Citrus Sinensis ID: 034677

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-------
MKMAILDESVVNSNISPDNSYGAVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELIQPVDERMRNVEAYIKG
cccccccccccccccccccccccEEEEEcccHHHHHHHHHHHHHHHHHccEEEEEEcccHHHHccccccccccHHHHHHHHHHHHHc
ccEEEEccccccccccccccccEEEEEccHHHHcHHHHHHHHHHHHHHcccEEEEEccHHHHHcccHHHHHHcHHHHHHHHHHHHcc
MKMAILDESvvnsnispdnsygaVVLGgtfdrlhdghRLFLKASAELARDRIVvgvcdgpmltnKQFAELIQPVDERMRNVEAYIKG
MKMAILDESVvnsnispdnSYGAVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQfaeliqpvderMRNVEAYIKG
MKMAILDESVVNSNISPDNSYGAVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELIQPVDERMRNVEAYIKG
******************NSYGAVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELIQPV*************
**********************AVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELIQPVDERMRNVEAYIKG
MKMAILDESVVNSNISPDNSYGAVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELIQPVDERMRNVEAYIKG
MKMAILDESVVNSNISPDNSYGAVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELIQPVDERMRNVEAYIKG
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKMAILDESVVNSNISPDNSYGAVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELIQPVDERMRNVEAYIKG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query87 2.2.26 [Sep-21-2011]
Q9ZPV8176 Phosphopantetheine adenyl yes no 0.862 0.426 0.8 2e-33
P53332305 Phosphopantetheine adenyl yes no 0.781 0.222 0.411 1e-11
Q9DBL7 563 Bifunctional coenzyme A s yes no 0.873 0.134 0.381 6e-10
Q13057 564 Bifunctional coenzyme A s yes no 0.873 0.134 0.381 6e-10
Q8MIR4 562 Bifunctional coenzyme A s yes no 0.873 0.135 0.368 2e-09
Q5JHE8165 Phosphopantetheine adenyl yes no 0.770 0.406 0.367 1e-07
C5A3G3159 Phosphopantetheine adenyl yes no 0.655 0.358 0.448 4e-07
Q9UYT0157 Phosphopantetheine adenyl yes no 0.758 0.420 0.343 8e-07
Q8TGY4157 Phosphopantetheine adenyl yes no 0.804 0.445 0.361 3e-06
O58358158 Phosphopantetheine adenyl no no 0.747 0.411 0.333 3e-06
>sp|Q9ZPV8|COAD_ARATH Phosphopantetheine adenylyltransferase OS=Arabidopsis thaliana GN=COAD PE=1 SV=1 Back     alignment and function desciption
 Score =  140 bits (354), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 71/75 (94%)

Query: 12 NSNISPDNSYGAVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELI 71
          +S +SP NS+GAVVLGGTFDRLHDGHR+FLKA+AELARDRIVVGVCDGPMLT KQF+++I
Sbjct: 6  DSKMSPANSFGAVVLGGTFDRLHDGHRMFLKAAAELARDRIVVGVCDGPMLTKKQFSDMI 65

Query: 72 QPVDERMRNVEAYIK 86
          QP++ERMRNVE Y+K
Sbjct: 66 QPIEERMRNVETYVK 80
Reversibly transfers an adenylyl group from ATP to 4'-phosphopantetheine, yielding dephospho-CoA (dPCoA) and pyrophosphate. Does not accept 4'-phosphopantothenoylcysteine as a substrate.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 7EC: .EC: 3
>sp|P53332|COAD_YEAST Phosphopantetheine adenylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAB4 PE=1 SV=1 Back     alignment and function description
>sp|Q9DBL7|COASY_MOUSE Bifunctional coenzyme A synthase OS=Mus musculus GN=Coasy PE=1 SV=2 Back     alignment and function description
>sp|Q13057|COASY_HUMAN Bifunctional coenzyme A synthase OS=Homo sapiens GN=COASY PE=1 SV=4 Back     alignment and function description
>sp|Q8MIR4|COASY_PIG Bifunctional coenzyme A synthase OS=Sus scrofa GN=COASY PE=1 SV=1 Back     alignment and function description
>sp|Q5JHE8|COAD_PYRKO Phosphopantetheine adenylyltransferase OS=Pyrococcus kodakaraensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=coaD PE=3 SV=1 Back     alignment and function description
>sp|C5A3G3|COAD_THEGJ Phosphopantetheine adenylyltransferase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=coaD PE=3 SV=1 Back     alignment and function description
>sp|Q9UYT0|COAD_PYRAB Phosphopantetheine adenylyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=coaD PE=1 SV=3 Back     alignment and function description
>sp|Q8TGY4|COAD_METKA Phosphopantetheine adenylyltransferase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=coaD PE=3 SV=1 Back     alignment and function description
>sp|O58358|COAD_PYRHO Phosphopantetheine adenylyltransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=coaD PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query87
255561104 493 syntaxin, putative [Ricinus communis] gi 0.977 0.172 0.835 2e-36
224133810178 predicted protein [Populus trichocarpa] 0.965 0.471 0.797 9e-35
449529337178 PREDICTED: phosphopantetheine adenylyltr 0.965 0.471 0.773 3e-33
297832482176 4-phosphopantetheine adenylyltransferase 0.862 0.426 0.84 6e-33
449432834178 PREDICTED: phosphopantetheine adenylyltr 0.965 0.471 0.761 1e-32
15224138176 phosphopantetheine adenylyltransferase [ 0.862 0.426 0.8 8e-32
359476888 493 PREDICTED: syntaxin-112 [Vitis vinifera] 0.919 0.162 0.762 5e-31
225460271174 PREDICTED: phosphopantetheine adenylyltr 0.977 0.488 0.741 9e-31
296089428 372 unnamed protein product [Vitis vinifera] 0.977 0.228 0.741 1e-30
297735135174 unnamed protein product [Vitis vinifera] 0.908 0.454 0.772 1e-30
>gi|255561104|ref|XP_002521564.1| syntaxin, putative [Ricinus communis] gi|223539242|gb|EEF40835.1| syntaxin, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  155 bits (393), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 71/85 (83%), Positives = 78/85 (91%)

Query: 3  MAILDESVVNSNISPDNSYGAVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPML 62
          MA+L+E +VN  ISP NSYGAVVLGGTFDRLHDGHRLFLKASAELAR+RIVVGVCDGPML
Sbjct: 1  MAVLEEPMVNHKISPPNSYGAVVLGGTFDRLHDGHRLFLKASAELARERIVVGVCDGPML 60

Query: 63 TNKQFAELIQPVDERMRNVEAYIKG 87
          TNKQFA+LIQP++ERM NVE YIK 
Sbjct: 61 TNKQFADLIQPIEERMHNVEIYIKS 85

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224133810|ref|XP_002327686.1| predicted protein [Populus trichocarpa] gi|222836771|gb|EEE75164.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449529337|ref|XP_004171656.1| PREDICTED: phosphopantetheine adenylyltransferase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297832482|ref|XP_002884123.1| 4-phosphopantetheine adenylyltransferase [Arabidopsis lyrata subsp. lyrata] gi|297329963|gb|EFH60382.1| 4-phosphopantetheine adenylyltransferase [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449432834|ref|XP_004134203.1| PREDICTED: phosphopantetheine adenylyltransferase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15224138|ref|NP_179417.1| phosphopantetheine adenylyltransferase [Arabidopsis thaliana] gi|75267775|sp|Q9ZPV8.1|COAD_ARATH RecName: Full=Phosphopantetheine adenylyltransferase; AltName: Full=Dephospho-CoA pyrophosphorylase; Short=AtCoaD; AltName: Full=Pantetheine-phosphate adenylyltransferase gi|4309741|gb|AAD15511.1| hypothetical protein [Arabidopsis thaliana] gi|34365611|gb|AAQ65117.1| At2g18250 [Arabidopsis thaliana] gi|51971991|dbj|BAD44660.1| hypothetical protein [Arabidopsis thaliana] gi|330251652|gb|AEC06746.1| phosphopantetheine adenylyltransferase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|359476888|ref|XP_002265408.2| PREDICTED: syntaxin-112 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225460271|ref|XP_002278835.1| PREDICTED: phosphopantetheine adenylyltransferase [Vitis vinifera] Back     alignment and taxonomy information
>gi|296089428|emb|CBI39247.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297735135|emb|CBI17497.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query87
TAIR|locus:2062165176 COAD "4-phosphopantetheine ade 0.862 0.426 0.8 4.9e-30
WB|WBGene00022031 461 Y65B4A.8 [Caenorhabditis elega 0.758 0.143 0.515 1.8e-12
SGD|S000003509305 CAB4 "Probable pantetheine-pho 0.770 0.219 0.434 7.6e-12
ZFIN|ZDB-GENE-040912-137 554 coasy "Coenzyme A synthase" [D 0.839 0.131 0.397 3.9e-11
DICTYBASE|DDB_G0288465409 DDB_G0288465 "putative panteth 0.919 0.195 0.370 2.7e-10
FB|FBgn0035632 518 Ppat-Dpck "Bifunctional Phosph 0.931 0.156 0.395 6.9e-10
UNIPROTKB|E2RIA4 564 COASY "Uncharacterized protein 0.873 0.134 0.381 7.9e-10
UNIPROTKB|E2QU79 615 COASY "Uncharacterized protein 0.873 0.123 0.381 9e-10
RGD|1549767 563 Coasy "CoA synthase" [Rattus n 0.873 0.134 0.381 1e-09
MGI|MGI:1918993 563 Coasy "Coenzyme A synthase" [M 0.873 0.134 0.381 1.3e-09
TAIR|locus:2062165 COAD "4-phosphopantetheine adenylyltransferase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 332 (121.9 bits), Expect = 4.9e-30, P = 4.9e-30
 Identities = 60/75 (80%), Positives = 71/75 (94%)

Query:    12 NSNISPDNSYGAVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELI 71
             +S +SP NS+GAVVLGGTFDRLHDGHR+FLKA+AELARDRIVVGVCDGPMLT KQF+++I
Sbjct:     6 DSKMSPANSFGAVVLGGTFDRLHDGHRMFLKAAAELARDRIVVGVCDGPMLTKKQFSDMI 65

Query:    72 QPVDERMRNVEAYIK 86
             QP++ERMRNVE Y+K
Sbjct:    66 QPIEERMRNVETYVK 80
GO:0003824 "catalytic activity" evidence=IEA
GO:0004140 "dephospho-CoA kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0009058 "biosynthetic process" evidence=IEA;ISS
GO:0015937 "coenzyme A biosynthetic process" evidence=IEA;IDA
GO:0016779 "nucleotidyltransferase activity" evidence=IEA;ISS
GO:0004595 "pantetheine-phosphate adenylyltransferase activity" evidence=IDA
GO:0006629 "lipid metabolic process" evidence=IMP
GO:0006970 "response to osmotic stress" evidence=IMP
GO:0009651 "response to salt stress" evidence=IMP
GO:0019915 "lipid storage" evidence=IMP
GO:0040007 "growth" evidence=IMP
GO:0080020 "regulation of coenzyme A biosynthetic process" evidence=IMP
GO:0005829 "cytosol" evidence=IDA
GO:0019344 "cysteine biosynthetic process" evidence=RCA
WB|WBGene00022031 Y65B4A.8 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
SGD|S000003509 CAB4 "Probable pantetheine-phosphate adenylyltransferase (PPAT)" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040912-137 coasy "Coenzyme A synthase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0288465 DDB_G0288465 "putative pantetheine-phosphate adenylyltransferase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
FB|FBgn0035632 Ppat-Dpck "Bifunctional Phosphopantetheine adenylyltransferase - Dephospho-CoA kinase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E2RIA4 COASY "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2QU79 COASY "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1549767 Coasy "CoA synthase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1918993 Coasy "Coenzyme A synthase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9ZPV8COAD_ARATH2, ., 7, ., 7, ., 30.80.86200.4261yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.7.30.824
3rd Layer2.7.70.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00570163
4-phosphopantetheine adenylyltransferase (EC-2.7.7.3) (178 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.XV.1934.1
SubName- Full=Putative uncharacterized protein; (185 aa)
     •• 0.946
fgenesh4_pm.C_LG_X000827
dephospho-CoA kinase (EC-2.7.1.24) (232 aa)
     •• 0.937
estExt_fgenesh4_pg.C_LG_XV0519
pantothenate kinase (EC-2.7.1.33) (872 aa)
     •• 0.918
eugene3.00120751
pantothenate kinase (EC-2.7.1.33) (939 aa)
     •• 0.918
eugene3.80020001
Predicted protein (399 aa)
     •• 0.457
gw1.XVIII.1881.1
hypothetical protein (281 aa)
• •     0.445
estExt_Genewise1_v1.C_LG_XIII0788
hypothetical protein (118 aa)
  •     0.419
gw1.64.350.1
hypothetical protein (339 aa)
• •     0.415
gw1.XIV.2332.1
annotation not avaliable (306 aa)
• •     0.409
estExt_fgenesh4_pm.C_LG_IX0168
RecName- Full=Proteasome subunit alpha type; EC=3.4.25.1;; The proteasome is a multicatalytic p [...] (250 aa)
  •     0.406

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
PLN02388177 PLN02388, PLN02388, phosphopantetheine adenylyltra 7e-52
cd02164143 cd02164, PPAT_CoAS, phosphopantetheine adenylyltra 5e-29
COG1019158 COG1019, COG1019, Predicted nucleotidyltransferase 6e-14
PRK00777153 PRK00777, PRK00777, phosphopantetheine adenylyltra 4e-13
cd02039143 cd02039, cytidylyltransferase_like, Cytidylyltrans 3e-09
TIGR0012566 TIGR00125, cyt_tran_rel, cytidyltransferase-like d 3e-08
pfam01467148 pfam01467, CTP_transf_2, Cytidylyltransferase 3e-08
PRK01170 322 PRK01170, PRK01170, phosphopantetheine adenylyltra 1e-05
COG0615140 COG0615, TagD, Cytidylyltransferase [Cell envelope 6e-05
cd02170136 cd02170, cytidylyltransferase, cytidylyltransferas 1e-04
cd02165 192 cd02165, NMNAT, Nicotinamide/nicotinate mononucleo 0.004
>gnl|CDD|215218 PLN02388, PLN02388, phosphopantetheine adenylyltransferase Back     alignment and domain information 
 Score =  159 bits (404), Expect = 7e-52
 Identities = 66/84 (78%), Positives = 75/84 (89%)

Query: 3  MAILDESVVNSNISPDNSYGAVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPML 62
          M  + +SV +S +SP NSYGAVVLGGTFDRLHDGHRLFLKA+AELARDRIV+GVCDGPML
Sbjct: 1  MVTVKDSVADSKLSPPNSYGAVVLGGTFDRLHDGHRLFLKAAAELARDRIVIGVCDGPML 60

Query: 63 TNKQFAELIQPVDERMRNVEAYIK 86
          + KQFAELIQP++ERM NVE YIK
Sbjct: 61 SKKQFAELIQPIEERMHNVEEYIK 84

Length = 177
>gnl|CDD|173915 cd02164, PPAT_CoAS, phosphopantetheine adenylyltransferase domain of eukaryotic and archaeal bifunctional enzymes Back     alignment and domain information
>gnl|CDD|223950 COG1019, COG1019, Predicted nucleotidyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|234834 PRK00777, PRK00777, phosphopantetheine adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|185678 cd02039, cytidylyltransferase_like, Cytidylyltransferase-like domain Back     alignment and domain information
>gnl|CDD|232837 TIGR00125, cyt_tran_rel, cytidyltransferase-like domain Back     alignment and domain information
>gnl|CDD|216517 pfam01467, CTP_transf_2, Cytidylyltransferase Back     alignment and domain information
>gnl|CDD|234912 PRK01170, PRK01170, phosphopantetheine adenylyltransferase/unknown domain fusion protein; Provisional Back     alignment and domain information
>gnl|CDD|223688 COG0615, TagD, Cytidylyltransferase [Cell envelope biogenesis, outer membrane / Lipid metabolism] Back     alignment and domain information
>gnl|CDD|173921 cd02170, cytidylyltransferase, cytidylyltransferase Back     alignment and domain information
>gnl|CDD|185680 cd02165, NMNAT, Nicotinamide/nicotinate mononucleotide adenylyltransferase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 87
PRK00777153 phosphopantetheine adenylyltransferase; Provisiona 99.82
cd02164143 PPAT_CoAS phosphopantetheine adenylyltransferase d 99.8
PLN02388177 phosphopantetheine adenylyltransferase 99.77
COG1019158 Predicted nucleotidyltransferase [General function 99.75
PRK00168159 coaD phosphopantetheine adenylyltransferase; Provi 99.74
TIGR0012566 cyt_tran_rel cytidyltransferase-related domain. Pr 99.74
PRK13964140 coaD phosphopantetheine adenylyltransferase; Provi 99.74
KOG3351293 consensus Predicted nucleotidyltransferase [Genera 99.72
cd02173152 ECT CTP:phosphoethanolamine cytidylyltransferase ( 99.72
COG1057 197 NadD Nicotinic acid mononucleotide adenylyltransfe 99.72
PRK01170 322 phosphopantetheine adenylyltransferase/unknown dom 99.71
TIGR01510155 coaD_prev_kdtB pantetheine-phosphate adenylyltrans 99.69
cd02163153 PPAT Phosphopantetheine adenylyltransferase. Phosp 99.69
cd02167158 NMNAT_NadR Nicotinamide/nicotinate mononucleotide 99.68
cd02174150 CCT CTP:phosphocholine cytidylyltransferase. CTP:p 99.68
PRK06973 243 nicotinic acid mononucleotide adenylyltransferase; 99.66
PF01467157 CTP_transf_2: Cytidylyltransferase; InterPro: IPR0 99.64
PRK00071 203 nadD nicotinic acid mononucleotide adenylyltransfe 99.64
PRK07152 342 nadD putative nicotinate-nucleotide adenylyltransf 99.63
PRK08887 174 nicotinic acid mononucleotide adenylyltransferase; 99.63
cd02166 163 NMNAT_Archaea Nicotinamide/nicotinate mononucleoti 99.63
COG0615140 TagD Cytidylyltransferase [Cell envelope biogenesi 99.62
PTZ00308353 ethanolamine-phosphate cytidylyltransferase; Provi 99.62
TIGR01527 165 arch_NMN_Atrans nicotinamide-nucleotide adenylyltr 99.62
COG0669159 CoaD Phosphopantetheine adenylyltransferase [Coenz 99.62
PLN02406 418 ethanolamine-phosphate cytidylyltransferase 99.62
TIGR01526 325 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr 99.61
cd02168 181 NMNAT_Nudix Nicotinamide/nicotinate mononucleotide 99.61
TIGR00482 193 nicotinate (nicotinamide) nucleotide adenylyltrans 99.61
cd02165 192 NMNAT Nicotinamide/nicotinate mononucleotide adeny 99.6
cd02170136 cytidylyltransferase cytidylyltransferase. The cyt 99.59
cd02039143 cytidylyltransferase_like Cytidylyltransferase-lik 99.58
cd02171129 G3P_Cytidylyltransferase glycerol-3-phosphate cyti 99.58
PRK01153 174 nicotinamide-nucleotide adenylyltransferase; Provi 99.56
PRK05379 340 bifunctional nicotinamide mononucleotide adenylylt 99.56
PLN02406 418 ethanolamine-phosphate cytidylyltransferase 99.55
cd02156105 nt_trans nucleotidyl transferase superfamily. nt_t 99.54
PLN02413 294 choline-phosphate cytidylyltransferase 99.53
PLN02945 236 nicotinamide-nucleotide adenylyltransferase/nicoti 99.5
PTZ00308 353 ethanolamine-phosphate cytidylyltransferase; Provi 99.43
TIGR01518125 g3p_cytidyltrns glycerol-3-phosphate cytidylyltran 99.43
KOG2803 358 consensus Choline phosphate cytidylyltransferase/P 99.38
cd02172144 RfaE_N N-terminal domain of RfaE. RfaE is a protei 99.38
TIGR02199144 rfaE_dom_II rfaE bifunctional protein, domain II. 99.38
cd09286 225 NMNAT_Eukarya Nicotinamide/nicotinate mononucleoti 99.37
PRK08099 399 bifunctional DNA-binding transcriptional repressor 99.37
TIGR00124 332 cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP 99.35
COG2870467 RfaE ADP-heptose synthase, bifunctional sugar kina 99.33
PRK13793 196 nicotinamide-nucleotide adenylyltransferase; Provi 99.33
PRK11316473 bifunctional heptose 7-phosphate kinase/heptose 1- 99.23
KOG2803358 consensus Choline phosphate cytidylyltransferase/P 99.16
cd02064 180 FAD_synthetase_N FAD synthetase, N-terminal domain 99.06
cd02169 297 Citrate_lyase_ligase Citrate lyase ligase. Citrate 99.06
COG1056 172 NadR Nicotinamide mononucleotide adenylyltransfera 99.02
smart00764 182 Citrate_ly_lig Citrate lyase ligase C-terminal dom 98.98
PRK13671 298 hypothetical protein; Provisional 98.95
KOG2804 348 consensus Phosphorylcholine transferase/cholinepho 98.74
PRK07143 279 hypothetical protein; Provisional 98.47
PRK05627 305 bifunctional riboflavin kinase/FMN adenylyltransfe 98.44
PF06574157 FAD_syn: FAD synthetase; InterPro: IPR015864 Ribof 98.19
TIGR00339 383 sopT ATP sulphurylase. Members of this family also 98.01
PF08218 182 Citrate_ly_lig: Citrate lyase ligase C-terminal do 97.95
TIGR00083 288 ribF riboflavin kinase/FMN adenylyltransferase. mu 97.91
PF05636 388 HIGH_NTase1: HIGH Nucleotidyl Transferase; InterPr 97.67
PRK13670 388 hypothetical protein; Provisional 97.6
COG0196 304 RibF FAD synthase [Coenzyme metabolism] 97.44
COG1323 358 Predicted nucleotidyltransferase [General function 97.36
TIGR00018 282 panC pantoate--beta-alanine ligase. This family is 96.94
COG3053 352 CitC Citrate lyase synthetase [Energy production a 96.92
cd00560 277 PanC Pantoate-beta-alanine ligase. PanC Pantoate-b 96.91
PRK00380 281 panC pantoate--beta-alanine ligase; Reviewed 96.71
KOG3199 234 consensus Nicotinamide mononucleotide adenylyl tra 96.65
PLN02660 284 pantoate--beta-alanine ligase 96.64
PF01747 215 ATP-sulfurylase: ATP-sulfurylase; InterPro: IPR002 95.91
cd00517 353 ATPS ATP-sulfurylase. ATP-sulfurylase (ATPS), also 95.59
COG2046 397 MET3 ATP sulfurylase (sulfate adenylyltransferase) 95.59
PRK04149 391 sat sulfate adenylyltransferase; Reviewed 95.48
PRK05537 568 bifunctional sulfate adenylyltransferase subunit 1 94.05
PRK13477 512 bifunctional pantoate ligase/cytidylate kinase; Pr 93.97
COG0414 285 PanC Panthothenate synthetase [Coenzyme metabolism 93.67
PF02569 280 Pantoate_ligase: Pantoate-beta-alanine ligase; Int 93.47
PLN02341470 pfkB-type carbohydrate kinase family protein 87.05
COG1519419 KdtA 3-deoxy-D-manno-octulosonic-acid transferase 82.37
KOG3042 283 consensus Panthothenate synthetase [Coenzyme trans 81.21
>PRK00777 phosphopantetheine adenylyltransferase; Provisional Back     alignment and domain information 
Probab=99.82  E-value=5e-20  Score=125.18  Aligned_cols=64  Identities=33%  Similarity=0.670  Sum_probs=56.8

Q ss_pred             ccEEEEcccCCCCCHHHHHHHHHHHHHhcCeEEEEEcCCCcccccCCCCCCCCHHHHHHHHHHHHh
Q 034677           21 YGAVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELIQPVDERMRNVEAYIK   86 (87)
Q Consensus        21 ~~~v~~gGtFDplH~GHl~ll~~a~~~~~d~vivgv~~d~~~~~k~~~~~i~~~~~R~~~v~~~l~   86 (87)
                      |++|++||||||+|.||+.++++|++++ ++|+||+++|+.++.++. .++.|+++|++||+.|++
T Consensus         1 ~~~v~~gGtFDplH~GH~~ll~~A~~~~-d~livgi~~d~~~~~~K~-~~i~~~e~R~~~v~~~~~   64 (153)
T PRK00777          1 MMKVAVGGTFDPLHDGHRALLRKAFELG-KRVTIGLTSDEFAKSYKK-HKVRPYEVRLKNLKKFLK   64 (153)
T ss_pred             CcEEEEecccCCCCHHHHHHHHHHHHcC-CEEEEEEcCCccccccCC-CCCCCHHHHHHHHHHHHH
Confidence            4689999999999999999999999998 799999999987743222 689999999999999986

>cd02164 PPAT_CoAS phosphopantetheine adenylyltransferase domain of eukaryotic and archaeal bifunctional enzymes Back     alignment and domain information
>PLN02388 phosphopantetheine adenylyltransferase Back     alignment and domain information
>COG1019 Predicted nucleotidyltransferase [General function prediction only] Back     alignment and domain information
>PRK00168 coaD phosphopantetheine adenylyltransferase; Provisional Back     alignment and domain information
>TIGR00125 cyt_tran_rel cytidyltransferase-related domain Back     alignment and domain information
>PRK13964 coaD phosphopantetheine adenylyltransferase; Provisional Back     alignment and domain information
>KOG3351 consensus Predicted nucleotidyltransferase [General function prediction only] Back     alignment and domain information
>cd02173 ECT CTP:phosphoethanolamine cytidylyltransferase (ECT) Back     alignment and domain information
>COG1057 NadD Nicotinic acid mononucleotide adenylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK01170 phosphopantetheine adenylyltransferase/unknown domain fusion protein; Provisional Back     alignment and domain information
>TIGR01510 coaD_prev_kdtB pantetheine-phosphate adenylyltransferase, bacterial Back     alignment and domain information
>cd02163 PPAT Phosphopantetheine adenylyltransferase Back     alignment and domain information
>cd02167 NMNAT_NadR Nicotinamide/nicotinate mononucleotide adenylyltransferase of bifunctional NadR-like proteins Back     alignment and domain information
>cd02174 CCT CTP:phosphocholine cytidylyltransferase Back     alignment and domain information
>PRK06973 nicotinic acid mononucleotide adenylyltransferase; Provisional Back     alignment and domain information
>PF01467 CTP_transf_2: Cytidylyltransferase; InterPro: IPR004820 This family includes []: Cholinephosphate cytidyltransferase (P49585 from SWISSPROT) Back     alignment and domain information
>PRK00071 nadD nicotinic acid mononucleotide adenylyltransferase; Provisional Back     alignment and domain information
>PRK07152 nadD putative nicotinate-nucleotide adenylyltransferase; Validated Back     alignment and domain information
>PRK08887 nicotinic acid mononucleotide adenylyltransferase; Provisional Back     alignment and domain information
>cd02166 NMNAT_Archaea Nicotinamide/nicotinate mononucleotide adenylyltransferase, archaeal Back     alignment and domain information
>COG0615 TagD Cytidylyltransferase [Cell envelope biogenesis, outer membrane / Lipid metabolism] Back     alignment and domain information
>PTZ00308 ethanolamine-phosphate cytidylyltransferase; Provisional Back     alignment and domain information
>TIGR01527 arch_NMN_Atrans nicotinamide-nucleotide adenylyltransferase Back     alignment and domain information
>COG0669 CoaD Phosphopantetheine adenylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>PLN02406 ethanolamine-phosphate cytidylyltransferase Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type Back     alignment and domain information
>cd02168 NMNAT_Nudix Nicotinamide/nicotinate mononucleotide adenylyltransferase of bifunctional proteins, also containing a Nudix hydrolase domain Back     alignment and domain information
>TIGR00482 nicotinate (nicotinamide) nucleotide adenylyltransferase Back     alignment and domain information
>cd02165 NMNAT Nicotinamide/nicotinate mononucleotide adenylyltransferase Back     alignment and domain information
>cd02170 cytidylyltransferase cytidylyltransferase Back     alignment and domain information
>cd02039 cytidylyltransferase_like Cytidylyltransferase-like domain Back     alignment and domain information
>cd02171 G3P_Cytidylyltransferase glycerol-3-phosphate cytidylyltransferase Back     alignment and domain information
>PRK01153 nicotinamide-nucleotide adenylyltransferase; Provisional Back     alignment and domain information
>PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional Back     alignment and domain information
>PLN02406 ethanolamine-phosphate cytidylyltransferase Back     alignment and domain information
>cd02156 nt_trans nucleotidyl transferase superfamily Back     alignment and domain information
>PLN02413 choline-phosphate cytidylyltransferase Back     alignment and domain information
>PLN02945 nicotinamide-nucleotide adenylyltransferase/nicotinate-nucleotide adenylyltransferase Back     alignment and domain information
>PTZ00308 ethanolamine-phosphate cytidylyltransferase; Provisional Back     alignment and domain information
>TIGR01518 g3p_cytidyltrns glycerol-3-phosphate cytidylyltransferase Back     alignment and domain information
>KOG2803 consensus Choline phosphate cytidylyltransferase/Predicted CDP-ethanolamine synthase [Lipid transport and metabolism] Back     alignment and domain information
>cd02172 RfaE_N N-terminal domain of RfaE Back     alignment and domain information
>TIGR02199 rfaE_dom_II rfaE bifunctional protein, domain II Back     alignment and domain information
>cd09286 NMNAT_Eukarya Nicotinamide/nicotinate mononucleotide adenylyltransferase, Eukaryotic Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase Back     alignment and domain information
>COG2870 RfaE ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK13793 nicotinamide-nucleotide adenylyltransferase; Provisional Back     alignment and domain information
>PRK11316 bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase; Provisional Back     alignment and domain information
>KOG2803 consensus Choline phosphate cytidylyltransferase/Predicted CDP-ethanolamine synthase [Lipid transport and metabolism] Back     alignment and domain information
>cd02064 FAD_synthetase_N FAD synthetase, N-terminal domain of the bifunctional enzyme Back     alignment and domain information
>cd02169 Citrate_lyase_ligase Citrate lyase ligase Back     alignment and domain information
>COG1056 NadR Nicotinamide mononucleotide adenylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>smart00764 Citrate_ly_lig Citrate lyase ligase C-terminal domain Back     alignment and domain information
>PRK13671 hypothetical protein; Provisional Back     alignment and domain information
>KOG2804 consensus Phosphorylcholine transferase/cholinephosphate cytidylyltransferase [Lipid transport and metabolism] Back     alignment and domain information
>PRK07143 hypothetical protein; Provisional Back     alignment and domain information
>PRK05627 bifunctional riboflavin kinase/FMN adenylyltransferase; Reviewed Back     alignment and domain information
>PF06574 FAD_syn: FAD synthetase; InterPro: IPR015864 Riboflavin is converted into catalytically active cofactors (FAD and FMN) by the actions of riboflavin kinase (2 Back     alignment and domain information
>TIGR00339 sopT ATP sulphurylase Back     alignment and domain information
>PF08218 Citrate_ly_lig: Citrate lyase ligase C-terminal domain; InterPro: IPR013166 [Citrate (pro-3S)-lyase] ligase (6 Back     alignment and domain information
>TIGR00083 ribF riboflavin kinase/FMN adenylyltransferase Back     alignment and domain information
>PF05636 HIGH_NTase1: HIGH Nucleotidyl Transferase; InterPro: IPR008513 This family consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK13670 hypothetical protein; Provisional Back     alignment and domain information
>COG0196 RibF FAD synthase [Coenzyme metabolism] Back     alignment and domain information
>COG1323 Predicted nucleotidyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00018 panC pantoate--beta-alanine ligase Back     alignment and domain information
>COG3053 CitC Citrate lyase synthetase [Energy production and conversion] Back     alignment and domain information
>cd00560 PanC Pantoate-beta-alanine ligase Back     alignment and domain information
>PRK00380 panC pantoate--beta-alanine ligase; Reviewed Back     alignment and domain information
>KOG3199 consensus Nicotinamide mononucleotide adenylyl transferase [Coenzyme transport and metabolism] Back     alignment and domain information
>PLN02660 pantoate--beta-alanine ligase Back     alignment and domain information
>PF01747 ATP-sulfurylase: ATP-sulfurylase; InterPro: IPR002650 This entry consists of sulphate adenylyltransferase or ATP-sulfurylase (2 Back     alignment and domain information
>cd00517 ATPS ATP-sulfurylase Back     alignment and domain information
>COG2046 MET3 ATP sulfurylase (sulfate adenylyltransferase) [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK04149 sat sulfate adenylyltransferase; Reviewed Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>COG0414 PanC Panthothenate synthetase [Coenzyme metabolism] Back     alignment and domain information
>PF02569 Pantoate_ligase: Pantoate-beta-alanine ligase; InterPro: IPR003721 D-Pantothenate is synthesized via four enzymes from ketoisovalerate, which is an intermediate of branched-chain amino acid synthesis [] Back     alignment and domain information
>PLN02341 pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>COG1519 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3042 consensus Panthothenate synthetase [Coenzyme transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
3do8_A148 Phosphopantetheine adenylyltransferase; protein wi 4e-18
3hl4_A236 Choline-phosphate cytidylyltransferase A; rossmann 2e-05
2b7l_A132 Glycerol-3-phosphate cytidylyltransferase; rossman 3e-05
1coz_A129 Protein (glycerol-3-phosphate cytidylyltransferase 6e-05
1lw7_A 365 Transcriptional regulator NADR; NMN, NMN adenylyl 9e-05
3elb_A341 Ethanolamine-phosphate cytidylyltransferase; kenne 3e-04
3glv_A143 Lipopolysaccharide core biosynthesis protein; stru 5e-04
>3do8_A Phosphopantetheine adenylyltransferase; protein with unknown function, structural genomics, MCSG, PSI-2, protein structure initiative; 1.60A {Archaeoglobus fulgidus} Length = 148 Back     alignment and structure
 Score = 72.4 bits (177), Expect = 4e-18
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 2/63 (3%)

Query: 24 VVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELIQPVDERMRNVEA 83
          V LGGTF+ LH+GH+  +  + +L    I +GV    M   +  +    P   R  NV+ 
Sbjct: 3  VALGGTFEPLHEGHKKLIDVAIKLGGRDITIGVTSDRMARARIRSV--LPFAIRAENVKR 60

Query: 84 YIK 86
          Y+ 
Sbjct: 61 YVM 63
>3hl4_A Choline-phosphate cytidylyltransferase A; rossmann fold, phospholipid synthesis, phosphatidylcholine, phosphocholine, CTP, CDP-choline; HET: CDC; 2.20A {Rattus norvegicus} Length = 236 Back     alignment and structure
>2b7l_A Glycerol-3-phosphate cytidylyltransferase; rossmann fold; 3.00A {Staphylococcus aureus} Length = 132 Back     alignment and structure
>1coz_A Protein (glycerol-3-phosphate cytidylyltransferase); HET: CTP; 2.00A {Bacillus subtilis} SCOP: c.26.1.2 PDB: 1n1d_A* Length = 129 Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Length = 365 Back     alignment and structure
>3elb_A Ethanolamine-phosphate cytidylyltransferase; kennedy pathway, CMP, CTP, phosphoethanolamine, cytidylyltra SGC, structural genomics consortium; HET: C5P; 2.00A {Homo sapiens} Length = 341 Back     alignment and structure
>3glv_A Lipopolysaccharide core biosynthesis protein; structural GEN PSI, MCSG, protein structure initiative; HET: AMP; 1.99A {Thermoplasma volcanium GSS1} Length = 143 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query87
3do8_A148 Phosphopantetheine adenylyltransferase; protein wi 99.78
3nbk_A177 Phosphopantetheine adenylyltransferase; PPAT, PHP; 99.75
3nv7_A157 Phosphopantetheine adenylyltransferase; helicobact 99.74
4f3r_A162 Phosphopantetheine adenylyltransferase; phosphopan 99.73
3nd5_A 171 Phosphopantetheine adenylyltransferase; PPAT, coen 99.72
3f3m_A 168 Phosphopantetheine adenylyltransferase; PPAT, coen 99.71
1vlh_A 173 Phosphopantetheine adenylyltransferase; TM0741, st 99.71
2qjt_B 352 Nicotinamide-nucleotide adenylyltransferase; two i 99.68
3k9w_A 187 Phosphopantetheine adenylyltransferase; niaid, ssg 99.68
1qjc_A158 Phosphopantetheine adenylyltransferase; coenzyme A 99.67
2b7l_A132 Glycerol-3-phosphate cytidylyltransferase; rossman 99.66
1coz_A129 Protein (glycerol-3-phosphate cytidylyltransferase 99.65
1lw7_A 365 Transcriptional regulator NADR; NMN, NMN adenylyl 99.65
3h05_A 177 Uncharacterized protein VPA0413; nucleotidylyl, tr 99.65
1o6b_A 169 Phosphopantetheine adenylyltransferase; structural 99.64
1f9a_A 168 Hypothetical protein MJ0541; alpha/beta, transfera 99.63
2qtr_A 189 Nicotinate (nicotinamide) nucleotide adenylyltran; 99.63
3hl4_A236 Choline-phosphate cytidylyltransferase A; rossmann 99.63
1od6_A160 PPAT, phosphopantetheine adenylyltransferase; coen 99.63
1kam_A 194 Deamido-NAD(+), nicotinate-nucleotide adenylyltran 99.62
3elb_A341 Ethanolamine-phosphate cytidylyltransferase; kenne 99.62
1yum_A 242 'probable nicotinate-nucleotide adenylyltransferas 99.61
1k4m_A 213 NAMN adenylyltransferase; nucleotidyltransferase; 99.6
2h29_A 189 Probable nicotinate-nucleotide adenylyltransferase 99.6
3glv_A143 Lipopolysaccharide core biosynthesis protein; stru 99.59
1ej2_A 181 Nicotinamide mononucleotide adenylyltransferase; d 99.58
3elb_A 341 Ethanolamine-phosphate cytidylyltransferase; kenne 99.56
2qjo_A 341 Bifunctional NMN adenylyltransferase/nudix hydrol; 99.53
1nup_A 252 FKSG76; NAD biosynthesis, mitochondria, pyridine a 99.48
1kqn_A 279 Nmnat, nicotinamide mononucleotide adenylyl transf 99.44
1jhd_A 396 Sulfate adenylyltransferase; sulfurylase, APS, che 98.79
2x0k_A 338 Riboflavin biosynthesis protein RIBF; riboflavin k 98.77
1v47_A 349 ATP sulfurylase; product binding complex, zinc, ri 98.73
1mrz_A 293 Riboflavin kinase/FMN adenylyltransferase; rossman 98.67
2ejc_A 280 Pantoate--beta-alanine ligase; X-RAY diffraction, 98.64
3gmi_A 357 UPF0348 protein MJ0951; protein with unknown funct 98.36
3op1_A 308 Macrolide-efflux protein; structural genomics, PSI 98.29
1v8f_A 276 Pantoate-beta-alanine ligase; rossmann fold, dimer 97.42
1r6x_A 395 ATP:sulfate adenylyltransferase; APS kinase-like d 97.03
1g8f_A 511 Sulfate adenylyltransferase; alpha-beta protein, b 97.0
3ag6_A 283 Pantothenate synthetase; ATP-dependent enzyme, ATP 96.95
3cov_A 301 Pantothenate synthetase; pantothenate biosynthesis 96.77
3uk2_A 283 Pantothenate synthetase; AMP, structural genomics, 96.6
2gks_A 546 Bifunctional SAT/APS kinase; transferase, sulfuryl 96.56
3q12_A 287 Pantoate--beta-alanine ligase; structural genomics 96.52
3inn_A 314 Pantothenate synthetase; ssgcid, SBRI, UW, decode, 96.43
1m8p_A 573 Sulfate adenylyltransferase; rossmann fold, phosph 96.33
3n8h_A 264 Pantothenate synthetase; alpha-beta sandwich, liga 94.67
3cr8_A 552 Sulfate adenylyltranferase, adenylylsulfate kinase 94.67
3mxt_A 285 Pantothenate synthetase; alpha-beta-alpha, structu 93.74
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 92.98
>3do8_A Phosphopantetheine adenylyltransferase; protein with unknown function, structural genomics, MCSG, PSI-2, protein structure initiative; 1.60A {Archaeoglobus fulgidus} Back     alignment and structure
Probab=99.78  E-value=1.6e-19  Score=120.84  Aligned_cols=61  Identities=33%  Similarity=0.633  Sum_probs=54.6

Q ss_pred             EEEEcccCCCCCHHHHHHHHHHHHHhcCeEEEEEcCCCcccccCCCCCCCCHHHHHHHHHHHH
Q 034677           23 AVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELIQPVDERMRNVEAYI   85 (87)
Q Consensus        23 ~v~~gGtFDplH~GHl~ll~~a~~~~~d~vivgv~~d~~~~~k~~~~~i~~~~~R~~~v~~~l   85 (87)
                      ++++||||||+|.||+.++++|++++.|+|+|+|+++++++++  ..++.|+++|++|++.++
T Consensus         2 ~~i~gGtFDPiH~GHl~l~~~a~~~~~d~viv~v~~~~~~~k~--~~~~~~~~~R~~ml~~a~   62 (148)
T 3do8_A            2 KVALGGTFEPLHEGHKKLIDVAIKLGGRDITIGVTSDRMARAR--IRSVLPFAIRAENVKRYV   62 (148)
T ss_dssp             CEEEEECCSSCCHHHHHHHHHHHHHHTTCEEEEEECHHHHHHH--SCCCSCHHHHHHHHHHHH
T ss_pred             EEEEEeeCCCCCHHHHHHHHHHHHhCCCEEEEEECCCcccccc--CCCCCCHHHHHHHHHHHH
Confidence            6899999999999999999999999658999999999876422  367999999999999998
>3nbk_A Phosphopantetheine adenylyltransferase; PPAT, PHP; HET: PNS; 1.58A {Mycobacterium tuberculosis} PDB: 3nba_A* 3pnb_A* 4e1a_A 3lcj_A 3rba_A* 1tfu_A* 3rff_A 3rhs_A* 3uc5_A* Back     alignment and structure
>3nv7_A Phosphopantetheine adenylyltransferase; helicobacter pylori 26695 strain, mutant I4V/N76Y, phosphopa adenylyltransferase; 1.75A {Helicobacter pylori} PDB: 3otw_A* Back     alignment and structure
>4f3r_A Phosphopantetheine adenylyltransferase; phosphopantetheine adenylyltranferase; 2.25A {Coxiella burnetii} Back     alignment and structure
>3nd5_A Phosphopantetheine adenylyltransferase; PPAT, coenzyme A BIO pathway; 2.30A {Enterococcus faecalis} SCOP: c.26.1.0 PDB: 3nd6_A* 3nd7_A* Back     alignment and structure
>3f3m_A Phosphopantetheine adenylyltransferase; PPAT, coenzyme A BIO pathway, coenzyme A biosynthesis, nucleotidyltransferase; HET: PPS; 2.40A {Staphylococcus aureus} SCOP: c.26.1.0 Back     alignment and structure
>1vlh_A Phosphopantetheine adenylyltransferase; TM0741, structural G JCSG, protein structure initiative, PSI, joint center for S genomics; HET: PNS; 2.20A {Thermotoga maritima} SCOP: c.26.1.3 Back     alignment and structure
>2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Back     alignment and structure
>3k9w_A Phosphopantetheine adenylyltransferase; niaid, ssgcid, seattle structural genomics center for infect disease, coenzyme A, COA; HET: 4PS ADE PG4; 1.60A {Burkholderia pseudomallei} PDB: 3ikz_A* 3pxu_A* Back     alignment and structure
>1qjc_A Phosphopantetheine adenylyltransferase; coenzyme A biosynthesis, nucleotidyltransferase; HET: PNS; 1.64A {Escherichia coli} SCOP: c.26.1.3 PDB: 1h1t_A* 1gn8_A* 1b6t_A* 3l92_A* 3l93_A Back     alignment and structure
>2b7l_A Glycerol-3-phosphate cytidylyltransferase; rossmann fold; 3.00A {Staphylococcus aureus} Back     alignment and structure
>1coz_A Protein (glycerol-3-phosphate cytidylyltransferase); HET: CTP; 2.00A {Bacillus subtilis} SCOP: c.26.1.2 PDB: 1n1d_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>3h05_A Uncharacterized protein VPA0413; nucleotidylyl, transferase, MCSG, midwest center for structu genomics, PSI; 1.65A {Vibrio parahaemolyticus} Back     alignment and structure
>1o6b_A Phosphopantetheine adenylyltransferase; structural genomics; HET: ADP; 2.20A {Bacillus subtilis} SCOP: c.26.1.3 Back     alignment and structure
>1f9a_A Hypothetical protein MJ0541; alpha/beta, transferase, structural genomics; HET: ATP; 2.00A {Methanocaldococcus jannaschii} SCOP: c.26.1.3 Back     alignment and structure
>2qtr_A Nicotinate (nicotinamide) nucleotide adenylyltran; NAD, nucleotidyltransferase, pyridine nucleotide biosynthesi transferase; HET: NXX; 1.70A {Bacillus anthracis} PDB: 3dv2_A 3mla_A* 3hfj_A* 3mlb_A* 3mmx_A* 3e27_A* 2qtn_A* 2qtm_A* Back     alignment and structure
>3hl4_A Choline-phosphate cytidylyltransferase A; rossmann fold, phospholipid synthesis, phosphatidylcholine, phosphocholine, CTP, CDP-choline; HET: CDC; 2.20A {Rattus norvegicus} Back     alignment and structure
>1od6_A PPAT, phosphopantetheine adenylyltransferase; coenzyme A biosynthesis, nucleotidyltransferase; HET: PNS; 1.5A {Thermus thermophilus} SCOP: c.26.1.3 Back     alignment and structure
>1kam_A Deamido-NAD(+), nicotinate-nucleotide adenylyltransferase; rossman fold; 2.10A {Bacillus subtilis} SCOP: c.26.1.3 PDB: 1kaq_A* Back     alignment and structure
>3elb_A Ethanolamine-phosphate cytidylyltransferase; kennedy pathway, CMP, CTP, phosphoethanolamine, cytidylyltra SGC, structural genomics consortium; HET: C5P; 2.00A {Homo sapiens} Back     alignment and structure
>1yum_A 'probable nicotinate-nucleotide adenylyltransferase; alpha/beta domain; HET: CIT NCN; 1.70A {Pseudomonas aeruginosa} PDB: 1yul_A* 1yun_A* Back     alignment and structure
>1k4m_A NAMN adenylyltransferase; nucleotidyltransferase; HET: NAD CIT; 1.90A {Escherichia coli} SCOP: c.26.1.3 PDB: 1k4k_A* Back     alignment and structure
>2h29_A Probable nicotinate-nucleotide adenylyltransferase; NADD, namnat, nmnat; HET: DND; 2.00A {Staphylococcus aureus} PDB: 2h2a_A* Back     alignment and structure
>3glv_A Lipopolysaccharide core biosynthesis protein; structural GEN PSI, MCSG, protein structure initiative; HET: AMP; 1.99A {Thermoplasma volcanium GSS1} Back     alignment and structure
>1ej2_A Nicotinamide mononucleotide adenylyltransferase; dinucleotide binding fold, structural genomics, PSI; HET: NAD; 1.90A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.26.1.3 PDB: 1m8g_A* 1hyb_A* 1m8j_A* 1m8f_A* 1m8k_A* Back     alignment and structure
>3elb_A Ethanolamine-phosphate cytidylyltransferase; kennedy pathway, CMP, CTP, phosphoethanolamine, cytidylyltra SGC, structural genomics consortium; HET: C5P; 2.00A {Homo sapiens} Back     alignment and structure
>2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} Back     alignment and structure
>1nup_A FKSG76; NAD biosynthesis, mitochondria, pyridine adenylyltransferase catalysis, transferase; HET: NMN; 1.90A {Homo sapiens} SCOP: c.26.1.3 PDB: 1nuq_A* 1nur_A 1nus_A* 1nut_A* 1nuu_A* Back     alignment and structure
>1kqn_A Nmnat, nicotinamide mononucleotide adenylyl transferase; nucleotidyltransferase superfamily; HET: NAD; 2.20A {Homo sapiens} SCOP: c.26.1.3 PDB: 1kqo_A* 1kr2_A* 1kku_A 1gzu_A* Back     alignment and structure
>1jhd_A Sulfate adenylyltransferase; sulfurylase, APS, chemoautotroph, bromide; 1.70A {Sulfur-oxidizing endosymbiont ofriftia pachyptila} SCOP: b.122.1.3 c.26.1.5 Back     alignment and structure
>2x0k_A Riboflavin biosynthesis protein RIBF; riboflavin kinase, nucleotide-binding, transferase, ATP-BIND multifunctional enzyme; 1.95A {Corynebacterium ammoniagenes} Back     alignment and structure
>1v47_A ATP sulfurylase; product binding complex, zinc, riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; HET: ADX; 2.49A {Thermus thermophilus} SCOP: b.122.1.3 c.26.1.5 Back     alignment and structure
>1mrz_A Riboflavin kinase/FMN adenylyltransferase; rossmann fold, flavin binding domain, 6-stranded beta barrel nucleotide binding domain; HET: CIT; 1.90A {Thermotoga maritima} SCOP: b.43.5.1 c.26.1.3 PDB: 1s4m_A* 1t6x_A* 1t6y_A* 1t6z_A* 2i1l_A Back     alignment and structure
>2ejc_A Pantoate--beta-alanine ligase; X-RAY diffraction, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Thermotoga maritima} Back     alignment and structure
>3gmi_A UPF0348 protein MJ0951; protein with unknown function, structural genomics, PSI, MCS protein structure initiative; 1.91A {Methanocaldococcus jannaschii} Back     alignment and structure
>3op1_A Macrolide-efflux protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PEG; 2.49A {Streptococcus pneumoniae} Back     alignment and structure
>1v8f_A Pantoate-beta-alanine ligase; rossmann fold, dimer, structural genomics, riken STR genomics/proteomics initiative, RSGI; HET: P6G; 1.90A {Thermus thermophilus} SCOP: c.26.1.4 PDB: 1ufv_A Back     alignment and structure
>1r6x_A ATP:sulfate adenylyltransferase; APS kinase-like domain; 1.40A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>3ag6_A Pantothenate synthetase; ATP-dependent enzyme, ATP-binding, nucleotide-binding, pantothenate biosynthesis; HET: PAJ PG4; 1.85A {Staphylococcus aureus} PDB: 3ag5_A* 2x3f_A* Back     alignment and structure
>3cov_A Pantothenate synthetase; pantothenate biosynthesis, enzym ligase, drug design, ATP-binding, magnesium, metal-binding; 1.50A {Mycobacterium tuberculosis} SCOP: c.26.1.4 PDB: 3cow_A* 3coy_A* 3coz_A* 3imc_A* 3ime_A* 3img_A* 3iob_A* 3ioc_A* 3iod_A* 3ioe_A* 3iub_A* 3iue_A* 3ivc_A* 3ivg_A* 3ivx_A* 2a84_A* 1n2b_A* 1n2e_A* 1n2g_A* 1n2h_A* ... Back     alignment and structure
>3uk2_A Pantothenate synthetase; AMP, structural genomics, seattle S genomics center for infectious disease, ssgcid, ligase; HET: AMP; 2.25A {Burkholderia thailandensis} SCOP: c.26.1.0 Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>3q12_A Pantoate--beta-alanine ligase; structural genomics, center for structural genomics of infec diseases, csgid; HET: PAF; 1.58A {Yersinia pestis} SCOP: c.26.1.4 PDB: 3q10_A* 3mue_A 1iho_A 3guz_A* Back     alignment and structure
>3inn_A Pantothenate synthetase; ssgcid, SBRI, UW, decode, NIH, niaid, pantoate beta alanine ligase, ATP-binding, cytoplasm, ligase; HET: ATP; 2.10A {Brucella melitensis} Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>3n8h_A Pantothenate synthetase; alpha-beta sandwich, ligase, structural genomics, structural of infectious diseases; HET: MSE AMP GOL; 2.00A {Francisella tularensis subsp} PDB: 3qtt_A* Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>3mxt_A Pantothenate synthetase; alpha-beta-alpha, structural genomics, center for structural of infectious diseases, csgid, ligase; HET: MSE; 1.85A {Campylobacter jejuni subsp} SCOP: c.26.1.0 PDB: 3uy4_A* Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 87
d1lw7a1163 c.26.1.3 (A:57-219) Transcriptional regulator NadR 5e-07
d1k4ma_ 213 c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) ad 5e-05
d1kama_ 189 c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) ad 1e-04
d1ej2a_ 167 c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) ad 4e-04
d1f9aa_ 164 c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) ad 0.002
>d1lw7a1 c.26.1.3 (A:57-219) Transcriptional regulator NadR, NMN-adenylyltransferase domain {Haemophilus influenzae [TaxId: 727]} Length = 163 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Nucleotidylyl transferase
family: Adenylyltransferase
domain: Transcriptional regulator NadR, NMN-adenylyltransferase domain
species: Haemophilus influenzae [TaxId: 727]

 Score = 42.5 bits (99), Expect = 5e-07
 Identities = 16/67 (23%), Positives = 28/67 (41%), Gaps = 5/67 (7%)

Query: 24 VVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFA----ELIQPVDERMR 79
           V+ G F  +H GH   +  +     D + V VC   +   K F     + +  V +R+R
Sbjct: 5  GVIFGKFYPVHTGHINMIYEAFSKV-DELHVIVCSDTVRDLKLFYDSKMKRMPTVQDRLR 63

Query: 80 NVEAYIK 86
           ++   K
Sbjct: 64 WMQQIFK 70
>d1k4ma_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Escherichia coli [TaxId: 562]} Length = 213 Back     information, alignment and structure
>d1kama_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Bacillus subtilis [TaxId: 1423]} Length = 189 Back     information, alignment and structure
>d1ej2a_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 167 Back     information, alignment and structure
>d1f9aa_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 164 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query87
d1coza_126 CTP:glycerol-3-phosphate cytidylyltransferase {Bac 99.75
d1ej2a_ 167 Nicotinamide mononucleotide (NMN) adenylyltransfer 99.69
d1f9aa_ 164 Nicotinamide mononucleotide (NMN) adenylyltransfer 99.69
d1o6ba_ 163 Phosphopantetheine adenylyltransferase {Bacillus s 99.68
d1lw7a1163 Transcriptional regulator NadR, NMN-adenylyltransf 99.65
d1qjca_157 Phosphopantetheine adenylyltransferase {Escherichi 99.63
d1od6a_160 Phosphopantetheine adenylyltransferase {Thermus th 99.61
d1tfua_157 Phosphopantetheine adenylyltransferase {Mycobacter 99.58
d1vlha_157 Phosphopantetheine adenylyltransferase {Thermotoga 99.57
d1k4ma_ 213 Nicotinamide mononucleotide (NMN) adenylyltransfer 99.53
d1kama_ 189 Nicotinamide mononucleotide (NMN) adenylyltransfer 99.52
d1kr2a_ 271 Nicotinamide mononucleotide (NMN) adenylyltransfer 99.52
d1nuua_ 233 Cytosolic NMN/NAMN adenylyltransferase {Human (Hom 99.35
d1jhda2 223 ATP sulfurylase catalytic domain {Sulfur-oxidizing 99.23
d1mrza2157 FMN adenylyltransferase domain of bifunctional FAD 98.39
d1g8fa2 221 ATP sulfurylase catalytic domain {Baker's yeast (S 96.65
d1v47a2 214 ATP sulfurylase catalytic domain {Thermus thermoph 96.25
d1v8fa_ 276 Pantothenate synthetase (Pantoate-beta-alanine lig 95.32
d1ihoa_ 282 Pantothenate synthetase (Pantoate-beta-alanine lig 95.25
d1x6va2 235 ATP sulfurylase catalytic domain {Human (Homo sapi 94.04
d2a84a1 286 Pantothenate synthetase (Pantoate-beta-alanine lig 93.04
>d1coza_ c.26.1.2 (A:) CTP:glycerol-3-phosphate cytidylyltransferase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Nucleotidylyl transferase
family: Cytidylyltransferase
domain: CTP:glycerol-3-phosphate cytidylyltransferase
species: Bacillus subtilis [TaxId: 1423]

Probab=99.75  E-value=1.7e-19  Score=115.59  Aligned_cols=61  Identities=30%  Similarity=0.389  Sum_probs=54.3

Q ss_pred             ccEEEEcccCCCCCHHHHHHHHHHHHHhcCeEEEEEcCCCcccccCCCCCCCCHHHHHHHHHH
Q 034677           21 YGAVVLGGTFDRLHDGHRLFLKASAELARDRIVVGVCDGPMLTNKQFAELIQPVDERMRNVEA   83 (87)
Q Consensus        21 ~~~v~~gGtFDplH~GHl~ll~~a~~~~~d~vivgv~~d~~~~~k~~~~~i~~~~~R~~~v~~   83 (87)
                      |++|+++|+||++|.||+.++++|+++| |.|+||+++|+....++ .+|++|+++|.++|++
T Consensus         1 Mk~V~~~G~FD~lH~GH~~~l~~Ak~~g-d~liV~v~sD~~~~~~k-~~pi~~~~eR~~~l~~   61 (126)
T d1coza_           1 MKKVITYGTFDLLHWGHIKLLERAKQLG-DYLVVAISTDEFNLQKQ-KKAYHSYEHRKLILET   61 (126)
T ss_dssp             CCEEEEEECCCSCCHHHHHHHHHHHTTS-SEEEEEEECHHHHHHHT-CCCSSCHHHHHHHHTT
T ss_pred             CcEEEEeeEeCCCCHHHHHHHHHHHhhC-ceeeeeeeccchhhhcc-CcccCCHHHHHHHhhh
Confidence            7899999999999999999999999998 89999999998764332 3799999999999864
>d1ej2a_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1f9aa_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1o6ba_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lw7a1 c.26.1.3 (A:57-219) Transcriptional regulator NadR, NMN-adenylyltransferase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qjca_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1od6a_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tfua_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vlha_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1k4ma_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kama_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kr2a_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nuua_ c.26.1.3 (A:) Cytosolic NMN/NAMN adenylyltransferase {Human (Homo sapiens), FKSG76 [TaxId: 9606]} Back     information, alignment and structure
>d1jhda2 c.26.1.5 (A:174-396) ATP sulfurylase catalytic domain {Sulfur-oxidizing endosymbiont of Riftia pachyptila [TaxId: 35843]} Back     information, alignment and structure
>d1mrza2 c.26.1.3 (A:2-158) FMN adenylyltransferase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g8fa2 c.26.1.5 (A:169-389) ATP sulfurylase catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v47a2 c.26.1.5 (A:136-349) ATP sulfurylase catalytic domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v8fa_ c.26.1.4 (A:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ihoa_ c.26.1.4 (A:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va2 c.26.1.5 (A:390-624) ATP sulfurylase catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a84a1 c.26.1.4 (A:3-288) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure