Citrus Sinensis ID: 034686


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-------
MLLRPGSMFIDNLSKASKFSDEGYGSVKRVYLVCEEDIGLPKHFQHWMIQNYPVNEVMEIKGGDHMAMLSEPQKLCDCLSQISLKYA
cccccccccHHHHHHcccccccccccEEEEEEEccccccccHHHHHHHHHHccccEEEEcccccccccccccHHHHHHHHHHHHHHc
HHcccEcccHHHHHHccccccccHHHccEEEEEccccccccHHHHHHHHHHccccEEEEcccccccHHHHcHHHHHHHHHHHHHHHc
mllrpgsmfidnlskaskfsdegygsvKRVYLVCeediglpkhFQHWMiqnypvnevmeikggdhmamlsepqklcdclsqislkya
mllrpgsmfidnlskaskfsdegygSVKRVYLVCEEDIGLPKHFQHWMIQNYPVNEVMEIKGGDHMAMLSEPQKLCDCLSQISLKYA
MLLRPGSMFIDNLSKASKFSDEGYGSVKRVYLVCEEDIGLPKHFQHWMIQNYPVNEVMEIKGGDHMAMLSEPQKLCDCLSQISLKYA
*********************EGYGSVKRVYLVCEEDIGLPKHFQHWMIQNYPVNEVMEIKGGDHMAMLSEPQKLCDCLSQI*****
MLLRPGSMFIDNLSKASKFSDEGYGSVKRVYLVCEEDIGLPKHFQHWMIQNYPVNEVMEIKGGDHMAMLSEPQKLCDCLSQISLKY*
MLLRPGSMFIDNLSKASKFSDEGYGSVKRVYLVCEEDIGLPKHFQHWMIQNYPVNEVMEIKGGDHMAMLSEPQKLCDCLSQISLKYA
MLLRPGSMFIDNLSKASKFSDEGYGSVKRVYLVCEEDIGLPKHFQHWMIQNYPVNEVMEIKGGDHMAMLSEPQKLCDCLSQISLKYA
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLRPGSMFIDNLSKASKFSDEGYGSVKRVYLVCEEDIGLPKHFQHWMIQNYPVNEVMEIKGGDHMAMLSEPQKLCDCLSQISLKYA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query87 2.2.26 [Sep-21-2011]
Q6RYA0260 Salicylic acid-binding pr N/A no 0.977 0.326 0.611 1e-25
O80474263 Methylesterase 4 OS=Arabi yes no 1.0 0.330 0.528 3e-23
Q8S8S9263 Methylesterase 1 OS=Arabi no no 1.0 0.330 0.540 3e-23
Q9LFT6258 Alpha-hydroxynitrile lyas no no 0.988 0.333 0.581 2e-22
F4IMK4260 Putative methylesterase 1 no no 1.0 0.334 0.528 4e-22
Q9SE93264 Polyneuridine-aldehyde es N/A no 0.954 0.314 0.530 5e-21
F4IMK2265 Putative methylesterase 6 no no 0.977 0.320 0.494 8e-20
O23171256 Methylesterase 9 OS=Arabi no no 0.988 0.335 0.511 8e-20
O80472260 Methylesterase 7 OS=Arabi no no 1.0 0.334 0.471 1e-18
O80477263 Methylesterase 3 OS=Arabi no no 1.0 0.330 0.471 1e-18
>sp|Q6RYA0|SABP2_TOBAC Salicylic acid-binding protein 2 OS=Nicotiana tabacum GN=SABP2 PE=1 SV=1 Back     alignment and function desciption
 Score =  114 bits (286), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 65/85 (76%)

Query: 2   LLRPGSMFIDNLSKASKFSDEGYGSVKRVYLVCEEDIGLPKHFQHWMIQNYPVNEVMEIK 61
           L+RP S+F+++LSKA  F+DE +GSVKRVY+VC ED G+P+ FQ W I N  V E +EIK
Sbjct: 175 LVRPSSLFMEDLSKAKYFTDERFGSVKRVYIVCTEDKGIPEEFQRWQIDNIGVTEAIEIK 234

