and 4 helices (H) in the topology B1-H1-H2-B2-B3-B4-H3-B5-H4-B6, followed by a C-terminal strand which may be from the same monomer or contributed by another [, ]. Motifs D (B2-B3), A (B4-H3) and B (B5-H4) are collectively called the HAT core [, , ], while the N-terminal motif C (B1-H1) is less conserved. Some proteins known to contain a GNAT domain: Yeast GCN5 and Hat1, which are histone acetyltransferases (EC 2.3.1.48). Human PCAF, a histone acetyltransferase. Mammalian serotonin N-acetyltransferase (SNAT) or arylalkylamine NAT (AANAT), which acetylates serotonin into a circadian neurohormone that may participate in light-dark rhythms, and human mood and behavior. Mammalian glucosamine 6-phosphate N-acetyltransferase (GNA1) (EC 2.3.1.4). Escherichia coli rimI and rimJ, which acetylate the N-terminal alanine of ribosomal proteins S18 and S5, respectively (EC 2.3.1.128). Mycobacterium tuberculosis aminoglycoside 2'-N-acetyltransferase (aac), which acetylates the 2' hydroxyl or amino group of a broad spectrum of aminoglycoside antibiotics. Bacillus subtilis bltD and paiA, which acetylate spermine and spermidine. This entry represents the entire GNAT domain.; GO: 0008080 N-acetyltransferase activity, 0008152 metabolic process; PDB: 3T9Y_A 2R7H_B 2OZH_A 1Y9W_B 1VKC_B 2OH1_C 3R9E_B 3R9G_B 3R9F_A 3R96_A .... |
| >KOG3139 consensus N-acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase | Back alignment and domain information |
|---|
| >PRK10809 ribosomal-protein-S5-alanine N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10151 ribosomal-protein-L7/L12-serine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02406 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferase | Back alignment and domain information |
|---|
| >PRK10975 TDP-fucosamine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1670 RimL Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK10140 putative acetyltransferase YhhY; Provisional | Back alignment and domain information |
|---|
| >PF13302 Acetyltransf_3: Acetyltransferase (GNAT) domain; PDB: 3TTH_C 3JUW_A 2ZXV_A 2Z0Z_A 2VI7_B 3EG7_F 1YRE_C 3IGR_B 3FBU_A 2FCK_A | Back alignment and domain information |
|---|
| >TIGR01575 rimI ribosomal-protein-alanine acetyltransferase | Back alignment and domain information |
|---|
| >PRK15130 spermidine N1-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13420 Acetyltransf_4: Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A | Back alignment and domain information |
|---|
| >PRK09491 rimI ribosomal-protein-alanine N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK03624 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0456 RimI Acetyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03585 PseH pseudaminic acid biosynthesis N-acetyl transferase | Back alignment and domain information |
|---|
| >PF13523 Acetyltransf_8: Acetyltransferase (GNAT) domain; PDB: 2VQY_A 2BUE_A 1V0C_A 1YK3_D 2PR8_A 2QIR_A 2PRB_A 2QML_A 2PC1_A | Back alignment and domain information |
|---|
| >PTZ00330 acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase | Back alignment and domain information |
|---|
| >PLN02706 glucosamine 6-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK10314 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF08445 FR47: FR47-like protein; InterPro: IPR013653 Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 (Q9VR51 from SWISSPROT) | Back alignment and domain information |
|---|
| >TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 | Back alignment and domain information |
|---|
| >PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A | Back alignment and domain information |
|---|
| >KOG4135 consensus Predicted phosphoglucosamine acetyltransferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07757 acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG3216 consensus Diamine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07922 N-acetylglutamate synthase; Validated | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A | Back alignment and domain information |
|---|
| >PHA01807 hypothetical protein | Back alignment and domain information |
|---|
| >PRK10514 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PHA00673 acetyltransferase domain containing protein | Back alignment and domain information |
|---|
| >PRK10562 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1247 Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional | Back alignment and domain information |
|---|
| >PLN02825 amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >COG1246 ArgA N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2488 consensus Acetyltransferase (GNAT) domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05279 N-acetylglutamate synthase; Validated | Back alignment and domain information |
|---|
| >cd02169 Citrate_lyase_ligase Citrate lyase ligase | Back alignment and domain information |
|---|
| >TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase | Back alignment and domain information |
|---|
| >TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >COG3393 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3397 consensus Acetyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09831 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13527 Acetyltransf_9: Acetyltransferase (GNAT) domain; PDB: 3SXN_C 2I00_D 1M4D_B 1M44_A 1M4G_B 1M4I_A 2OZG_A 2HV2_F 3N7Z_A 3RYO_B | Back alignment and domain information |
|---|
| >PRK13688 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF08444 Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region; InterPro: IPR013652 This entry represents mammalian-specific glycine N-acyltransferase (also called aralkyl acyl-CoA:amino acid N-acyltransferase; 2 | Back alignment and domain information |
|---|
| >KOG3138 consensus Predicted N-acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3396 consensus Glucosamine-phosphate N-acetyltransferase [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >COG3981 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3235 consensus Subunit of the major N alpha-acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase | Back alignment and domain information |
|---|
| >COG3153 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG2153 ElaA Predicted acyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01211 ELP3 histone acetyltransferase, ELP3 family | Back alignment and domain information |
|---|
| >PRK01346 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3234 consensus Acetyltransferase, (GNAT) family [General function prediction only] | Back alignment and domain information |
|---|
| >cd04301 NAT_SF N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate | Back alignment and domain information |
|---|
| >PF12746 GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S_B | Back alignment and domain information |
|---|
| >PF13718 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2ZPA_B | Back alignment and domain information |
|---|
| >KOG4144 consensus Arylalkylamine N-acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG3818 Predicted acetyltransferase, GNAT superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF14542 Acetyltransf_CG: GCN5-related N-acetyl-transferase; PDB: 2H5M_A 2Q44_A 1XMT_A 2Q4Y_A 2IL4_A 2EVN_A 1R57_A | Back alignment and domain information |
|---|
| >COG0454 WecD Histone acetyltransferase HPA2 and related acetyltransferases [Transcription / General function prediction only] | Back alignment and domain information |
|---|
| >COG4552 Eis Predicted acetyltransferase involved in intracellular survival and related acetyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PF12568 DUF3749: Acetyltransferase (GNAT) domain; InterPro: IPR024612 This domain is found in uncharacterised proteins from Gammaproteobacteria, and is approximately 40 amino acids in length | Back alignment and domain information |
|---|
| >COG2388 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG3053 CitC Citrate lyase synthetase [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG5628 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF13880 Acetyltransf_13: ESCO1/2 acetyl-transferase | Back alignment and domain information |
|---|
| >PF00765 Autoind_synth: Autoinducer synthetase; InterPro: IPR001690 Bacterial species have many methods of controlling gene expression and cell growth | Back alignment and domain information |
|---|
| >PRK13834 putative autoinducer synthesis protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03694 exosort_acyl putative PEP-CTERM/exosortase system-associated acyltransferase | Back alignment and domain information |
|---|
| >PF05301 Mec-17: Touch receptor neuron protein Mec-17; InterPro: IPR007965 Mec-17 is the protein product of one of the 18 genes required for the development and function of the touch receptor neuron for gentle touch | Back alignment and domain information |
|---|
| >COG1243 ELP3 Histone acetyltransferase [Transcription / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF06852 DUF1248: Protein of unknown function (DUF1248); InterPro: IPR009658 This entry represents a conserved region within a number of proteins of unknown function that seem to be specific to Caenorhabditis elegans | Back alignment and domain information |
|---|
| >KOG2535 consensus RNA polymerase II elongator complex, subunit ELP3/histone acetyltransferase [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd04264 DUF619-NAGS DUF619 domain of various N-acetylglutamate Synthases of the fungal arginine-biosynthetic pathway and urea cycle found in humans and fish | Back alignment and domain information |
|---|
| >cd04265 DUF619-NAGS-U DUF619 domain of various N-acetylglutamate Synthases (NAGS) of the urea (U) cycle of humans and fish | Back alignment and domain information |
|---|
| >PF11039 DUF2824: Protein of unknown function (DUF2824); InterPro: IPR022568 This family of proteins has no known function | Back alignment and domain information |
|---|
| >PF01853 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz is a monocytic leukemia Zn_finger protein and the SAS protein from Saccharomyces cerevisiae (Baker's yeast) is involved in silencing the Hmr locus | Back alignment and domain information |
|---|
| >COG3375 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF01233 NMT: Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain; InterPro: IPR022676 Myristoyl-CoA:protein N-myristoyltransferase (2 | Back alignment and domain information |
|---|
| >KOG4601 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13480 Acetyltransf_6: Acetyltransferase (GNAT) domain | Back alignment and domain information |
|---|
| >COG3916 LasI N-acyl-L-homoserine lactone synthetase [Signal transduction mechanisms / Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >KOG2696 consensus Histone acetyltransferase type b catalytic subunit [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG2747 consensus Histone acetyltransferase (MYST family) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase | Back alignment and domain information |
|---|
| >KOG2036 consensus Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PHA01733 hypothetical protein | Back alignment and domain information |
|---|
| >PLN03238 probable histone acetyltransferase MYST; Provisional | Back alignment and domain information |
|---|
| >PF11090 DUF2833: Protein of unknown function (DUF2833); InterPro: IPR020335 This entry contains proteins with no known function | Back alignment and domain information |
|---|
| >PLN03239 histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF02474 NodA: Nodulation protein A (NodA); InterPro: IPR003484 Rhizobial nodulation (Nod) factors are signalling molecules secreted by root-nodulating rhizobia in response to flavanoids excreted by the host plant | Back alignment and domain information |
|---|
| >PF04377 ATE_C: Arginine-tRNA-protein transferase, C terminus; InterPro: IPR007472 Arginine-tRNA-protein transferase catalyses the post-translational conjugation of arginine to the N terminus of a protein | Back alignment and domain information |
|---|
| >PTZ00064 histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PHA00432 internal virion protein A | Back alignment and domain information |
|---|
| >PLN00104 MYST -like histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14852 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03019 pepcterm_femAB FemAB-related protein, PEP-CTERM system-associated | Back alignment and domain information |
|---|
| >PF04768 DUF619: Protein of unknown function (DUF619); InterPro: IPR006855 This region of unknown function is found at the C terminus of Neurospora crassa acetylglutamate synthase (2 | Back alignment and domain information |
|---|
| >PF04958 AstA: Arginine N-succinyltransferase beta subunit; InterPro: IPR007041 Arginine N-succinyltransferase catalyses the transfer of succinyl-CoA to arginine to produce succinylarginine | Back alignment and domain information |
|---|
| >KOG3698 consensus Hyaluronoglucosaminidase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK01305 arginyl-tRNA-protein transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03243 arg_catab_AOST arginine and ornithine succinyltransferase subunits | Back alignment and domain information |
|---|
| >PHA02769 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03245 arg_AOST_alph arginine/ornithine succinyltransferase, alpha subunit | Back alignment and domain information |
|---|
| >PF13444 Acetyltransf_5: Acetyltransferase (GNAT) domain | Back alignment and domain information |
|---|
| >TIGR03244 arg_catab_AstA arginine N-succinyltransferase | Back alignment and domain information |
|---|
| >PRK10456 arginine succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2935 Putative arginyl-tRNA:protein arginylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd04266 DUF619-NAGS-FABP DUF619 domain of N-acetylglutamate Synthase of the fungal arginine-biosynthetic pathway | Back alignment and domain information |
|---|
| >COG5027 SAS2 Histone acetyltransferase (MYST family) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF12261 T_hemolysin: Thermostable hemolysin; InterPro: IPR022050 This family of proteins is found in bacteria | Back alignment and domain information |
|---|
| >KOG4387 consensus Ornithine decarboxylase antizyme [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00756 acyltransferase NodA; Provisional | Back alignment and domain information |
|---|
| >cd07235 MRD Mitomycin C resistance protein (MRD) | Back alignment and domain information |
|---|
| >cd08356 Glo_EDI_BRP_like_17 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08353 Glo_EDI_BRP_like_7 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 91 | ||||
| 3eo4_A | 164 | The Crystal Structure Of A Domain From Methanocaldo | 4e-04 |
| >pdb|3EO4|A Chain A, The Crystal Structure Of A Domain From Methanocaldococcus Jannaschii Dsm 2661 Length = 164 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 91 | |||
| 3eo4_A | 164 | Uncharacterized protein MJ1062; APC60792.2,MJ_1062 | 4e-21 | |
| 3owc_A | 188 | Probable acetyltransferase; structural genomics, P | 2e-12 | |
| 3eg7_A | 176 | Spermidine N1-acetyltransferase; structural genomi | 5e-12 | |
| 3tth_A | 170 | Spermidine N1-acetyltransferase; central intermedi | 6e-12 | |
| 2vzy_A | 218 | RV0802C; transferase, GCN5-related N-acetyltransfe | 2e-10 | |
| 3tcv_A | 246 | GCN5-related N-acetyltransferase; GRAM negative co | 9e-10 | |
| 1sqh_A | 312 | Hypothetical protein CG14615-PA; structural genomi | 4e-09 | |
| 1yre_A | 197 | Hypothetical protein PA3270; APC5563, midwest cent | 6e-09 | |
| 2z10_A | 194 | Ribosomal-protein-alanine acetyltransferase; alpha | 7e-09 | |
| 2fl4_A | 149 | Spermine/spermidine acetyltransferase; structural | 9e-09 | |
| 2vi7_A | 177 | Acetyltransferase PA1377; GNAT, GCN5 family, N-ace | 9e-09 | |
| 1nsl_A | 184 | Probable acetyltransferase; structural genomics, h | 3e-08 | |
| 2i6c_A | 160 | Putative acetyltransferase; GNAT family, structura | 4e-08 | |
| 3igr_A | 184 | Ribosomal-protein-S5-alanine N-acetyltransferase; | 4e-08 | |
| 2bue_A | 202 | AAC(6')-IB; GNAT, transferase, aminoglycoside, flu | 6e-08 | |
| 3pzj_A | 209 | Probable acetyltransferases; MCSG, PSI-2, structur | 8e-08 | |
| 1vhs_A | 175 | Similar to phosphinothricin acetyltransferase; str | 1e-07 | |
| 3exn_A | 160 | Probable acetyltransferase; GCN5-related N-acetylt | 1e-07 | |
| 2ae6_A | 166 | Acetyltransferase, GNAT family; GCN5-related N-ace | 1e-07 | |
| 3d3s_A | 189 | L-2,4-diaminobutyric acid acetyltransferase; alpha | 2e-07 | |
| 1s7k_A | 182 | Acetyl transferase; GNAT; 1.80A {Salmonella typhim | 2e-07 | |
| 3f8k_A | 160 | Protein acetyltransferase; GCN5-related N-acetyltr | 2e-07 | |
| 3kkw_A | 182 | Putative uncharacterized protein; acetyltransferas | 3e-07 | |
| 2fsr_A | 195 | Acetyltransferase; alpha-beta-sandwich, structural | 3e-07 | |
| 1yr0_A | 175 | AGR_C_1654P, phosphinothricin acetyltransferase; s | 3e-07 | |
| 3dr6_A | 174 | YNCA; acetyltransferase, csgid target, essential g | 3e-07 | |
| 3fbu_A | 168 | Acetyltransferase, GNAT family; structur genomics, | 3e-07 | |
| 2j8m_A | 172 | Acetyltransferase PA4866 from P. aeruginosa; GCN5 | 4e-07 | |
| 3r9f_A | 188 | MCCE protein; microcin C7, acetyltransferase, SELF | 5e-07 | |
| 2qml_A | 198 | BH2621 protein; structural genomics, joint center | 6e-07 | |
| 2jlm_A | 182 | Putative phosphinothricin N-acetyltransferase; met | 6e-07 | |
| 3g3s_A | 249 | GCN5-related N-acetyltransferase; ZP_00874857.1, a | 1e-06 | |
| 2wpx_A | 339 | ORF14; transferase, acetyl transferase, antibiotic | 1e-06 | |
| 2i79_A | 172 | Acetyltransferase, GNAT family; acetyl coenzyme *A | 1e-06 | |
| 2zw5_A | 301 | Bleomycin acetyltransferase; dimer, two domains; H | 2e-06 | |
| 2fck_A | 181 | Ribosomal-protein-serine acetyltransferase, putat; | 2e-06 | |
| 4ava_A | 333 | Lysine acetyltransferase; allosteric regulation, d | 3e-06 | |
| 3juw_A | 175 | Probable GNAT-family acetyltransferase; structural | 3e-06 | |
| 1mk4_A | 157 | Hypothetical protein YQJY; alpha-beta-alpha sandwi | 3e-06 | |
| 1yk3_A | 210 | Hypothetical protein RV1347C/MT1389; acyltransfera | 4e-06 | |
| 2ge3_A | 170 | Probable acetyltransferase; structural GEN PSI, pr | 6e-06 | |
| 3f5b_A | 182 | Aminoglycoside N(6')acetyltransferase; APC60744, l | 8e-06 | |
| 2aj6_A | 159 | Hypothetical protein MW0638; structural genomics, | 8e-06 | |
| 1z4e_A | 153 | Transcriptional regulator; nysgxrc target T2017, G | 1e-05 | |
| 3bln_A | 143 | Acetyltransferase GNAT family; NP_981174.1, struct | 2e-05 | |
| 1p0h_A | 318 | Hypothetical protein RV0819; GNAT fold, acetyltran | 2e-05 | |
| 3dsb_A | 157 | Putative acetyltransferase; APC60368.2, ST genomic | 2e-05 | |
| 3c26_A | 266 | Putative acetyltransferase TA0821; NP_394282.1, A | 3e-05 | |
| 3iwg_A | 276 | Acetyltransferase, GNAT family; structural genomic | 5e-05 | |
| 2fia_A | 162 | Acetyltransferase; structural genomics, PSI, prote | 6e-05 | |
| 3ld2_A | 197 | SMU.2055, putative acetyltransferase; HET: COA; 2. | 7e-05 | |
| 2pc1_A | 201 | Acetyltransferase, GNAT family; NP_688560.1, struc | 9e-05 | |
| 2gan_A | 190 | 182AA long hypothetical protein; alpha-beta protei | 9e-05 | |
| 3te4_A | 215 | GH12636P, dopamine N acetyltransferase, isoform A; | 1e-04 | |
| 3ec4_A | 228 | Putative acetyltransferase from the GNAT family; Y | 1e-04 | |
| 1s3z_A | 165 | Aminoglycoside 6'-N-acetyltransferase; GNAT, amino | 2e-04 | |
| 4fd7_A | 238 | Putative arylalkylamine N-acetyltransferase 7; GNA | 3e-04 | |
| 3frm_A | 254 | Uncharacterized conserved protein; APC61048, staph | 3e-04 | |
| 1y9k_A | 157 | IAA acetyltransferase; structural genomics, midwes | 4e-04 | |
| 4evy_A | 166 | Aminoglycoside N(6')-acetyltransferase type 1; cen | 4e-04 | |
| 1yvk_A | 163 | Hypothetical protein BSU33890; ALPHS-beta protein, | 6e-04 | |
| 3tt2_A | 330 | GCN5-related N-acetyltransferase; structural genom | 6e-04 | |
| 1ufh_A | 180 | YYCN protein; alpha and beta, fold, acetyltransfer | 6e-04 | |
| 3h4q_A | 188 | Putative acetyltransferase; NP_371943.1, structura | 6e-04 | |
| 3lod_A | 162 | Putative acyl-COA N-acyltransferase; structural ge | 7e-04 | |
| 2q0y_A | 153 | GCN5-related N-acetyltransferase; YP_295895.1, ace | 9e-04 |
| >3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} Length = 164 | Back alignment and structure |
|---|
Score = 80.8 bits (200), Expect = 4e-21
Identities = 27/89 (30%), Positives = 46/89 (51%), Gaps = 7/89 (7%)
Query: 1 MVGDVNIYMNDLDNLELAEVEIMIAEPKSRGKGLAKDAVLMMMAYAVENFGIHVFRAKIG 60
VG VN+ + DN E+ I+I E GK + + +V +++ + +N G A+I
Sbjct: 77 KVGSVNVSQLNTDN---PEIGILIGEFFLWGKHIGRHSVSLVLKWL-KNIGYKKAHARIL 132
Query: 61 ESNGASLRLFQKLGFEDISY---SEIFKE 86
E+N S++LF+ LGF+ +E E
Sbjct: 133 ENNIRSIKLFESLGFKKTKKGRENEWIYE 161
|
| >3owc_A Probable acetyltransferase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} Length = 188 | Back alignment and structure |
|---|
| >3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} Length = 176 | Back alignment and structure |
|---|
| >3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii} Length = 170 | Back alignment and structure |
|---|
| >2vzy_A RV0802C; transferase, GCN5-related N-acetyltransferase, succinyltransferase; HET: FLC; 2.00A {Mycobacterium tuberculosis} PDB: 2vzz_A* Length = 218 | Back alignment and structure |
|---|
| >3tcv_A GCN5-related N-acetyltransferase; GRAM negative coccobacillus, brucellosis, acyl CO-A, arylami transferase; 1.75A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} Length = 246 | Back alignment and structure |
|---|
| >1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 Length = 312 | Back alignment and structure |
|---|
| >1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSC protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Length = 197 | Back alignment and structure |
|---|
| >2z10_A Ribosomal-protein-alanine acetyltransferase; alpha/beta protein, acyltransferase, structural genomics, NPPSFA; HET: IYR; 1.77A {Thermus thermophilus} PDB: 2z0z_A* 2z11_A* 2zxv_A* Length = 194 | Back alignment and structure |
|---|
| >2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 Length = 149 | Back alignment and structure |
|---|
| >2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa} Length = 177 | Back alignment and structure |
|---|
| >1nsl_A Probable acetyltransferase; structural genomics, hexamer, alpha-beta, PSI, protein struc initiative, midwest center for structural genomics; 2.70A {Bacillus subtilis} SCOP: d.108.1.1 Length = 184 | Back alignment and structure |
|---|
| >2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* Length = 160 | Back alignment and structure |
|---|
| >3igr_A Ribosomal-protein-S5-alanine N-acetyltransferase; fisch MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.00A {Vibrio fischeri} Length = 184 | Back alignment and structure |
|---|
| >2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A* Length = 202 | Back alignment and structure |
|---|
| >3pzj_A Probable acetyltransferases; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: MSE; 1.85A {Chromobacterium violaceum} Length = 209 | Back alignment and structure |
|---|
| >1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 Length = 175 | Back alignment and structure |
|---|
| >3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} Length = 160 | Back alignment and structure |
|---|
| >2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 Length = 166 | Back alignment and structure |
|---|
| >3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} Length = 189 | Back alignment and structure |
|---|
| >1s7k_A Acetyl transferase; GNAT; 1.80A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 1s7l_A* 1s7n_A* 1s7f_A 1z9u_A Length = 182 | Back alignment and structure |
|---|
| >3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} Length = 160 | Back alignment and structure |
|---|
| >3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} Length = 182 | Back alignment and structure |
|---|
| >2fsr_A Acetyltransferase; alpha-beta-sandwich, structural genomics, PSI, protein struc initiative, midwest center for structural genomics; HET: PEG; 1.52A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Length = 195 | Back alignment and structure |
|---|
| >1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Length = 175 | Back alignment and structure |
|---|
| >3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} PDB: 3dr8_A* Length = 174 | Back alignment and structure |
|---|
| >3fbu_A Acetyltransferase, GNAT family; structur genomics, PSI2, MCSG, protein structure initiative, midwest for structural genomics; HET: COA; 1.80A {Bacillus anthracis str} Length = 168 | Back alignment and structure |
|---|
| >2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A Length = 172 | Back alignment and structure |
|---|
| >3r9f_A MCCE protein; microcin C7, acetyltransferase, SELF immunity, resistance, A coenzyme A, transferase; HET: COA GSU; 1.20A {Escherichia coli} PDB: 3r95_A* 3r96_A* 3r9e_A* 3r9g_A* Length = 188 | Back alignment and structure |
|---|
| >2qml_A BH2621 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 1.55A {Bacillus halodurans} Length = 198 | Back alignment and structure |
|---|
| >2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi} Length = 182 | Back alignment and structure |
|---|
| >3g3s_A GCN5-related N-acetyltransferase; ZP_00874857.1, acetyltransferase (GNAT) family, structural joint center for structural genomics, JCSG; HET: MSE; 1.80A {Streptococcus suis} Length = 249 | Back alignment and structure |
|---|
| >2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Length = 339 | Back alignment and structure |
|---|
| >2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} Length = 172 | Back alignment and structure |
|---|
| >2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* Length = 301 | Back alignment and structure |
|---|
| >2fck_A Ribosomal-protein-serine acetyltransferase, putat; ribosomal-protein structural genomics, PSI, protein structure initiative; HET: MSE; 1.70A {Vibrio cholerae o1 biovar eltor} SCOP: d.108.1.1 Length = 181 | Back alignment and structure |
|---|
| >4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Length = 333 | Back alignment and structure |
|---|
| >3juw_A Probable GNAT-family acetyltransferase; structural genomics, APC60242, acetyltransferas protein structure initiative; HET: MSE; 2.11A {Bordetella pertussis} Length = 175 | Back alignment and structure |
|---|
| >1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Length = 157 | Back alignment and structure |
|---|
| >1yk3_A Hypothetical protein RV1347C/MT1389; acyltransferase, GCN5-related fold, structural genomics, PSI, protein structure initiative; HET: BOG; 2.20A {Mycobacterium tuberculosis} SCOP: d.108.1.1 Length = 210 | Back alignment and structure |
|---|
| >2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 Length = 170 | Back alignment and structure |
|---|
| >3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp} Length = 182 | Back alignment and structure |
|---|
| >2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 Length = 159 | Back alignment and structure |
|---|
| >1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 Length = 153 | Back alignment and structure |
|---|
| >3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} Length = 143 | Back alignment and structure |
|---|
| >1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Length = 318 | Back alignment and structure |
|---|
| >3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} Length = 157 | Back alignment and structure |
|---|
| >3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} Length = 266 | Back alignment and structure |
|---|
| >3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} Length = 276 | Back alignment and structure |
|---|
| >2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 Length = 162 | Back alignment and structure |
|---|
| >3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} Length = 197 | Back alignment and structure |
|---|
| >2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} Length = 201 | Back alignment and structure |
|---|
| >2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 Length = 190 | Back alignment and structure |
|---|
| >3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} Length = 215 | Back alignment and structure |
|---|
| >3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Length = 228 | Back alignment and structure |
|---|
| >1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* Length = 165 | Back alignment and structure |
|---|
| >4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti} Length = 238 | Back alignment and structure |
|---|
| >3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} Length = 254 | Back alignment and structure |
|---|
| >1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 Length = 157 | Back alignment and structure |
|---|
| >4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A Length = 166 | Back alignment and structure |
|---|
| >1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 Length = 163 | Back alignment and structure |
|---|
| >3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Length = 330 | Back alignment and structure |
|---|
| >1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 Length = 180 | Back alignment and structure |
|---|
| >3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE P33; 2.50A {Staphylococcus aureus subsp} Length = 188 | Back alignment and structure |
|---|
| >3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} Length = 162 | Back alignment and structure |
|---|
| >2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Length = 153 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 91 | |||
| 1tiq_A | 180 | Protease synthase and sporulation negative regulat | 99.83 | |
| 3igr_A | 184 | Ribosomal-protein-S5-alanine N-acetyltransferase; | 99.83 | |
| 2x7b_A | 168 | N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf | 99.83 | |
| 1on0_A | 158 | YYCN protein; structural genomics, alpha-beta prot | 99.83 | |
| 2fl4_A | 149 | Spermine/spermidine acetyltransferase; structural | 99.82 | |
| 3pzj_A | 209 | Probable acetyltransferases; MCSG, PSI-2, structur | 99.82 | |
| 1wwz_A | 159 | Hypothetical protein PH1933; structural genomics, | 99.82 | |
| 2bei_A | 170 | Diamine acetyltransferase 2; SSAT2, BC011751, AAH1 | 99.82 | |
| 3r9f_A | 188 | MCCE protein; microcin C7, acetyltransferase, SELF | 99.81 | |
| 3fbu_A | 168 | Acetyltransferase, GNAT family; structur genomics, | 99.81 | |
| 3tcv_A | 246 | GCN5-related N-acetyltransferase; GRAM negative co | 99.81 | |
| 3lod_A | 162 | Putative acyl-COA N-acyltransferase; structural ge | 99.81 | |
| 2i79_A | 172 | Acetyltransferase, GNAT family; acetyl coenzyme *A | 99.81 | |
| 4h89_A | 173 | GCN5-related N-acetyltransferase; N-acyltransferas | 99.81 | |
| 2ge3_A | 170 | Probable acetyltransferase; structural GEN PSI, pr | 99.81 | |
| 1yre_A | 197 | Hypothetical protein PA3270; APC5563, midwest cent | 99.81 | |
| 2ae6_A | 166 | Acetyltransferase, GNAT family; GCN5-related N-ace | 99.81 | |
| 3tth_A | 170 | Spermidine N1-acetyltransferase; central intermedi | 99.81 | |
| 2dxq_A | 150 | AGR_C_4057P, acetyltransferase; structural genomic | 99.8 | |
| 2ob0_A | 170 | Human MAK3 homolog; acetyltransferase, structural | 99.8 | |
| 3eg7_A | 176 | Spermidine N1-acetyltransferase; structural genomi | 99.8 | |
| 1s3z_A | 165 | Aminoglycoside 6'-N-acetyltransferase; GNAT, amino | 99.8 | |
| 1vhs_A | 175 | Similar to phosphinothricin acetyltransferase; str | 99.8 | |
| 4evy_A | 166 | Aminoglycoside N(6')-acetyltransferase type 1; cen | 99.8 | |
| 4e0a_A | 164 | BH1408 protein; structural genomics, PSI-biology, | 99.8 | |
| 1z4e_A | 153 | Transcriptional regulator; nysgxrc target T2017, G | 99.8 | |
| 3d8p_A | 163 | Acetyltransferase of GNAT family; NP_373092.1, str | 99.8 | |
| 1ufh_A | 180 | YYCN protein; alpha and beta, fold, acetyltransfer | 99.79 | |
| 2vi7_A | 177 | Acetyltransferase PA1377; GNAT, GCN5 family, N-ace | 99.79 | |
| 1u6m_A | 199 | Acetyltransferase, GNAT family; structural genomic | 99.79 | |
| 1mk4_A | 157 | Hypothetical protein YQJY; alpha-beta-alpha sandwi | 99.79 | |
| 3eo4_A | 164 | Uncharacterized protein MJ1062; APC60792.2,MJ_1062 | 99.79 | |
| 3owc_A | 188 | Probable acetyltransferase; structural genomics, P | 99.79 | |
| 2b5g_A | 171 | Diamine acetyltransferase 1; structural genomics, | 99.79 | |
| 2pdo_A | 144 | Acetyltransferase YPEA; alpha-beta-alpha sandwich, | 99.79 | |
| 2fe7_A | 166 | Probable N-acetyltransferase; structural genomics, | 99.79 | |
| 3pp9_A | 187 | Putative streptothricin acetyltransferase; toxin p | 99.79 | |
| 1nsl_A | 184 | Probable acetyltransferase; structural genomics, h | 99.79 | |
| 2z10_A | 194 | Ribosomal-protein-alanine acetyltransferase; alpha | 99.79 | |
| 2cnt_A | 160 | Modification of 30S ribosomal subunit protein S18; | 99.79 | |
| 3kkw_A | 182 | Putative uncharacterized protein; acetyltransferas | 99.79 | |
| 2oh1_A | 179 | Acetyltransferase, GNAT family; YP_013287.1, struc | 99.78 | |
| 2fia_A | 162 | Acetyltransferase; structural genomics, PSI, prote | 99.78 | |
| 2jlm_A | 182 | Putative phosphinothricin N-acetyltransferase; met | 99.78 | |
| 2i6c_A | 160 | Putative acetyltransferase; GNAT family, structura | 99.78 | |
| 3fix_A | 183 | N-acetyltransferase; termoplasma acidophilum, stru | 99.78 | |
| 1ghe_A | 177 | Acetyltransferase; acyl coenzyme A complex; HET: A | 99.78 | |
| 3i9s_A | 183 | Integron cassette protein; oyster POND, woods HOLE | 99.78 | |
| 2cy2_A | 174 | TTHA1209, probable acetyltransferase; structural g | 99.78 | |
| 2eui_A | 153 | Probable acetyltransferase; dimer, structural geno | 99.78 | |
| 1s7k_A | 182 | Acetyl transferase; GNAT; 1.80A {Salmonella typhim | 99.78 | |
| 3juw_A | 175 | Probable GNAT-family acetyltransferase; structural | 99.78 | |
| 2vzy_A | 218 | RV0802C; transferase, GCN5-related N-acetyltransfe | 99.78 | |
| 2r7h_A | 177 | Putative D-alanine N-acetyltransferase of GNAT FA; | 99.78 | |
| 2fck_A | 181 | Ribosomal-protein-serine acetyltransferase, putat; | 99.78 | |
| 1yvk_A | 163 | Hypothetical protein BSU33890; ALPHS-beta protein, | 99.78 | |
| 1qsm_A | 152 | HPA2 histone acetyltransferase; protein-acetyl coe | 99.78 | |
| 2bue_A | 202 | AAC(6')-IB; GNAT, transferase, aminoglycoside, flu | 99.77 | |
| 3dsb_A | 157 | Putative acetyltransferase; APC60368.2, ST genomic | 99.77 | |
| 1y9k_A | 157 | IAA acetyltransferase; structural genomics, midwes | 99.77 | |
| 1vkc_A | 158 | Putative acetyl transferase; structural genomics, | 99.77 | |
| 2j8m_A | 172 | Acetyltransferase PA4866 from P. aeruginosa; GCN5 | 99.77 | |
| 2r1i_A | 172 | GCN5-related N-acetyltransferase; YP_831484.1, put | 99.77 | |
| 1yr0_A | 175 | AGR_C_1654P, phosphinothricin acetyltransferase; s | 99.77 | |
| 3dr6_A | 174 | YNCA; acetyltransferase, csgid target, essential g | 99.77 | |
| 3fnc_A | 163 | Protein LIN0611, putative acetyltransferase; GNAT, | 99.77 | |
| 3exn_A | 160 | Probable acetyltransferase; GCN5-related N-acetylt | 99.77 | |
| 2q7b_A | 181 | Acetyltransferase, GNAT family; NP_689019.1, struc | 99.76 | |
| 3f5b_A | 182 | Aminoglycoside N(6')acetyltransferase; APC60744, l | 99.76 | |
| 3t9y_A | 150 | Acetyltransferase, GNAT family; PSI-biology, struc | 99.76 | |
| 2fsr_A | 195 | Acetyltransferase; alpha-beta-sandwich, structural | 99.76 | |
| 2g3a_A | 152 | Acetyltransferase; structural genomics, PSI, prote | 99.76 | |
| 3jvn_A | 166 | Acetyltransferase; alpha-beta protein, structural | 99.76 | |
| 3g8w_A | 169 | Lactococcal prophage PS3 protein 05; APC61042, ace | 99.76 | |
| 3fyn_A | 176 | Integron gene cassette protein HFX_CASS3; integron | 99.75 | |
| 1yx0_A | 159 | Hypothetical protein YSNE; NESG, GFT structral gen | 99.75 | |
| 3f8k_A | 160 | Protein acetyltransferase; GCN5-related N-acetyltr | 99.75 | |
| 3gy9_A | 150 | GCN5-related N-acetyltransferase; YP_001815201.1, | 99.74 | |
| 3ec4_A | 228 | Putative acetyltransferase from the GNAT family; Y | 99.74 | |
| 2qml_A | 198 | BH2621 protein; structural genomics, joint center | 99.74 | |
| 3d3s_A | 189 | L-2,4-diaminobutyric acid acetyltransferase; alpha | 99.74 | |
| 1yk3_A | 210 | Hypothetical protein RV1347C/MT1389; acyltransfera | 99.74 | |
| 1y7r_A | 133 | Hypothetical protein SA2161; structural genomics, | 99.73 | |
| 2aj6_A | 159 | Hypothetical protein MW0638; structural genomics, | 99.73 | |
| 3efa_A | 147 | Putative acetyltransferase; structural genom 2, pr | 99.73 | |
| 1bo4_A | 168 | Protein (serratia marcescens aminoglycoside-3-N- a | 99.73 | |
| 3bln_A | 143 | Acetyltransferase GNAT family; NP_981174.1, struct | 99.72 | |
| 2gan_A | 190 | 182AA long hypothetical protein; alpha-beta protei | 99.72 | |
| 1y9w_A | 140 | Acetyltransferase; structural genomics, Pro struct | 99.72 | |
| 1n71_A | 180 | AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, | 99.72 | |
| 3ld2_A | 197 | SMU.2055, putative acetyltransferase; HET: COA; 2. | 99.72 | |
| 3i3g_A | 161 | N-acetyltransferase; malaria, structural genomics, | 99.72 | |
| 2q0y_A | 153 | GCN5-related N-acetyltransferase; YP_295895.1, ace | 99.72 | |
| 3mgd_A | 157 | Predicted acetyltransferase; structural genomics, | 99.71 | |
| 2wpx_A | 339 | ORF14; transferase, acetyl transferase, antibiotic | 99.71 | |
| 1i12_A | 160 | Glucosamine-phosphate N-acetyltransferase; GNAT, a | 99.71 | |
| 2jdc_A | 146 | Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1. | 99.71 | |
| 3iwg_A | 276 | Acetyltransferase, GNAT family; structural genomic | 99.71 | |
| 3e0k_A | 150 | Amino-acid acetyltransferase; N-acetylglutamate sy | 99.71 | |
| 2atr_A | 138 | Acetyltransferase, GNAT family; MCSG, structural g | 99.7 | |
| 3c26_A | 266 | Putative acetyltransferase TA0821; NP_394282.1, A | 99.7 | |
| 4fd4_A | 217 | Arylalkylamine N-acetyltransferase like 5B; GNAT; | 99.7 | |
| 1xeb_A | 150 | Hypothetical protein PA0115; midwest center for st | 99.7 | |
| 1cjw_A | 166 | Protein (serotonin N-acetyltransferase); HET: COT; | 99.7 | |
| 4ava_A | 333 | Lysine acetyltransferase; allosteric regulation, d | 99.7 | |
| 3t90_A | 149 | Glucose-6-phosphate acetyltransferase 1; GNAT fold | 99.69 | |
| 2zw5_A | 301 | Bleomycin acetyltransferase; dimer, two domains; H | 99.69 | |
| 1q2y_A | 140 | Protein YJCF, similar to hypothetical proteins; GC | 99.69 | |
| 1qst_A | 160 | TGCN5 histone acetyl transferase; GCN5-related N-a | 99.69 | |
| 2ree_A | 224 | CURA; GNAT, S-acetyltransferase, decarboxylase, po | 99.69 | |
| 2fiw_A | 172 | GCN5-related N-acetyltransferase:aminotransferase | 99.68 | |
| 2o28_A | 184 | Glucosamine 6-phosphate N-acetyltransferase; struc | 99.68 | |
| 1p0h_A | 318 | Hypothetical protein RV0819; GNAT fold, acetyltran | 99.68 | |
| 1ygh_A | 164 | ADA4, protein (transcriptional activator GCN5); tr | 99.67 | |
| 3h4q_A | 188 | Putative acetyltransferase; NP_371943.1, structura | 99.67 | |
| 2pc1_A | 201 | Acetyltransferase, GNAT family; NP_688560.1, struc | 99.67 | |
| 2ozh_A | 142 | Hypothetical protein XCC2953; structural genomics, | 99.67 | |
| 3qb8_A | 197 | A654L protein; GNAT N-acetyltransferase, acetyltra | 99.67 | |
| 4ag7_A | 165 | Glucosamine-6-phosphate N-acetyltransferase; HET: | 99.67 | |
| 1kux_A | 207 | Aralkylamine, serotonin N-acetyltransferase; enzym | 99.66 | |
| 2qec_A | 204 | Histone acetyltransferase HPA2 and related acetylt | 99.65 | |
| 2vez_A | 190 | Putative glucosamine 6-phosphate acetyltransferase | 99.65 | |
| 1m4i_A | 181 | Aminoglycoside 2'-N-acetyltransferase; COA binding | 99.64 | |
| 3ey5_A | 181 | Acetyltransferase-like, GNAT family; structural ge | 99.64 | |
| 2wpx_A | 339 | ORF14; transferase, acetyl transferase, antibiotic | 99.63 | |
| 3te4_A | 215 | GH12636P, dopamine N acetyltransferase, isoform A; | 99.63 | |
| 2k5t_A | 128 | Uncharacterized protein YHHK; N-acetyl transferase | 99.63 | |
| 2q04_A | 211 | Acetoin utilization protein; ZP_00540088.1, struct | 99.62 | |
| 1sqh_A | 312 | Hypothetical protein CG14615-PA; structural genomi | 99.61 | |
| 1z4r_A | 168 | General control of amino acid synthesis protein 5- | 99.61 | |
| 3tt2_A | 330 | GCN5-related N-acetyltransferase; structural genom | 99.61 | |
| 4fd7_A | 238 | Putative arylalkylamine N-acetyltransferase 7; GNA | 99.6 | |
| 4fd5_A | 222 | Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A | 99.6 | |
| 3s6f_A | 145 | Hypothetical acetyltransferase; acyl-COA N-acyltra | 99.58 | |
| 3g3s_A | 249 | GCN5-related N-acetyltransferase; ZP_00874857.1, a | 99.58 | |
| 3frm_A | 254 | Uncharacterized conserved protein; APC61048, staph | 99.58 | |
| 3ddd_A | 288 | Putative acetyltransferase; NP_142035.1, structura | 99.58 | |
| 2kcw_A | 147 | Uncharacterized acetyltransferase YJAB; GNAT fold, | 99.58 | |
| 3shp_A | 176 | Putative acetyltransferase STHE_0691; PSI-biology, | 99.58 | |
| 3dns_A | 135 | Ribosomal-protein-alanine acetyltransferase; N-ter | 99.57 | |
| 3d2m_A | 456 | Putative acetylglutamate synthase; protein-COA-Glu | 99.55 | |
| 2d4p_A | 141 | Hypothetical protein TTHA1254; structural genomics | 99.55 | |
| 2g0b_A | 198 | FEEM; N-acyl transferase, environmental DNA, prote | 99.53 | |
| 2pr1_A | 163 | Uncharacterized N-acetyltransferase YLBP; YIBP pro | 99.51 | |
| 1r57_A | 102 | Conserved hypothetical protein; GCN5, N-acetyltran | 99.51 | |
| 2ozg_A | 396 | GCN5-related N-acetyltransferase; YP_325469.1, ace | 99.47 | |
| 3tt2_A | 330 | GCN5-related N-acetyltransferase; structural genom | 99.45 | |
| 2ft0_A | 235 | TDP-fucosamine acetyltransferase; GNAT fold acetyl | 99.42 | |
| 2i00_A | 406 | Acetyltransferase, GNAT family; structural genomic | 99.35 | |
| 2hv2_A | 400 | Hypothetical protein; PSI, protein structure initi | 99.35 | |
| 3r1k_A | 428 | Enhanced intracellular surviVal protein; GNAT, ace | 99.33 | |
| 3n7z_A | 388 | Acetyltransferase, GNAT family; PSI2, MCSG, struct | 99.32 | |
| 3sxn_A | 422 | Enhanced intracellular surviVal protein; GNAT fold | 99.29 | |
| 1p0h_A | 318 | Hypothetical protein RV0819; GNAT fold, acetyltran | 99.26 | |
| 1xmt_A | 103 | Putative acetyltransferase; structural genomics, p | 99.18 | |
| 2zpa_A | 671 | Uncharacterized protein YPFI; RNA modification enz | 99.09 | |
| 1ro5_A | 201 | Autoinducer synthesis protein LASI; alpha-beta-alp | 99.07 | |
| 3p2h_A | 201 | AHL synthase; acyl-ACP binding, SAM binding, signa | 98.87 | |
| 1bob_A | 320 | HAT1, histone acetyltransferase; histone modificat | 98.72 | |
| 1kzf_A | 230 | Acyl-homoserinelactone synthase ESAI; alpha-beta, | 98.72 | |
| 2p0w_A | 324 | Histone acetyltransferase type B catalytic subuni; | 98.21 | |
| 3ddd_A | 288 | Putative acetyltransferase; NP_142035.1, structura | 97.34 | |
| 4hkf_A | 191 | Alpha-tubulin N-acetyltransferase; tubulin acetylt | 97.17 | |
| 1yle_A | 342 | Arginine N-succinyltransferase, alpha chain; struc | 96.89 | |
| 4b5o_A | 200 | Alpha-tubulin N-acetyltransferase; microtubules, c | 96.67 | |
| 4h6u_A | 200 | Alpha-tubulin N-acetyltransferase; tubulin acetylt | 96.59 | |
| 3s6k_A | 467 | Acetylglutamate kinase; synthase, transferase; 2.8 | 96.38 | |
| 4gs4_A | 240 | Alpha-tubulin N-acetyltransferase; acetyl coenzyme | 96.27 | |
| 3s6g_A | 460 | N-acetylglutamate kinase / N-acetylglutamate SYNT; | 96.25 | |
| 4b14_A | 385 | Glycylpeptide N-tetradecanoyltransferase; malaria, | 95.99 | |
| 3to7_A | 276 | Histone acetyltransferase ESA1; MYST family; HET: | 95.62 | |
| 2pq8_A | 278 | Probable histone acetyltransferase MYST1; MOF, str | 95.51 | |
| 2ou2_A | 280 | Histone acetyltransferase htatip; structural genom | 95.48 | |
| 2ozu_A | 284 | Histone acetyltransferase MYST3; structural genomi | 95.47 | |
| 3iu1_A | 383 | Glycylpeptide N-tetradecanoyltransferase 1; N-myri | 95.03 | |
| 1iic_A | 422 | Peptide N-myristoyltransferase; HET: MYA; 2.20A {S | 94.39 | |
| 1iyk_A | 392 | Myristoyl-COA:protein N-myristoyltransferase; HET: | 94.39 | |
| 2wuu_A | 421 | N-myristoyltransferase; acyltransferase; HET: NHM; | 93.55 | |
| 1rxt_A | 496 | Myristoyl-, glycylpeptide N-tetradecanoyltransfera | 93.33 | |
| 1zo0_A | 126 | ODC-AZ, ornithine decarboxylase antizyme; ornithin | 91.59 | |
| 1qys_A | 106 | TOP7; alpha-beta, novel fold, de novo protein; 2.5 | 89.83 | |
| 3fxt_A | 113 | Nucleoside diphosphate-linked moiety X motif 6; nu | 89.12 | |
| 4ab7_A | 464 | Protein Arg5,6, mitochondrial; transferase, argini | 88.89 |
| >1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
Probab=99.83 E-value=4.9e-20 Score=103.59 Aligned_cols=81 Identities=19% Similarity=0.288 Sum_probs=70.9
Q ss_pred CccceEEEeecCC----CcCceeeEEeeeCccccCcchHHHHHHHHHHHHHhhcCccEEEEEecCCcHHHHHHHHhcCce
Q 034552 1 MVGDVNIYMNDLD----NLELAEVEIMIAEPKSRGKGLAKDAVLMMMAYAVENFGIHVFRAKIGESNGASLRLFQKLGFE 76 (91)
Q Consensus 1 ~VG~~~~~~~~~~----~~~~~~i~~~~v~~~~r~~G~g~~l~~~~~~~~~~~~~~~~v~~~~~~~n~~~~~~~~~~Gf~ 76 (91)
+||++.+...... ..+.++|..++|+|+|||+|+|++|++.+++++. +.|++.+.+.|...|..|++||+++||+
T Consensus 70 ivG~~~~~~~~~~~~~~~~~~~~i~~l~V~p~~rg~GiG~~Ll~~~~~~a~-~~g~~~i~L~v~~~N~~A~~fY~k~GF~ 148 (180)
T 1tiq_A 70 IAGYVKVNIDDAQSEEMGAESLEIERIYIKNSFQKHGLGKHLLNKAIEIAL-ERNKKNIWLGVWEKNENAIAFYKKMGFV 148 (180)
T ss_dssp EEEEEEEEEGGGSSSCCCTTEEEEEEEEECGGGCSSSHHHHHHHHHHHHHH-HTTCSEEEEEEETTCHHHHHHHHHTTCE
T ss_pred EEEEEEEEeCCCcccccCCCcEEEEEEEECHHHhCCCHHHHHHHHHHHHHH-HCCCCEEEEEehhcCHHHHHHHHHcCCE
Confidence 4788888755421 2357899999999999999999999999999998 7899999999999999999999999999
Q ss_pred eechhh
Q 034552 77 DISYSE 82 (91)
Q Consensus 77 ~~~~~~ 82 (91)
.++..+
T Consensus 149 ~~g~~~ 154 (180)
T 1tiq_A 149 QTGAHS 154 (180)
T ss_dssp EEEEEE
T ss_pred EcCcEE
Confidence 998754
|
| >3igr_A Ribosomal-protein-S5-alanine N-acetyltransferase; fisch MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.00A {Vibrio fischeri} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3pzj_A Probable acetyltransferases; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: MSE; 1.85A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* | Back alignment and structure |
|---|
| >3r9f_A MCCE protein; microcin C7, acetyltransferase, SELF immunity, resistance, A coenzyme A, transferase; HET: COA GSU; 1.20A {Escherichia coli} PDB: 3r95_A* 3r96_A* 3r9e_A* 3r9g_A* | Back alignment and structure |
|---|
| >3fbu_A Acetyltransferase, GNAT family; structur genomics, PSI2, MCSG, protein structure initiative, midwest for structural genomics; HET: COA; 1.80A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3tcv_A GCN5-related N-acetyltransferase; GRAM negative coccobacillus, brucellosis, acyl CO-A, arylami transferase; 1.75A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >4h89_A GCN5-related N-acetyltransferase; N-acyltransferase superfamily, structural genomics, PSI-BIOL midwest center for structural genomics, MCSG; 1.37A {Kribbella flavida} | Back alignment and structure |
|---|
| >2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSC protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* | Back alignment and structure |
|---|
| >3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* | Back alignment and structure |
|---|
| >1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A | Back alignment and structure |
|---|
| >4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* | Back alignment and structure |
|---|
| >1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3owc_A Probable acetyltransferase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* | Back alignment and structure |
|---|
| >2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1nsl_A Probable acetyltransferase; structural genomics, hexamer, alpha-beta, PSI, protein struc initiative, midwest center for structural genomics; 2.70A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2z10_A Ribosomal-protein-alanine acetyltransferase; alpha/beta protein, acyltransferase, structural genomics, NPPSFA; HET: IYR; 1.77A {Thermus thermophilus} PDB: 2z0z_A* 2z11_A* 2zxv_A* | Back alignment and structure |
|---|
| >2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* | Back alignment and structure |
|---|
| >3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi} | Back alignment and structure |
|---|
| >2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* | Back alignment and structure |
|---|
| >3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* | Back alignment and structure |
|---|
| >1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* | Back alignment and structure |
|---|
| >3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* | Back alignment and structure |
|---|
| >2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1s7k_A Acetyl transferase; GNAT; 1.80A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 1s7l_A* 1s7n_A* 1s7f_A 1z9u_A | Back alignment and structure |
|---|
| >3juw_A Probable GNAT-family acetyltransferase; structural genomics, APC60242, acetyltransferas protein structure initiative; HET: MSE; 2.11A {Bordetella pertussis} | Back alignment and structure |
|---|
| >2vzy_A RV0802C; transferase, GCN5-related N-acetyltransferase, succinyltransferase; HET: FLC; 2.00A {Mycobacterium tuberculosis} PDB: 2vzz_A* | Back alignment and structure |
|---|
| >2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >2fck_A Ribosomal-protein-serine acetyltransferase, putat; ribosomal-protein structural genomics, PSI, protein structure initiative; HET: MSE; 1.70A {Vibrio cholerae o1 biovar eltor} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A | Back alignment and structure |
|---|
| >2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A* | Back alignment and structure |
|---|
| >3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} | Back alignment and structure |
|---|
| >1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A | Back alignment and structure |
|---|
| >2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} | Back alignment and structure |
|---|
| >1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 3dr8_A* | Back alignment and structure |
|---|
| >3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} | Back alignment and structure |
|---|
| >3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2fsr_A Acetyltransferase; alpha-beta-sandwich, structural genomics, PSI, protein struc initiative, midwest center for structural genomics; HET: PEG; 1.52A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} | Back alignment and structure |
|---|
| >3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} | Back alignment and structure |
|---|
| >1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* | Back alignment and structure |
|---|
| >3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} | Back alignment and structure |
|---|
| >2qml_A BH2621 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 1.55A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} | Back alignment and structure |
|---|
| >1yk3_A Hypothetical protein RV1347C/MT1389; acyltransferase, GCN5-related fold, structural genomics, PSI, protein structure initiative; HET: BOG; 2.20A {Mycobacterium tuberculosis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} | Back alignment and structure |
|---|
| >2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* | Back alignment and structure |
|---|
| >3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A | Back alignment and structure |
|---|
| >2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* | Back alignment and structure |
|---|
| >1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A | Back alignment and structure |
|---|
| >2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* | Back alignment and structure |
|---|
| >3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} | Back alignment and structure |
|---|
| >4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti} | Back alignment and structure |
|---|
| >1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural GEN protein structure initiative, PSI, APC22065; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A | Back alignment and structure |
|---|
| >4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* | Back alignment and structure |
|---|
| >3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* | Back alignment and structure |
|---|
| >1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* | Back alignment and structure |
|---|
| >2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* | Back alignment and structure |
|---|
| >2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A | Back alignment and structure |
|---|
| >1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* | Back alignment and structure |
|---|
| >1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE P33; 2.50A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} | Back alignment and structure |
|---|
| >2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} | Back alignment and structure |
|---|
| >4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* | Back alignment and structure |
|---|
| >1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* | Back alignment and structure |
|---|
| >2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* | Back alignment and structure |
|---|
| >1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* | Back alignment and structure |
|---|
| >3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* | Back alignment and structure |
|---|
| >3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} PDB: 3v8i_A* | Back alignment and structure |
|---|
| >2k5t_A Uncharacterized protein YHHK; N-acetyl transferase, COA, bound ligand, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: COA; NMR {Escherichia coli K12} | Back alignment and structure |
|---|
| >2q04_A Acetoin utilization protein; ZP_00540088.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.33A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 | Back alignment and structure |
|---|
| >1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* | Back alignment and structure |
|---|
| >3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti} | Back alignment and structure |
|---|
| >4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A | Back alignment and structure |
|---|
| >3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3g3s_A GCN5-related N-acetyltransferase; ZP_00874857.1, acetyltransferase (GNAT) family, structural joint center for structural genomics, JCSG; HET: MSE; 1.80A {Streptococcus suis} | Back alignment and structure |
|---|
| >3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3shp_A Putative acetyltransferase STHE_0691; PSI-biology, midwest center for structural genomics, MCSG; HET: SRT; 2.21A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3dns_A Ribosomal-protein-alanine acetyltransferase; N-terminal domain of ribosomal-protein-alanine acetyltransfe MCSG, PSI; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* | Back alignment and structure |
|---|
| >2d4p_A Hypothetical protein TTHA1254; structural genomics, NPPSFA, national project on protein STR and functional analyses; 1.70A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 2d4o_A | Back alignment and structure |
|---|
| >2g0b_A FEEM; N-acyl transferase, environmental DNA, protein-product compl antibiotic synthase, transferase; HET: NLT; 3.00A {Uncultured bacterium} | Back alignment and structure |
|---|
| >2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein, coenzyme A, structural GE PSI-2, protein structure initiative; HET: SUC COA; 3.20A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1r57_A Conserved hypothetical protein; GCN5, N-acetyltransferase, structural genomics, PSI, protein structure initiative; NMR {Staphylococcus aureus} SCOP: d.108.1.1 PDB: 2h5m_A* | Back alignment and structure |
|---|
| >2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >2ft0_A TDP-fucosamine acetyltransferase; GNAT fold acetyltransferase, structural genomics, montreal-K bacterial structural genomics initiative, BSGI; HET: ACO; 1.66A {Escherichia coli} PDB: 2fs5_A* | Back alignment and structure |
|---|
| >2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} PDB: 3sxo_A 3ryo_A 3uy5_A | Back alignment and structure |
|---|
| >3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3sxn_A Enhanced intracellular surviVal protein; GNAT fold, acetyltransferase, acetyl COA binding, transferas; HET: COA; 2.03A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* | Back alignment and structure |
|---|
| >1xmt_A Putative acetyltransferase; structural genomics, protein structure initiative, CESG, AT1G77540, center for eukaryotic structural genomics; 1.15A {Arabidopsis thaliana} SCOP: d.108.1.1 PDB: 2q44_A 2evn_A 2il4_A* 2q4y_A* | Back alignment and structure |
|---|
| >2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} | Back alignment and structure |
|---|
| >1ro5_A Autoinducer synthesis protein LASI; alpha-beta-alpha sandwich, phosphopantetheine fold, signalin; 2.30A {Pseudomonas aeruginosa} SCOP: d.108.1.3 | Back alignment and structure |
|---|
| >3p2h_A AHL synthase; acyl-ACP binding, SAM binding, signaling protein-I MTA complex, signaling protein-inhibitor complex; HET: MTA NOO; 2.00A {Burkholderia glumae} PDB: 3p2f_A* | Back alignment and structure |
|---|
| >1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1kzf_A Acyl-homoserinelactone synthase ESAI; alpha-beta, autoinducer synthase, quorum sensing, bacterial pathogenesis, ligase; 1.80A {Pantoea stewartii subsp} SCOP: d.108.1.3 PDB: 1k4j_A | Back alignment and structure |
|---|
| >2p0w_A Histone acetyltransferase type B catalytic subuni; HAT1, structural genomics, structural genomics consortium, S transferase; HET: ACO; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >4hkf_A Alpha-tubulin N-acetyltransferase; tubulin acetyltransferase, MEC-17, GNAT, acetyl-COA, GNAT FO transferase; HET: ACO; 1.70A {Danio rerio} PDB: 4h6u_A* 4h6z_A* | Back alignment and structure |
|---|
| >1yle_A Arginine N-succinyltransferase, alpha chain; structural genomics, acyltransferase, arginine metabolism, protein structure initiative; 1.70A {Pseudomonas aeruginosa} SCOP: d.108.1.8 | Back alignment and structure |
|---|
| >4b5o_A Alpha-tubulin N-acetyltransferase; microtubules, cilium, intraflagellar transport; HET: ACO; 1.05A {Homo sapiens} PDB: 4b5p_A* | Back alignment and structure |
|---|
| >4h6u_A Alpha-tubulin N-acetyltransferase; tubulin acetyltransferase; HET: ACO; 2.45A {Danio rerio} PDB: 4h6z_A* | Back alignment and structure |
|---|
| >3s6k_A Acetylglutamate kinase; synthase, transferase; 2.80A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >4gs4_A Alpha-tubulin N-acetyltransferase; acetyl coenzyme A binding, cytosolic; HET: ACO; 2.11A {Homo sapiens} | Back alignment and structure |
|---|
| >3s6g_A N-acetylglutamate kinase / N-acetylglutamate SYNT; synthase, transferase; HET: COA; 2.67A {Maricaulis maris} PDB: 3s7y_A 3s6h_A* | Back alignment and structure |
|---|
| >4b14_A Glycylpeptide N-tetradecanoyltransferase; malaria, drug design; HET: NHW 4XB; 1.50A {Plasmodium vivax} PDB: 4b11_A* 4b12_A* 4b13_A* 4b10_A* 4a95_A* | Back alignment and structure |
|---|
| >3to7_A Histone acetyltransferase ESA1; MYST family; HET: ALY COA; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 3to6_A* 1fy7_A* 1mja_A* 1mjb_A* 3to9_A* 1mj9_A* | Back alignment and structure |
|---|
| >2pq8_A Probable histone acetyltransferase MYST1; MOF, structural genomics, structural genomics consortium, SGC; HET: COA; 1.45A {Homo sapiens} PDB: 2giv_A* 3qah_A* 2y0m_A* 3toa_A* 3tob_A* | Back alignment and structure |
|---|
| >2ou2_A Histone acetyltransferase htatip; structural genomics, structural genomics consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2ozu_A Histone acetyltransferase MYST3; structural genomics, structural G consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} SCOP: d.108.1.1 PDB: 2rc4_A* 1m36_A | Back alignment and structure |
|---|
| >3iu1_A Glycylpeptide N-tetradecanoyltransferase 1; N-myristoyltransferase, NMT1, acyltransferase, phosphoprotein, structural genomics; HET: MYA; 1.42A {Homo sapiens} PDB: 3iu2_A* 3iwe_A* 3jtk_A* | Back alignment and structure |
|---|
| >1iic_A Peptide N-myristoyltransferase; HET: MYA; 2.20A {Saccharomyces cerevisiae} SCOP: d.108.1.2 d.108.1.2 PDB: 1iid_A* 2nmt_A* 2p6e_A* 2p6f_A* 2p6g_A* | Back alignment and structure |
|---|
| >1iyk_A Myristoyl-COA:protein N-myristoyltransferase; HET: MYA MIM; 2.30A {Candida albicans} SCOP: d.108.1.2 d.108.1.2 PDB: 1iyl_A* 1nmt_A | Back alignment and structure |
|---|
| >2wuu_A N-myristoyltransferase; acyltransferase; HET: NHM; 1.42A {Leishmania donovani} PDB: 3h5z_A* 4a2z_A* 4a30_A* 4a31_A* 4a32_A* 4a33_A* 2wsa_A* | Back alignment and structure |
|---|
| >1rxt_A Myristoyl-, glycylpeptide N-tetradecanoyltransferase 1; alpha-beta structure, unique N-myristoyltransferase fold; 3.00A {Homo sapiens} SCOP: d.108.1.2 d.108.1.2 | Back alignment and structure |
|---|
| >1zo0_A ODC-AZ, ornithine decarboxylase antizyme; ornithine decarboxylase inhibitor, lyase inhibitor; NMR {Rattus norvegicus} SCOP: d.108.1.7 | Back alignment and structure |
|---|
| >1qys_A TOP7; alpha-beta, novel fold, de novo protein; 2.50A {Computationally designed sequence} SCOP: k.41.1.1 | Back alignment and structure |
|---|
| >3fxt_A Nucleoside diphosphate-linked moiety X motif 6; nudix, NUDT6, GFG, FGF2AS, antisense basic fibroblast growth FGF-2 regulation, hydrolase; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4ab7_A Protein Arg5,6, mitochondrial; transferase, arginine biosynthesis, amino acid kinase domain GCN5-related acetyltransferase, GNAT; HET: NLG; 3.25A {Saccharomyces cerevisiae} PDB: 3zzi_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 91 | ||||
| d1sqha_ | 297 | d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fr | 2e-08 | |
| d1yk3a1 | 198 | d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/ | 5e-08 | |
| d1p0ha_ | 308 | d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacter | 7e-06 | |
| d1u6ma_ | 189 | d.108.1.1 (A:) Putative acetyltransferase EF0945 { | 1e-05 | |
| d1z4ea1 | 150 | d.108.1.1 (A:4-153) Transcriptional regulator BH19 | 2e-05 | |
| d2beia1 | 167 | d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {H | 8e-04 | |
| d1ufha_ | 155 | d.108.1.1 (A:) Putative acetyltransferase YycN {Ba | 0.001 | |
| d2fsra1 | 164 | d.108.1.1 (A:4-167) Probable acetyltranferase Atu2 | 0.001 | |
| d2fl4a1 | 146 | d.108.1.1 (A:1-146) Probable spermine/spermidine a | 0.002 | |
| d2gana1 | 182 | d.108.1.1 (A:1-182) Hypothetical protein PH0736 {P | 0.002 | |
| d1y9ka1 | 152 | d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillu | 0.003 | |
| d1cjwa_ | 166 | d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep | 0.004 |
| >d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 297 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Acyl-CoA N-acyltransferases (Nat) superfamily: Acyl-CoA N-acyltransferases (Nat) family: Hypothetical protein cg14615-pa domain: Hypothetical protein cg14615-pa species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
Score = 47.3 bits (112), Expect = 2e-08
Identities = 13/68 (19%), Positives = 26/68 (38%), Gaps = 1/68 (1%)
Query: 18 AEVEIMIAEPKSRGKGLAKDAVLMMMAYAVENFGIHVFRAKIGESNGASLRLFQKLGFED 77
+ + ++ PK+ +GL M A I +N S L +++G++
Sbjct: 226 SGLGMLQVLPKAERRGLGGLLAAAMSREIARG-EEITLTAWIVATNWRSEALLKRIGYQK 284
Query: 78 ISYSEIFK 85
+E K
Sbjct: 285 DLVNEWIK 292
|
| >d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 198 | Back information, alignment and structure |
|---|
| >d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 308 | Back information, alignment and structure |
|---|
| >d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} Length = 189 | Back information, alignment and structure |
|---|
| >d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} Length = 150 | Back information, alignment and structure |
|---|
| >d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 167 | Back information, alignment and structure |
|---|
| >d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} Length = 155 | Back information, alignment and structure |
|---|
| >d2fsra1 d.108.1.1 (A:4-167) Probable acetyltranferase Atu2435 {Agrobacterium tumefaciens [TaxId: 358]} Length = 164 | Back information, alignment and structure |
|---|
| >d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]} Length = 146 | Back information, alignment and structure |
|---|
| >d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} Length = 182 | Back information, alignment and structure |
|---|
| >d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} Length = 152 | Back information, alignment and structure |
|---|
| >d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} Length = 166 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 91 | |||
| d1y9ka1 | 152 | IAA acetyltransferase {Bacillus cereus [TaxId: 139 | 99.85 | |
| d1ufha_ | 155 | Putative acetyltransferase YycN {Bacillus subtilis | 99.85 | |
| d2fl4a1 | 146 | Probable spermine/spermidine acetyltransferase EF1 | 99.85 | |
| d1yvka1 | 152 | Hypothetical protein YvbK (BSu33890) {Bacillus sub | 99.84 | |
| d1s3za_ | 147 | Aminoglycoside N-acetyltransferase AAC(6')-IY {Sal | 99.82 | |
| d1mk4a_ | 157 | Hypothetical protein YqiY {Bacillus subtilis [TaxI | 99.81 | |
| d2b5ga1 | 167 | Diamine acetyltransferase 1 {Human (Homo sapiens) | 99.81 | |
| d2fiaa1 | 157 | Probable acetyltransferase EF1919 {Enterococcus fa | 99.81 | |
| d1yrea1 | 183 | Hypothetical protein PA3270 {Pseudomonas aeruginos | 99.81 | |
| d1yr0a1 | 163 | Phosphinothricin acetyltransferase {Agrobacterium | 99.8 | |
| d2i6ca1 | 160 | Putative acetyltransferase PA4794 {Pseudomonas aer | 99.8 | |
| d1y9wa1 | 140 | Probable acetyltransferase BC2806 {Bacillus cereus | 99.8 | |
| d2fe7a1 | 156 | Probable N-acetyltransferase PA0478 {Pseudomonas a | 99.8 | |
| d1yx0a1 | 151 | Hypothetical protein YsnE {Bacillus subtilis [TaxI | 99.8 | |
| d2ge3a1 | 164 | Probable acetyltransferase Atu2290 {Agrobacterium | 99.8 | |
| d1yvoa1 | 169 | Hypothetical protein PA4866 {Pseudomonas aeruginos | 99.8 | |
| d2g3aa1 | 137 | Probable acetyltransferase Atu2258 {Agrobacterium | 99.8 | |
| d2beia1 | 167 | Diamine acetyltransferase 2 {Human (Homo sapiens) | 99.8 | |
| d1nsla_ | 180 | Probable acetyltransferase YdaF {Bacillus subtilis | 99.79 | |
| d1vkca_ | 149 | Putative acetyltransferase PF0028 {Pyrococcus furi | 99.79 | |
| d1tiqa_ | 173 | Protease synthase and sporulation negative regulat | 99.79 | |
| d1s7ka1 | 174 | L7/L12-Ribosomal-protein-serine acetyltransferase | 99.79 | |
| d1wwza1 | 157 | Hypothetical protein PH1933 {Pyrococcus horikoshii | 99.78 | |
| d2fcka1 | 178 | Putative ribosomal-protein-serine acetyltransferas | 99.78 | |
| d2cy2a1 | 174 | Probable acetyltransferase TTHA1209 {Thermus therm | 99.78 | |
| d1vhsa_ | 165 | Putative phosphinothricin acetyltransferase YwnH { | 99.78 | |
| d1ghea_ | 170 | Tabtoxin resistance protein {Pseudomonas syringae | 99.78 | |
| d1z4ea1 | 150 | Transcriptional regulator BH1968 {Bacillus halodur | 99.78 | |
| d2ae6a1 | 161 | Putative acetyltransferase EF0244 {Enterococcus fa | 99.78 | |
| d1n71a_ | 180 | Aminoglycoside 6'-N-acetyltransferase {Enterococcu | 99.78 | |
| d2euia1 | 153 | Probable acetyltransferase PA4026 {Pseudomonas aer | 99.77 | |
| d2gana1 | 182 | Hypothetical protein PH0736 {Pyrococcus horikoshii | 99.77 | |
| d1y7ra1 | 133 | Hypothetical protein SA2161 {Staphylococcus aureus | 99.76 | |
| d1qsma_ | 150 | Histone acetyltransferase HPA2 {Baker's yeast (Sac | 99.76 | |
| d1u6ma_ | 189 | Putative acetyltransferase EF0945 {Enterococcus fa | 99.74 | |
| d1p0ha_ | 308 | Mycothiol synthase MshD {Mycobacterium tuberculosi | 99.74 | |
| d1qsra_ | 162 | Catalytic domain of GCN5 histone acetyltransferase | 99.73 | |
| d2jdca1 | 145 | Probable acetyltransferase YitI {Bacillus lichenif | 99.73 | |
| d1i12a_ | 157 | Glucosamine-phosphate N-acetyltransferase GNA1 {Ba | 99.71 | |
| d1q2ya_ | 140 | Probable acetyltransferase YjcF {Bacillus subtilis | 99.71 | |
| d1bo4a_ | 137 | Aminoglycoside 3-N-acetyltransferase {Serratia mar | 99.7 | |
| d1ygha_ | 164 | Catalytic domain of GCN5 histone acetyltransferase | 99.7 | |
| d1cjwa_ | 166 | Serotonin N-acetyltranferase {Sheep (Ovis aries) [ | 99.69 | |
| d2fiwa1 | 156 | Probable N-acetyltransferase RPA1999 {Rhodopseudom | 99.68 | |
| d2atra1 | 137 | Probable acetyltransferase SP0256 {Streptococcus p | 99.68 | |
| d1z4ra1 | 162 | Catalytic domain of GCN5 histone acetyltransferase | 99.68 | |
| d1yk3a1 | 198 | Hypothetical protein Rv1347c/MT1389 {Mycobacterium | 99.67 | |
| d1xeba_ | 149 | Hypothetical protein PA0115 {Pseudomonas aeruginos | 99.67 | |
| d2fsra1 | 164 | Probable acetyltranferase Atu2435 {Agrobacterium t | 99.62 | |
| d1sqha_ | 297 | Hypothetical protein cg14615-pa {Fruit fly (Drosop | 99.6 | |
| d2aj6a1 | 118 | Hypothetical protein MW0638 {Staphylococcus aureus | 99.34 | |
| d1m4ia_ | 181 | Aminoglycoside 2'-N-acetyltransferase {Mycobacteri | 99.34 | |
| d2hv2a2 | 285 | Hypothetical protein EF1021 {Enterococcus faecalis | 99.27 | |
| d2ozga2 | 283 | Putative acetyltransferase Ava4977 {Anabaena varia | 99.26 | |
| d2i00a2 | 291 | Putative acetyltransferase EF2353 {Enterococcus fa | 99.22 | |
| d1r57a_ | 102 | Hypothetical protein SA2309 {Staphylococcus aureus | 99.16 | |
| d1p0ha_ | 308 | Mycothiol synthase MshD {Mycobacterium tuberculosi | 98.67 | |
| d1ro5a_ | 197 | Autoinducer synthesis protein LasI {Pseudomonas ae | 98.48 | |
| d1xmta_ | 95 | Hypothetical protein AT1g77540 {Thale cress (Arabi | 98.29 | |
| d1boba_ | 315 | Histone acetyltransferase HAT1 {Baker's yeast (Sac | 97.93 | |
| d1kzfa_ | 210 | Acyl-homoserinelactone synthase EsaI {Pantoea stew | 97.74 | |
| d1iica1 | 185 | N-myristoyl transferase, NMT {Baker's yeast (Sacch | 97.02 | |
| d1rxta1 | 141 | N-myristoyl transferase, NMT {Human (Homo sapiens) | 96.87 | |
| d1iyka1 | 165 | N-myristoyl transferase, NMT {Yeast (Candida albic | 96.52 | |
| d2ozua1 | 270 | Histone acetyltransferase MYST3 {Human (Homo sapie | 95.84 | |
| d1fy7a_ | 273 | Histone acetyltransferase ESA1 {Baker's yeast (Sac | 95.82 | |
| d2giva1 | 271 | Probable histone acetyltransferase MYST1 {Human (H | 95.72 | |
| d1ylea1 | 338 | Arginine N-succinyltransferase, alpha chain, AstA | 94.07 | |
| d1lrza2 | 165 | Methicillin resistance protein FemA {Staphylococcu | 94.02 | |
| d1lrza3 | 182 | Methicillin resistance protein FemA {Staphylococcu | 93.19 | |
| d1ecsa_ | 120 | Bleomycin resistance protein, BRP {Klebsiella pneu | 89.91 | |
| d1cjxa1 | 150 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom | 87.92 | |
| d1xqaa_ | 113 | Hypothetical protein BC3580 {Bacillus cereus [TaxI | 86.82 | |
| d1klla_ | 128 | Mitomycin resistance protein D, MRD {Streptomyces | 83.82 |
| >d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Acyl-CoA N-acyltransferases (Nat) superfamily: Acyl-CoA N-acyltransferases (Nat) family: N-acetyl transferase, NAT domain: IAA acetyltransferase species: Bacillus cereus [TaxId: 1396]
Probab=99.85 E-value=6.6e-21 Score=104.16 Aligned_cols=81 Identities=21% Similarity=0.301 Sum_probs=72.1
Q ss_pred CccceEEEeecCCCcCceeeEEeeeCccccCcchHHHHHHHHHHHHHhhcCccEEEEEecCCcHHHHHHHHhcCceeech
Q 034552 1 MVGDVNIYMNDLDNLELAEVEIMIAEPKSRGKGLAKDAVLMMMAYAVENFGIHVFRAKIGESNGASLRLFQKLGFEDISY 80 (91)
Q Consensus 1 ~VG~~~~~~~~~~~~~~~~i~~~~v~~~~r~~G~g~~l~~~~~~~~~~~~~~~~v~~~~~~~n~~~~~~~~~~Gf~~~~~ 80 (91)
+||++.+.... ++.++|..++|+|+|||+|+|+++++.++++++ +.|++.+.+.+...|.++++||+++||+.++.
T Consensus 46 ivG~~~~~~~~---~~~~~i~~l~V~p~~rg~GiG~~Ll~~~~~~a~-~~g~~~i~l~t~~~n~~a~~fY~k~GF~~~~~ 121 (152)
T d1y9ka1 46 VIGVYVLLETR---PKTMEIMNIAVAEHLQGKGIGKKLLRHAVETAK-GYGMSKLEVGTGNSSVSQLALYQKCGFRIFSI 121 (152)
T ss_dssp EEEEEEEEECS---TTEEEEEEEEECGGGCSSSHHHHHHHHHHHHHH-HTTCSEEEEEEETTCHHHHHHHHHTTCEEEEE
T ss_pred EEEEEEEEEcC---CCEEEEEEEEEcHHHCCCCcchHHHHHHHHHHH-HcCCceEEEEeccCCHHHHHHHHHCCCEEEeE
Confidence 46777665433 478999999999999999999999999999998 78999999999999999999999999999998
Q ss_pred hhhhh
Q 034552 81 SEIFK 85 (91)
Q Consensus 81 ~~~~~ 85 (91)
.+.|.
T Consensus 122 ~~~~f 126 (152)
T d1y9ka1 122 DFDYF 126 (152)
T ss_dssp ETTHH
T ss_pred EcCcc
Confidence 76653
|
| >d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} | Back information, alignment and structure |
|---|
| >d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1yrea1 d.108.1.1 (A:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nsla_ d.108.1.1 (A:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1s7ka1 d.108.1.1 (A:3-176) L7/L12-Ribosomal-protein-serine acetyltransferase RimL {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} | Back information, alignment and structure |
|---|
| >d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} | Back information, alignment and structure |
|---|
| >d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2fsra1 d.108.1.1 (A:4-167) Probable acetyltranferase Atu2435 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} | Back information, alignment and structure |
|---|
| >d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ro5a_ d.108.1.3 (A:) Autoinducer synthesis protein LasI {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1xmta_ d.108.1.1 (A:) Hypothetical protein AT1g77540 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kzfa_ d.108.1.3 (A:) Acyl-homoserinelactone synthase EsaI {Pantoea stewartii subsp. stewartii [TaxId: 66271]} | Back information, alignment and structure |
|---|
| >d1iica1 d.108.1.2 (A:34-218) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rxta1 d.108.1.2 (A:78-218) N-myristoyl transferase, NMT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyka1 d.108.1.2 (A:60-224) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fy7a_ d.108.1.1 (A:) Histone acetyltransferase ESA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ylea1 d.108.1.8 (A:1-338) Arginine N-succinyltransferase, alpha chain, AstA {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1lrza2 d.108.1.4 (A:1-165) Methicillin resistance protein FemA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1lrza3 d.108.1.4 (A:166-244,A:310-412) Methicillin resistance protein FemA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1ecsa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1cjxa1 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1klla_ d.32.1.2 (A:) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]} | Back information, alignment and structure |
|---|