Query: 62  GGDHMAMLSEPQKLCDCLSQISLKY 86
           G DHMAML EPQKLC  L +I+ KY
Sbjct: 235 GADHMAMLCEPQKLCASLLEIAHKY 259




Required to convert methyl salicylate (MeSA) to salicylic acid (SA) as part of the signal transduction pathways that activate systemic acquired resistance in systemic tissue. MeSA is believed to be an inactive form that needs to be demethylated to exert a biological effect. Also able to catalyze the conversion of acibenzolar-S-methyl into acibenzolar to induce systemic acquired resistance.
Nicotiana tabacum (taxid: 4097)
EC: 3EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|O80474|MES4_ARATH Methylesterase 4 OS=Arabidopsis thaliana GN=MES4 PE=1 SV=1 Back     alignment and function description
>sp|Q8S8S9|MES1_ARATH Methylesterase 1 OS=Arabidopsis thaliana GN=MES1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LFT6|HNL_ARATH Alpha-hydroxynitrile lyase OS=Arabidopsis thaliana GN=HNL PE=1 SV=1 Back     alignment and function description
>sp|F4IMK4|MES19_ARATH Putative methylesterase 19 OS=Arabidopsis thaliana GN=MES19 PE=2 SV=2 Back     alignment and function description
>sp|Q9SE93|PNAE_RAUSE Polyneuridine-aldehyde esterase OS=Rauvolfia serpentina GN=PNAE PE=1 SV=1 Back     alignment and function description
>sp|F4IMK2|MES6_ARATH Putative methylesterase 6 OS=Arabidopsis thaliana GN=MES6 PE=2 SV=1 Back     alignment and function description
>sp|O23171|MES9_ARATH Methylesterase 9 OS=Arabidopsis thaliana GN=MES9 PE=1 SV=1 Back     alignment and function description
>sp|O80472|MES7_ARATH Methylesterase 7 OS=Arabidopsis thaliana GN=MES7 PE=1 SV=1 Back     alignment and function description
>sp|O80477|MES3_ARATH Methylesterase 3 OS=Arabidopsis thaliana GN=MES3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query87
14279437 267 ethylene-induced esterase [Citrus sinens 1.0 0.325 0.954 4e-43
224096834 263 predicted protein [Populus trichocarpa] 0.988 0.326 0.593 2e-25
224096838 263 predicted protein [Populus trichocarpa] 0.988 0.326 0.604 9e-25
406365498 260 salicylic acid-binding protein 2 [Nicoti 0.977 0.326 0.6 5e-24
75324631 260 RecName: Full=Salicylic acid-binding pro 0.977 0.326 0.611 6e-24
356511853 260 PREDICTED: polyneuridine-aldehyde estera 0.988 0.330 0.581 1e-23
255562677 263 Polyneuridine-aldehyde esterase precurso 0.988 0.326 0.569 2e-23
356502227 261 PREDICTED: polyneuridine-aldehyde estera 0.977 0.325 0.588 5e-23
356498541 264 PREDICTED: polyneuridine-aldehyde estera 0.988 0.325 0.586 6e-23
53830670 258 protein S [Catharanthus roseus] 1.0 0.337 0.563 7e-23
>gi|14279437|gb|AAK58599.1|AF269158_1 ethylene-induced esterase [Citrus sinensis] Back     alignment and taxonomy information
 Score =  178 bits (451), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 85/87 (97%)

Query: 1   MLLRPGSMFIDNLSKASKFSDEGYGSVKRVYLVCEEDIGLPKHFQHWMIQNYPVNEVMEI 60
           ML+RPGSMFIDNLSK SKFSDEGYGSVKRVYLVCEEDIGLPK FQHWMIQNYPVNEVMEI
Sbjct: 181 MLVRPGSMFIDNLSKESKFSDEGYGSVKRVYLVCEEDIGLPKQFQHWMIQNYPVNEVMEI 240

Query: 61  KGGDHMAMLSEPQKLCDCLSQISLKYA 87
           KGGDHMAMLS+PQKLCDCLSQISLKYA
Sbjct: 241 KGGDHMAMLSDPQKLCDCLSQISLKYA 267




Source: Citrus sinensis

Species: Citrus sinensis

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224096834|ref|XP_002310754.1| predicted protein [Populus trichocarpa] gi|222853657|gb|EEE91204.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224096838|ref|XP_002310756.1| predicted protein [Populus trichocarpa] gi|222853659|gb|EEE91206.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|406365498|gb|AFS35576.1| salicylic acid-binding protein 2 [Nicotiana benthamiana] Back     alignment and taxonomy information
>gi|75324631|sp|Q6RYA0.1|SABP2_TOBAC RecName: Full=Salicylic acid-binding protein 2; Short=NtSABP2; AltName: Full=Methyl salicylate esterase gi|40549303|gb|AAR87711.1| salicylic acid-binding protein 2 [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|356511853|ref|XP_003524636.1| PREDICTED: polyneuridine-aldehyde esterase-like [Glycine max] Back     alignment and taxonomy information
>gi|255562677|ref|XP_002522344.1| Polyneuridine-aldehyde esterase precursor, putative [Ricinus communis] gi|223538422|gb|EEF40028.1| Polyneuridine-aldehyde esterase precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356502227|ref|XP_003519921.1| PREDICTED: polyneuridine-aldehyde esterase-like [Glycine max] Back     alignment and taxonomy information
>gi|356498541|ref|XP_003518109.1| PREDICTED: polyneuridine-aldehyde esterase-like [Glycine max] Back     alignment and taxonomy information
>gi|53830670|gb|AAU95203.1| protein S [Catharanthus roseus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query87
UNIPROTKB|Q6RYA0260 SABP2 "Salicylic acid-binding 0.977 0.326 0.611 1.6e-24
TAIR|locus:2046748263 MES1 "methyl esterase 1" [Arab 0.988 0.326 0.546 4.3e-22
TAIR|locus:2046827263 MES4 "methyl esterase 4" [Arab 1.0 0.330 0.528 9e-22
TAIR|locus:2145412258 MES5 "methyl esterase 5" [Arab 0.988 0.333 0.581 1.1e-21
TAIR|locus:2046773265 MES6 "methyl esterase 6" [Arab 0.977 0.320 0.494 5.1e-19
TAIR|locus:2114985256 MES9 "methyl esterase 9" [Arab 0.988 0.335 0.511 5.1e-19
TAIR|locus:2046862263 MES3 "methyl esterase 3" [Arab 1.0 0.330 0.471 3.6e-18
TAIR|locus:2046793260 MES7 "methyl esterase 7" [Arab 1.0 0.334 0.471 5.8e-18
TAIR|locus:2046842272 MES8 "methyl esterase 8" [Arab 1.0 0.319 0.448 5.8e-18
TAIR|locus:2046852263 ACL "acetone-cyanohydrin lyase 0.954 0.315 0.506 7.5e-18
UNIPROTKB|Q6RYA0 SABP2 "Salicylic acid-binding protein 2" [Nicotiana tabacum (taxid:4097)] Back     alignment and assigned GO terms
 Score = 280 (103.6 bits), Expect = 1.6e-24, P = 1.6e-24
 Identities = 52/85 (61%), Positives = 65/85 (76%)

Query:     2 LLRPGSMFIDNLSKASKFSDEGYGSVKRVYLVCEEDIGLPKHFQHWMIQNYPVNEVMEIK 61
             L+RP S+F+++LSKA  F+DE +GSVKRVY+VC ED G+P+ FQ W I N  V E +EIK
Sbjct:   175 LVRPSSLFMEDLSKAKYFTDERFGSVKRVYIVCTEDKGIPEEFQRWQIDNIGVTEAIEIK 234

Query:    62 GGDHMAMLSEPQKLCDCLSQISLKY 86
             G DHMAML EPQKLC  L +I+ KY
Sbjct:   235 GADHMAMLCEPQKLCASLLEIAHKY 259




GO:0008152 "metabolic process" evidence=IDA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=IMP
GO:0016298 "lipase activity" evidence=IDA
GO:0080031 "methyl salicylate esterase activity" evidence=IMP;IDA
TAIR|locus:2046748 MES1 "methyl esterase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046827 MES4 "methyl esterase 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2145412 MES5 "methyl esterase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046773 MES6 "methyl esterase 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2114985 MES9 "methyl esterase 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046862 MES3 "methyl esterase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046793 MES7 "methyl esterase 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046842 MES8 "methyl esterase 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046852 ACL "acetone-cyanohydrin lyase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_fgenesh4_pm.C_LG_VII0354
hypothetical protein (264 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
pfam12697187 pfam12697, Abhydrolase_6, Alpha/beta hydrolase fam 7e-06
PLN02211273 PLN02211, PLN02211, methyl indole-3-acetate methyl 0.003
>gnl|CDD|221720 pfam12697, Abhydrolase_6, Alpha/beta hydrolase family Back     alignment and domain information
 Score = 41.3 bits (97), Expect = 7e-06
 Identities = 10/52 (19%), Positives = 25/52 (48%)

Query: 26  SVKRVYLVCEEDIGLPKHFQHWMIQNYPVNEVMEIKGGDHMAMLSEPQKLCD 77
           +V  + +  E+D  +P      + +  P  E++ + G  H+  L  P+++ +
Sbjct: 135 TVPVLVIHGEDDPLVPPEAARRLAEALPGAELVVLPGAGHLPHLEHPEEVAE 186


This family contains alpha/beta hydrolase enzymes of diverse specificity. Length = 187

>gnl|CDD|215128 PLN02211, PLN02211, methyl indole-3-acetate methyltransferase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 87
PLN02211273 methyl indole-3-acetate methyltransferase 99.65
PLN02965255 Probable pheophorbidase 99.59
PRK10349256 carboxylesterase BioH; Provisional 99.37
KOG1454326 consensus Predicted hydrolase/acyltransferase (alp 99.36
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 99.33
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 99.32
PLN02824294 hydrolase, alpha/beta fold family protein 99.32
PRK03204286 haloalkane dehalogenase; Provisional 99.3
PRK07581339 hypothetical protein; Validated 99.27
PLN02679360 hydrolase, alpha/beta fold family protein 99.26
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 99.25
PRK03592295 haloalkane dehalogenase; Provisional 99.24
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 99.22
PRK08775343 homoserine O-acetyltransferase; Provisional 99.2
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 99.19
PRK10673255 acyl-CoA esterase; Provisional 99.18
TIGR03611257 RutD pyrimidine utilization protein D. This protei 99.18
PRK00870302 haloalkane dehalogenase; Provisional 99.17
PLN02578354 hydrolase 99.15
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 99.14
PRK00175379 metX homoserine O-acetyltransferase; Provisional 99.14
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 99.13
PLN03084383 alpha/beta hydrolase fold protein; Provisional 99.1
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 99.1
PRK06489360 hypothetical protein; Provisional 99.09
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 99.05
PLN02385349 hydrolase; alpha/beta fold family protein 99.03
PLN02894402 hydrolase, alpha/beta fold family protein 98.98
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 98.97
PRK06765389 homoserine O-acetyltransferase; Provisional 98.95
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 98.9
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 98.89
PLN02298330 hydrolase, alpha/beta fold family protein 98.86
KOG2382315 consensus Predicted alpha/beta hydrolase [General 98.85
PHA02857276 monoglyceride lipase; Provisional 98.84
PRK05855 582 short chain dehydrogenase; Validated 98.83
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 98.81
KOG4178322 consensus Soluble epoxide hydrolase [Lipid transpo 98.77
PRK10749330 lysophospholipase L2; Provisional 98.75
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 98.74
PLN02511388 hydrolase 98.7
PLN02652395 hydrolase; alpha/beta fold family protein 98.62
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 98.59
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 98.46
PRK05077414 frsA fermentation/respiration switch protein; Revi 98.29
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 98.27
PLN02872395 triacylglycerol lipase 98.27
PRK10985324 putative hydrolase; Provisional 98.23
TIGR01838532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 98.21
PF08386103 Abhydrolase_4: TAP-like protein; InterPro: IPR0135 98.17
KOG2984277 consensus Predicted hydrolase [General function pr 97.94
PRK07868 994 acyl-CoA synthetase; Validated 97.92
KOG4409365 consensus Predicted hydrolase/acyltransferase (alp 97.82
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 97.82
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 97.78
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 97.64
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 97.59
PRK11460232 putative hydrolase; Provisional 97.47
PRK10566249 esterase; Provisional 97.45
PRK11071190 esterase YqiA; Provisional 97.43
PF05705240 DUF829: Eukaryotic protein of unknown function (DU 97.26
PRK13604307 luxD acyl transferase; Provisional 97.24
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 97.11
COG1647243 Esterase/lipase [General function prediction only] 97.05
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 97.02
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 97.01
COG2021368 MET2 Homoserine acetyltransferase [Amino acid tran 96.99
KOG4667269 consensus Predicted esterase [Lipid transport and 96.98
COG3208244 GrsT Predicted thioesterase involved in non-riboso 96.84
COG2267298 PldB Lysophospholipase [Lipid metabolism] 96.73
PF09752348 DUF2048: Uncharacterized conserved protein (DUF204 96.73
KOG1552258 consensus Predicted alpha/beta hydrolase [General 96.57
KOG2551230 consensus Phospholipase/carboxyhydrolase [Amino ac 96.28
PTZ00472462 serine carboxypeptidase (CBP1); Provisional 96.21
PF03959212 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 96.06
PF01738218 DLH: Dienelactone hydrolase family; InterPro: IPR0 96.04
PF08840213 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term 96.0
COG0429345 Predicted hydrolase of the alpha/beta-hydrolase fo 95.99
COG1073299 Hydrolases of the alpha/beta superfamily [General 95.74
COG3243445 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me 95.73
PF00450415 Peptidase_S10: Serine carboxypeptidase; InterPro: 95.73
PF10142367 PhoPQ_related: PhoPQ-activated pathogenicity-relat 95.69
COG0400207 Predicted esterase [General function prediction on 95.5
PLN02442283 S-formylglutathione hydrolase 95.2
COG3545181 Predicted esterase of the alpha/beta hydrolase fol 94.96
KOG4391300 consensus Predicted alpha/beta hydrolase BEM46 [Ge 94.96
TIGR01849406 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, 94.67
KOG2564343 consensus Predicted acetyltransferases and hydrola 94.61
TIGR01839560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 94.29
PF03096283 Ndr: Ndr family; InterPro: IPR004142 This family c 94.27
PF05448320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 94.23
PLN02213319 sinapoylglucose-malate O-sinapoyltransferase/ carb 94.13
KOG3253 784 consensus Predicted alpha/beta hydrolase [General 93.83
KOG1455313 consensus Lysophospholipase [Lipid transport and m 93.74
PF04301213 DUF452: Protein of unknown function (DUF452); Inte 93.72
COG2945210 Predicted hydrolase of the alpha/beta superfamily 93.71
KOG1551371 consensus Uncharacterized conserved protein [Funct 93.64
PLN02209437 serine carboxypeptidase 92.94
PLN03016433 sinapoylglucose-malate O-sinapoyltransferase 92.41
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 91.92
KOG1838409 consensus Alpha/beta hydrolase [General function p 91.73
KOG3043242 consensus Predicted hydrolase related to dienelact 90.94
PF03583290 LIP: Secretory lipase ; InterPro: IPR005152 This e 90.79
KOG1282454 consensus Serine carboxypeptidases (lysosomal cath 90.76
KOG2931326 consensus Differentiation-related gene 1 protein ( 90.69
PRK10162318 acetyl esterase; Provisional 90.59
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 90.47
PRK05371 767 x-prolyl-dipeptidyl aminopeptidase; Provisional 88.98
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 86.29
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 85.9
PRK10115686 protease 2; Provisional 85.68
COG0412236 Dienelactone hydrolase and related enzymes [Second 84.76
COG4287 507 PqaA PhoPQ-activated pathogenicity-related protein 83.76
COG4757281 Predicted alpha/beta hydrolase [General function p 83.46
COG0657312 Aes Esterase/lipase [Lipid metabolism] 83.14
PLN00021313 chlorophyllase 81.87
KOG4627270 consensus Kynurenine formamidase [Amino acid trans 81.34
PF06850202 PHB_depo_C: PHB de-polymerase C-terminus; InterPro 80.76
COG2939498 Carboxypeptidase C (cathepsin A) [Amino acid trans 80.67
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
Probab=99.65  E-value=9.7e-16  Score=104.06  Aligned_cols=81  Identities=30%  Similarity=0.413  Sum_probs=67.3

Q ss_pred             CcCCCccccccccccCc-ccccccCCcceEEEEeCCCCCCCHHHHHHHHHhCCCCcEEEecCCCCccCCcChHHHHHHHH
Q 034686            2 LLRPGSMFIDNLSKASK-FSDEGYGSVKRVYLVCEEDIGLPKHFQHWMIQNYPVNEVMEIKGGDHMAMLSEPQKLCDCLS   80 (87)
Q Consensus         2 ~lrp~~~~~~~~~~~~~-~~~~~~~~~P~~~i~g~~D~~~p~~~~~~~~~~~~~~~~~~l~~aGH~p~l~~p~~~~~~l~   80 (87)
                      .++|+|..  .+.+... ....+|.++|++||+|++|.++|++.++.|++..++.+++.++ +||+||+|+|++|++.|.
T Consensus       188 ~~~~~~~~--~~~~~~~~~~~~~~~~vP~l~I~g~~D~~ip~~~~~~m~~~~~~~~~~~l~-~gH~p~ls~P~~~~~~i~  264 (273)
T PLN02211        188 LLRPGPIL--ALRSARFEEETGDIDKVPRVYIKTLHDHVVKPEQQEAMIKRWPPSQVYELE-SDHSPFFSTPFLLFGLLI  264 (273)
T ss_pred             hcCCcCcc--ccccccccccccccCccceEEEEeCCCCCCCHHHHHHHHHhCCccEEEEEC-CCCCccccCHHHHHHHHH
Confidence            46777765  4444332 1234677899999999999999999999999999888999997 999999999999999999


Q ss_pred             HHHHH
Q 034686           81 QISLK   85 (87)
Q Consensus        81 ~~~~~   85 (87)
                      ++++.
T Consensus       265 ~~a~~  269 (273)
T PLN02211        265 KAAAS  269 (273)
T ss_pred             HHHHH
Confidence            98875



>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>PF08386 Abhydrolase_4: TAP-like protein; InterPro: IPR013595 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG2984 consensus Predicted hydrolase [General function prediction only] Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>PF05705 DUF829: Eukaryotic protein of unknown function (DUF829); InterPro: IPR008547 This signature identifies Transmembrane protein 53, that have no known function but are predicted to be integral membrane proteins Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4667 consensus Predicted esterase [Lipid transport and metabolism] Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function Back     alignment and domain information
>KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>KOG2551 consensus Phospholipase/carboxyhydrolase [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>COG1073 Hydrolases of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] Back     alignment and domain information
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF10142 PhoPQ_related: PhoPQ-activated pathogenicity-related protein; InterPro: IPR009199 Proteins in this entry are believed to play a role in virulence/pathogenicity in Salmonella Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only] Back     alignment and domain information
>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>PF03096 Ndr: Ndr family; InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3 Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>PLN02213 sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information
>KOG3253 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>PF04301 DUF452: Protein of unknown function (DUF452); InterPro: IPR007398 This is a family of uncharacterised proteins Back     alignment and domain information
>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>KOG1551 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02209 serine carboxypeptidase Back     alignment and domain information
>PLN03016 sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>KOG1838 consensus Alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>KOG3043 consensus Predicted hydrolase related to dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>KOG1282 consensus Serine carboxypeptidases (lysosomal cathepsin A) [Posttranslational modification, protein turnover, chaperones; Amino acid transport and metabolism] Back     alignment and domain information
>KOG2931 consensus Differentiation-related gene 1 protein (NDR1 protein), related proteins [Function unknown] Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG4287 PqaA PhoPQ-activated pathogenicity-related protein [General function prediction only] Back     alignment and domain information
>COG4757 Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>KOG4627 consensus Kynurenine formamidase [Amino acid transport and metabolism] Back     alignment and domain information
>PF06850 PHB_depo_C: PHB de-polymerase C-terminus; InterPro: IPR009656 This entry represents the C terminus of bacterial poly(3-hydroxybutyrate) (PHB) de-polymerase Back     alignment and domain information
>COG2939 Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
1y7h_A268 Structural And Biochemical Studies Identify Tobacco 3e-25
1xkl_A273 Crystal Structure Of Salicylic Acid-Binding Protein 3e-25
3dqz_A258 Structure Of The Hydroxynitrile Lyase From Arabidop 2e-23
3gzj_A258 Crystal Structure Of Polyneuridine Aldehyde Esteras 4e-21
2wfm_A264 Crystal Structure Of Polyneuridine Aldehyde Esteras 4e-21
2wfl_A264 Crystal Structure Of Polyneuridine Aldehyde Esteras 6e-21
2wfl_B264 Crystal Structure Of Polyneuridine Aldehyde Esteras 8e-20
3rkt_A258 Crystal Structure Of The Manihot Esculenta Hydroxyn 5e-16
3rks_A258 Crystal Structure Of The Manihot Esculenta Hydroxyn 1e-15
1eb8_A262 Structure Determinants Of Substrate Specificity Of 1e-14
1e89_A262 On The Mechanism Of Cyanogenesis Catalyzed By Hydro 1e-14
1dwq_A262 Crystal Structure Of Hydroxynitrile Lyase From Mani 1e-14
1dwo_A262 Crystal Structure Of Hydroxynitrile Lyase From Mani 1e-14
1sci_A257 K236l Mutant Of Hydroxynitrile Lyase From Hevea Bra 4e-14
2g4l_A257 Anomalous Substructure Of Hydroxynitrile Lyase Leng 9e-14
3stt_A267 Crystal Structure Of Tomato Methylketone Synthase I 1e-13
3sty_A267 Crystal Structure Of Tomato Methylketone Synthase I 1e-13
1yas_A257 Hydroxynitrile Lyase Complexed With Histidine Lengt 1e-13
1yb6_A256 Hydroxynitrile Lyase From Hevea Brasiliensis In Com 1e-13
3stx_A267 Crystal Structure Of Tomato Methylketone Synthase I 1e-12
>pdb|1Y7H|A Chain A, Structural And Biochemical Studies Identify Tobacco Sabp2 As A Methylsalicylate Esterase And Further Implicate It In Plant Innate Immunity, Northeast Structural Genomics Target Ar2241 Length = 268 Back     alignment and structure

Iteration: 1

Score = 110 bits (274), Expect = 3e-25, Method: Composition-based stats. Identities = 50/85 (58%), Positives = 62/85 (72%) Query: 2 LLRPGSMFIDNLSKASKFSDEGYGSVKRVYLVCEEDIGLPKHFQHWMIQNYPVNEVMEIK 61 L+RP S+F ++LSKA F+DE +GSVKRVY+VC ED G+P+ FQ W I N V E +EIK Sbjct: 175 LVRPSSLFXEDLSKAKYFTDERFGSVKRVYIVCTEDKGIPEEFQRWQIDNIGVTEAIEIK 234 Query: 62 GGDHMAMLSEPQKLCDCLSQISLKY 86 G DH A L EPQKLC L +I+ KY Sbjct: 235 GADHXAXLCEPQKLCASLLEIAHKY 259
>pdb|1XKL|A Chain A, Crystal Structure Of Salicylic Acid-Binding Protein 2 (Sabp2) From Nicotiana Tabacum, Nesg Target Ar2241 Length = 273 Back     alignment and structure
>pdb|3DQZ|A Chain A, Structure Of The Hydroxynitrile Lyase From Arabidopsis Thaliana Length = 258 Back     alignment and structure
>pdb|3GZJ|A Chain A, Crystal Structure Of Polyneuridine Aldehyde Esterase Complexed With 16-Epi-Vellosimine Length = 258 Back     alignment and structure
>pdb|2WFM|A Chain A, Crystal Structure Of Polyneuridine Aldehyde Esterase Mutant (H244a) Length = 264 Back     alignment and structure
>pdb|2WFL|A Chain A, Crystal Structure Of Polyneuridine Aldehyde Esterase Length = 264 Back     alignment and structure
>pdb|2WFL|B Chain B, Crystal Structure Of Polyneuridine Aldehyde Esterase Length = 264 Back     alignment and structure
>pdb|3RKT|A Chain A, Crystal Structure Of The Manihot Esculenta Hydroxynitrile Lyase (Mehnl) 3kp Triple Mutant Length = 258 Back     alignment and structure
>pdb|3RKS|A Chain A, Crystal Structure Of The Manihot Esculenta Hydroxynitrile Lyase (Mehnl) K176p Mutant Length = 258 Back     alignment and structure
>pdb|1EB8|A Chain A, Structure Determinants Of Substrate Specificity Of Hydroxynitrile Lyase From Manihot Esculenta Length = 262 Back     alignment and structure
>pdb|1E89|A Chain A, On The Mechanism Of Cyanogenesis Catalyzed By Hydroxynitrile Lyase From Manihot Esculenta. Crystal Structure Of Active Site Mutant Ser80ala In Complex With Acetone Cyanohydrin Length = 262 Back     alignment and structure
>pdb|1DWQ|A Chain A, Crystal Structure Of Hydroxynitrile Lyase From Manihot Esculenta In Complex With Substrates Acetone And Chloroacetone:implications For The Mechanism Of Cyanogenesis Length = 262 Back     alignment and structure
>pdb|1DWO|A Chain A, Crystal Structure Of Hydroxynitrile Lyase From Manihot Esculenta In Complex With Substrates Acetone And Chloroacetone:implications For The Mechanism Of Cyanogenesis Length = 262 Back     alignment and structure
>pdb|1SCI|A Chain A, K236l Mutant Of Hydroxynitrile Lyase From Hevea Brasiliensis Length = 257 Back     alignment and structure
>pdb|2G4L|A Chain A, Anomalous Substructure Of Hydroxynitrile Lyase Length = 257 Back     alignment and structure
>pdb|3STT|A Chain A, Crystal Structure Of Tomato Methylketone Synthase I Apo Form Length = 267 Back     alignment and structure
>pdb|3STY|A Chain A, Crystal Structure Of Tomato Methylketone Synthase I T18a Mutant Length = 267 Back     alignment and structure
>pdb|1YAS|A Chain A, Hydroxynitrile Lyase Complexed With Histidine Length = 257 Back     alignment and structure
>pdb|1YB6|A Chain A, Hydroxynitrile Lyase From Hevea Brasiliensis In Complex With Mandelonitrile Length = 256 Back     alignment and structure
>pdb|3STX|A Chain A, Crystal Structure Of Tomato Methylketone Synthase I H243a Variant Complexed With Beta-Ketoheptanoate Length = 267 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 2e-31
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 6e-31
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 6e-30
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 9e-30
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 3e-29
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} Length = 258 Back     alignment and structure
 Score =  109 bits (273), Expect = 2e-31
 Identities = 50/86 (58%), Positives = 62/86 (72%)

Query: 1   MLLRPGSMFIDNLSKASKFSDEGYGSVKRVYLVCEEDIGLPKHFQHWMIQNYPVNEVMEI 60
           ML R GS F ++LSK  KFS+EGYGSV+RVY++  ED  +P  F  WMI N+ V++V EI
Sbjct: 172 MLHRQGSFFTEDLSKKEKFSEEGYGSVQRVYVMSSEDKAIPCDFIRWMIDNFNVSKVYEI 231

Query: 61  KGGDHMAMLSEPQKLCDCLSQISLKY 86
            GGDHM MLS+PQKL D LS I+  Y
Sbjct: 232 DGGDHMVMLSKPQKLFDSLSAIATDY 257


>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Length = 257 Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Length = 273 Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Length = 264 Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Length = 267 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query87
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 99.65
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 99.57
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 99.55
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 99.53
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 99.52
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 99.43
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 99.39
1iup_A282 META-cleavage product hydrolase; aromatic compound 99.38
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 99.36
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 99.35
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 99.35
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 99.33
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 99.33
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 99.32
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 99.32
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 99.32
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 99.31
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 99.31
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 99.3
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 99.3
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 99.3
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 99.29
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 99.29
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 99.29
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 99.27
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 99.27
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 99.26
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 99.25
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 99.25
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 99.25
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 99.25
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 99.24
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 99.24
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 99.24
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 99.24
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 99.23
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 99.22
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 99.21
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 99.2
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 99.19
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 99.19
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 99.19
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 99.18
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 99.18
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 99.17
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 99.17
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 99.16
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 99.16
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 99.16
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 99.15
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 99.14
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 99.13
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 99.13
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 99.13
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 99.13
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 99.11
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 99.1
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 99.1
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 99.09
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 99.09
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 99.08
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 99.08
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 99.07
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 99.06
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 99.06
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 99.05
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 99.03
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 99.02
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 99.02
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 99.01
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 99.01
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 98.99
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 98.99
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 98.98
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 98.96
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 98.94
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 98.94
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 98.93
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 98.93
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 98.93
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 98.93
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 98.93
1r3d_A264 Conserved hypothetical protein VC1974; structural 98.92
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 98.9
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 98.9
3h04_A275 Uncharacterized protein; protein with unknown func 98.9
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 98.89
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 98.87
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 98.84
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 98.84
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 98.82
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 98.82
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 98.82
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 98.28
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 98.79
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 98.78
3llc_A270 Putative hydrolase; structural genomics, joint cen 98.76
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 98.75
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 98.73
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 98.73
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 98.71
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 98.68
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 98.66
1vkh_A273 Putative serine hydrolase; structural genomics, jo 98.63
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 98.6
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 98.58
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 98.58
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 98.55
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 98.54
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 98.54
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 98.54
4fle_A202 Esterase; structural genomics, PSI-biology, northe 98.51
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 98.5
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 98.49
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 98.48
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 98.47
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 98.44
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 98.43
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 98.36
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 98.35
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 98.34
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.32
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 98.28
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 98.28
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 98.28
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 98.27
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 98.25
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 98.25
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 98.25
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 98.24
3bjr_A283 Putative carboxylesterase; structural genomics, jo 98.23
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 98.21
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 98.21
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 98.21
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 98.19
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 98.19
1kez_A300 Erythronolide synthase; polyketide synthase, modul 98.17
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 98.16
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 98.15
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 98.15
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 98.15
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.13
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 98.03
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.03
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 98.02
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 98.01
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 98.0
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 97.98
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 97.9
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 97.88
3ain_A323 303AA long hypothetical esterase; carboxylesterase 97.85
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 97.83
1whs_B153 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 97.82
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 97.82
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 97.81
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 97.79
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 97.79
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 97.77
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 97.76
4f21_A246 Carboxylesterase/phospholipase family protein; str 97.71
3tej_A329 Enterobactin synthase component F; nonribosomal pe 97.65
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 97.64
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 97.62
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 97.6
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 97.59
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 97.58
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 97.55
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 97.5
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 97.5
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 97.43
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 97.43
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 97.4
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 97.4
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 97.35
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 97.35
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 97.32
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 97.29
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 97.26
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 97.25
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 97.06
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 96.98
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 96.97
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 96.93
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 96.91
3lp5_A250 Putative cell surface hydrolase; structural genom 96.86
4az3_B155 Lysosomal protective protein 20 kDa chain; hydrola 96.85
2d81_A 318 PHB depolymerase; alpha/beta hydrolase fold, circu 96.77
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 96.67
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 96.49
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 96.42
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 96.36
1gxs_B158 P-(S)-hydroxymandelonitrIle lyase chain B; inhibit 96.32
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 96.3
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 96.26
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 96.13
3d59_A383 Platelet-activating factor acetylhydrolase; secret 96.1
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 95.91
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 95.77
1ac5_A483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 95.61
3guu_A462 Lipase A; protein structure, hydrolase; HET: 1PE; 95.24
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 95.23
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 94.69
1cpy_A421 Serine carboxypeptidase; hydrolase (carboxypeptida 94.62
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 94.55
1ivy_A452 Human protective protein; carboxypeptidase, serine 94.53
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 93.68
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 90.54
2vsq_A1304 Surfactin synthetase subunit 3; ligase, peptidyl c 89.68
2px6_A316 Thioesterase domain; thioesaterse domain, orlistat 89.59
3gff_A331 IROE-like serine hydrolase; NP_718593.1, structura 80.13
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
Probab=99.65  E-value=2.4e-16  Score=103.33  Aligned_cols=66  Identities=33%  Similarity=0.723  Sum_probs=61.3

Q ss_pred             cccCCcceEEEEeCCCCCCCHHHHHHHHHhCCCCcEEEecCCCCccCCcChHHHHHHHHHHHHHhC
Q 034686           22 EGYGSVKRVYLVCEEDIGLPKHFQHWMIQNYPVNEVMEIKGGDHMAMLSEPQKLCDCLSQISLKYA   87 (87)
Q Consensus        22 ~~~~~~P~~~i~g~~D~~~p~~~~~~~~~~~~~~~~~~l~~aGH~p~l~~p~~~~~~l~~~~~~~~   87 (87)
                      +.+.++|+++|+|++|.++|.+.++.+++..++.++++++||||++|+|+|+++++.|.+|+++++
T Consensus       192 ~~~~~~P~l~i~G~~D~~~p~~~~~~~~~~~~~~~~~~i~~~gH~~~~e~P~~~~~~l~~f~~~~~  257 (257)
T 3c6x_A          192 EGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN  257 (257)
T ss_dssp             TTGGGSCEEEEECTTCSSSCHHHHHHHHHHSCCSEEEECCSCCSCHHHHSHHHHHHHHHHHHHHCC
T ss_pred             hhcCcccEEEEEeCCCcccCHHHHHHHHHHCCCCeEEEeCCCCCCcccCCHHHHHHHHHHHHHhcC
Confidence            445579999999999999999999999999999999999999999999999999999999999874



>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>1whs_B Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1wht_B* 1bcs_B* 1bcr_B* 3sc2_B* Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>4az3_B Lysosomal protective protein 20 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_B* Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>1gxs_B P-(S)-hydroxymandelonitrIle lyase chain B; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 87
d3c70a1256 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber t 2e-09
d1xkla_258 c.69.1.20 (A:) Salicylic acid-binding protein 2 (S 3e-09
d2rhwa1283 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2 0.002
d1c4xa_281 c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-di 0.002
d1uk8a_271 c.69.1.10 (A:) Meta-cleavage product hydrolase Cum 0.003
d1zd3a2322 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, 0.003
d1bn7a_291 c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus 0.004
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Length = 256 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Hydroxynitrile lyase-like
domain: Hydroxynitrile lyase
species: Rubber tree (Hevea brasiliensis) [TaxId: 3981]
 Score = 49.9 bits (117), Expect = 2e-09
 Identities = 31/86 (36%), Positives = 56/86 (65%)

Query: 1   MLLRPGSMFIDNLSKASKFSDEGYGSVKRVYLVCEEDIGLPKHFQHWMIQNYPVNEVMEI 60
           ML R GS+F + L+K   F+ EGYGS+K++Y+  ++D      FQ W I+NY  ++V ++
Sbjct: 170 MLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKV 229

Query: 61  KGGDHMAMLSEPQKLCDCLSQISLKY 86
           +GGDH   L++ +++ + L +++  Y
Sbjct: 230 EGGDHKLQLTKTKEIAEILQEVADTY 255


>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 258 Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Length = 283 Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Length = 281 Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Length = 271 Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Length = 291 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query87
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 99.64
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 99.6
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 99.44
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.42
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 99.41
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.4
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 99.39
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 99.38
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 99.37
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 99.33
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 99.33
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 99.3
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 99.28
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 99.28
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 99.27
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 99.26
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 99.26
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 99.2
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 99.18
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 99.15
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 99.13
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 99.11
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 99.07
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 99.07
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 99.0
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 98.76
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 98.71
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 98.67
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 98.6
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 98.54
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 98.52
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 98.45
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 98.26
d2vata1376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 98.15
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 98.09
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 98.07
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 97.85
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 97.85
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 97.84
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 97.79
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 97.78
d2pl5a1362 Homoserine O-acetyltransferase {Leptospira interro 97.71
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 97.66
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 97.66
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 97.62
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 97.62
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 97.55
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 97.55
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 97.53
d2b61a1357 Homoserine O-acetyltransferase {Haemophilus influe 97.44
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 97.43
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 97.36
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 97.35
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 97.13
g1wht.1409 Serine carboxypeptidase II {Wheat (Triticum vulgar 97.0
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 97.0
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 96.6
g1gxs.1425 Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T 96.58
d1ivya_452 Human 'protective protein', HPP {Human (Homo sapie 96.57
d1wpxa1421 Serine carboxypeptidase II {Baker's yeast (Sacchar 96.33
d1ac5a_483 Serine carboxypeptidase II {Baker's yeast (Sacchar 96.22
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 96.05
d1lzla_317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 95.69
d1u4na_308 Carboxylesterase {Alicyclobacillus acidocaldarius 95.37
d2d81a1 318 Polyhydroxybutyrate depolymerase {Penicillium funi 95.12
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 94.47
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 94.07
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 92.71
d2gzsa1265 Enterobactin and salmochelin hydrolase IroE {Esche 89.02
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 87.26
d1lnsa3405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 84.9
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 81.18
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Hydroxynitrile lyase-like
domain: Hydroxynitrile lyase
species: Rubber tree (Hevea brasiliensis) [TaxId: 3981]
Probab=99.64  E-value=2e-16  Score=98.60  Aligned_cols=68  Identities=34%  Similarity=0.748  Sum_probs=62.4

Q ss_pred             ccccccCCcceEEEEeCCCCCCCHHHHHHHHHhCCCCcEEEecCCCCccCCcChHHHHHHHHHHHHHh
Q 034686           19 FSDEGYGSVKRVYLVCEEDIGLPKHFQHWMIQNYPVNEVMEIKGGDHMAMLSEPQKLCDCLSQISLKY   86 (87)
Q Consensus        19 ~~~~~~~~~P~~~i~g~~D~~~p~~~~~~~~~~~~~~~~~~l~~aGH~p~l~~p~~~~~~l~~~~~~~   86 (87)
                      .....+.++|+++|+|++|..+|++.++.+.+..|+.++++++|+||++|+|+|+++++.|.++++.|
T Consensus       188 ~~~~~~~~~P~l~i~G~~D~~~~~~~~~~~~~~~p~~~~~~i~~agH~~~~e~P~~~~~~l~~~~~~~  255 (256)
T d3c70a1         188 FTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTY  255 (256)
T ss_dssp             CCTTTGGGSCEEEEECTTCSSSCHHHHHHHHHHSCCSEEEECCSCCSCHHHHSHHHHHHHHHHHHHHC
T ss_pred             hhhhhccccceeEEeecCCCCCCHHHHHHHHHHCCCCEEEEECCCCCchHHhCHHHHHHHHHHHHHhc
Confidence            34445556999999999999999999999999999999999999999999999999999999999987



>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure