Citrus Sinensis ID: 034697


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80------
MASNTMTSSRSSGSSWTVKQNKQFETALAFYDKDTPDRWDNVAKAVSGKTVEDVKKHYELLVKDINDIEAGRYPHPNYRSTTGTGN
cccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccc
cccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccccccccccc
masntmtssrssgsswtvKQNKQFETALAfydkdtpdrwdnvakavsgktvEDVKKHYELLVKDIndieagryphpnyrsttgtgn
masntmtssrssgsswtvkqNKQFETALAfydkdtpdrWDNVAkavsgktvedvkKHYELLVKdindieagryphpnyrsttgtgn
MAsntmtssrssgsswtVKQNKQFETALAFYDKDTPDRWDNVAKAVSGKTVEDVKKHYELLVKDINDIEAGRYPHPNYRSTTGTGN
***********************FETALAFYDKDTPDRWDNVAKAVSGKTVEDVKKHYELLVKDINDIEAG***************
********************NKQFETALAFYDKDTPDRWDNVAKAVSGKTVEDVKKHYELLVKDINDIEAGRYPH***********
******************KQNKQFETALAFYDKDTPDRWDNVAKAVSGKTVEDVKKHYELLVKDINDIEAGRYPHPNY********
***************WTVKQNKQFETALAFYDKDTPDRWDNVAKAVSGKTVEDVKKHYELLVKDINDIEAGRYPHPNYR*******
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASNTMTSSRSSGSSWTVKQNKQFETALAFYDKDTPDRWDNVAKAVSGKTVEDVKKHYELLVKDINDIEAGRYPHPNYRSTTGTGN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query86 2.2.26 [Sep-21-2011]
Q58FS393 Transcription factor RADI N/A no 0.906 0.838 0.653 2e-25
Q6NNN081 Protein RADIALIS-like 3 O yes no 0.755 0.802 0.723 6e-25
Q1A17397 Protein RADIALIS-like 6 O no no 0.883 0.783 0.675 2e-24
F4JVB8100 Protein RADIALIS-like 1 O no no 0.825 0.71 0.676 1e-23
Q9SIJ5101 Protein RADIALIS-like 2 O no no 0.825 0.702 0.647 5e-22
Q1G3C477 Protein RADIALIS-like 4 O no no 0.732 0.818 0.650 2e-21
Q8GW75100 Protein RADIALIS-like 5 O no no 0.732 0.63 0.603 4e-17
Q8S9H7 307 Transcription factor DIVA N/A no 0.883 0.247 0.467 6e-14
Q4R8H2621 DnaJ homolog subfamily C N/A no 0.825 0.114 0.355 3e-06
Q99543621 DnaJ homolog subfamily C no no 0.825 0.114 0.355 3e-06
>sp|Q58FS3|RAD_ANTMA Transcription factor RADIALIS OS=Antirrhinum majus GN=RAD PE=1 SV=1 Back     alignment and function desciption
 Score =  114 bits (285), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 62/78 (79%)

Query: 6  MTSSRSSGSSWTVKQNKQFETALAFYDKDTPDRWDNVAKAVSGKTVEDVKKHYELLVKDI 65
          M S+R SG  W+ K+NK FE ALA YDKDTPDRW NVA+AV G+T E+VKKHYE+LV+DI
Sbjct: 1  MASTRGSGRPWSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDI 60

Query: 66 NDIEAGRYPHPNYRSTTG 83
            IE+G+ P PNYR+T G
Sbjct: 61 KYIESGKVPFPNYRTTGG 78




Involved in the dorsovental asymmetry of flowers. Promotes dorsal identity.
Antirrhinum majus (taxid: 4151)
>sp|Q6NNN0|RADL3_ARATH Protein RADIALIS-like 3 OS=Arabidopsis thaliana GN=RL3 PE=2 SV=1 Back     alignment and function description
>sp|Q1A173|RADL6_ARATH Protein RADIALIS-like 6 OS=Arabidopsis thaliana GN=RL6 PE=2 SV=1 Back     alignment and function description
>sp|F4JVB8|RADL1_ARATH Protein RADIALIS-like 1 OS=Arabidopsis thaliana GN=RL1 PE=2 SV=1 Back     alignment and function description
>sp|Q9SIJ5|RADL2_ARATH Protein RADIALIS-like 2 OS=Arabidopsis thaliana GN=RL2 PE=2 SV=1 Back     alignment and function description
>sp|Q1G3C4|RADL4_ARATH Protein RADIALIS-like 4 OS=Arabidopsis thaliana GN=RL4 PE=2 SV=1 Back     alignment and function description
>sp|Q8GW75|RADL5_ARATH Protein RADIALIS-like 5 OS=Arabidopsis thaliana GN=RL5 PE=3 SV=1 Back     alignment and function description
>sp|Q8S9H7|DIV_ANTMA Transcription factor DIVARICATA OS=Antirrhinum majus GN=DIVARICATA PE=2 SV=1 Back     alignment and function description
>sp|Q4R8H2|DNJC2_MACFA DnaJ homolog subfamily C member 2 OS=Macaca fascicularis GN=DNAJC2 PE=2 SV=1 Back     alignment and function description
>sp|Q99543|DNJC2_HUMAN DnaJ homolog subfamily C member 2 OS=Homo sapiens GN=DNAJC2 PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query86
22543073479 PREDICTED: dnaJ homolog subfamily C memb 0.918 1.0 0.708 2e-27
22413382285 predicted protein [Populus trichocarpa] 0.941 0.952 0.679 4e-27
29773514374 unnamed protein product [Vitis vinifera] 0.860 1.0 0.702 7e-25
7532041493 RecName: Full=Transcription factor RADIA 0.906 0.838 0.653 9e-24
22409701878 predicted protein [Populus trichocarpa] 0.906 1.0 0.627 1e-23
35653879392 PREDICTED: dnaJ homolog subfamily C memb 1.0 0.934 0.581 2e-23
29780229481 At4g36570 [Arabidopsis lyrata subsp. lyr 0.755 0.802 0.723 3e-23
110931770100 MYB transcription factor MYB164 [Glycine 0.895 0.77 0.636 3e-23
15222161126 RAD-like 6 protein [Arabidopsis thaliana 0.883 0.603 0.675 4e-23
35655388398 PREDICTED: dnaJ homolog subfamily C memb 0.872 0.765 0.64 4e-23
>gi|225430734|ref|XP_002266235.1| PREDICTED: dnaJ homolog subfamily C member 1-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 56/79 (70%), Positives = 68/79 (86%)

Query: 1  MASNTMTSSRSSGSSWTVKQNKQFETALAFYDKDTPDRWDNVAKAVSGKTVEDVKKHYEL 60
          MASN+MTSSR+SGSSWT KQNK FE ALA YDKDTPDRW N+AKAV GK+ E+VK+HYE+
Sbjct: 1  MASNSMTSSRTSGSSWTPKQNKLFEKALAKYDKDTPDRWQNIAKAVGGKSAEEVKRHYEI 60

Query: 61 LVKDINDIEAGRYPHPNYR 79
          L++D+  IE+G+ P PNYR
Sbjct: 61 LIEDVKHIESGKVPFPNYR 79




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224133822|ref|XP_002327689.1| predicted protein [Populus trichocarpa] gi|222836774|gb|EEE75167.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297735143|emb|CBI17505.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|75320414|sp|Q58FS3.1|RAD_ANTMA RecName: Full=Transcription factor RADIALIS gi|118137433|pdb|2CJJ|A Chain A, Crystal Structure Of The Myb Domain Of The Rad Transcription Factor From Antirrhinum Majus gi|61652985|gb|AAX48042.1| RADIALIS [Antirrhinum majus] Back     alignment and taxonomy information
>gi|224097018|ref|XP_002310812.1| predicted protein [Populus trichocarpa] gi|222853715|gb|EEE91262.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356538793|ref|XP_003537885.1| PREDICTED: dnaJ homolog subfamily C member 2-like [Glycine max] Back     alignment and taxonomy information
>gi|297802294|ref|XP_002869031.1| At4g36570 [Arabidopsis lyrata subsp. lyrata] gi|75324337|sp|Q6NNN0.1|RADL3_ARATH RecName: Full=Protein RADIALIS-like 3; Short=AtRL3; Short=Protein RAD-like 3 gi|38566494|gb|AAR24137.1| At4g36570 [Arabidopsis thaliana] gi|40823588|gb|AAR92291.1| At4g36570 [Arabidopsis thaliana] gi|297314867|gb|EFH45290.1| At4g36570 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|110931770|gb|ABH02884.1| MYB transcription factor MYB164 [Glycine max] Back     alignment and taxonomy information
>gi|15222161|ref|NP_177661.1| RAD-like 6 protein [Arabidopsis thaliana] gi|10092271|gb|AAG12684.1|AC025814_8 myb-related protein; 20671-21051 [Arabidopsis thaliana] gi|41618978|gb|AAS09995.1| MYB transcription factor [Arabidopsis thaliana] gi|109946537|gb|ABG48447.1| At1g75250 [Arabidopsis thaliana] gi|332197572|gb|AEE35693.1| RAD-like 6 protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356553883|ref|XP_003545280.1| PREDICTED: dnaJ homolog subfamily C member 2-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query86
TAIR|locus:211526081 RL3 "RAD-like 3" [Arabidopsis 0.720 0.765 0.725 4.8e-23
TAIR|locus:401071363177 RL4 "RAD-like 4" [Arabidopsis 0.732 0.818 0.650 4.9e-21
TAIR|locus:2136283100 RL1 "RAD-like 1" [Arabidopsis 0.790 0.68 0.676 4.9e-21
UNIPROTKB|Q58FS393 RAD "Transcription factor RADI 0.755 0.698 0.692 6.3e-21
TAIR|locus:2049374101 MEE3 "MATERNAL EFFECT EMBRYO A 0.802 0.683 0.637 2.1e-20
TAIR|locus:202518297 RL6 "RAD-like 6" [Arabidopsis 0.709 0.628 0.704 3.5e-20
TAIR|locus:2016417100 RL5 "RAD-like 5" [Arabidopsis 0.779 0.67 0.588 2.5e-17
TAIR|locus:2042872 298 AT2G38090 [Arabidopsis thalian 0.767 0.221 0.590 4.7e-16
TAIR|locus:2166459 277 AT5G05790 [Arabidopsis thalian 0.779 0.241 0.537 1.8e-14
TAIR|locus:2074723 263 AT3G11280 [Arabidopsis thalian 0.697 0.228 0.566 1.6e-13
TAIR|locus:2115260 RL3 "RAD-like 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 266 (98.7 bits), Expect = 4.8e-23, P = 4.8e-23
 Identities = 45/62 (72%), Positives = 56/62 (90%)

Query:    19 KQNKQFETALAFYDKDTPDRWDNVAKAVSGKTVEDVKKHYELLVKDINDIEAGRYPHPNY 78
             K+NK FE ALA YD+DTPDRW NVA+AV GK+ E+V++HYELL++D+NDIE+GRYPHPNY
Sbjct:    15 KENKLFERALATYDQDTPDRWHNVARAVGGKSAEEVRRHYELLIRDVNDIESGRYPHPNY 74

Query:    79 RS 80
             RS
Sbjct:    75 RS 76




GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
TAIR|locus:4010713631 RL4 "RAD-like 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2136283 RL1 "RAD-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q58FS3 RAD "Transcription factor RADIALIS" [Antirrhinum majus (taxid:4151)] Back     alignment and assigned GO terms
TAIR|locus:2049374 MEE3 "MATERNAL EFFECT EMBRYO ARREST 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025182 RL6 "RAD-like 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2016417 RL5 "RAD-like 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042872 AT2G38090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166459 AT5G05790 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074723 AT3G11280 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6NNN0RADL3_ARATHNo assigned EC number0.72300.75580.8024yesno
Q58FS3RAD_ANTMANo assigned EC number0.65380.90690.8387N/Ano

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.57.329.1
hypothetical protein (74 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query86
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 2e-05
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 3e-05
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 0.004
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
 Score = 37.6 bits (88), Expect = 2e-05
 Identities = 12/51 (23%), Positives = 26/51 (50%), Gaps = 3/51 (5%)

Query: 13 GSSWTVKQNKQFETALAFYDKDTPDRWDNVAKAVSGKTVEDVKKHYELLVK 63
             WT ++++     +  Y K+    W+ +AK + G+T E  ++ +  L+K
Sbjct: 1  KGEWTEEEDELLIELVKKYGKN---NWEKIAKELPGRTAEQCRERWRNLLK 48


Length = 49

>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 86
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.62
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.43
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.38
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.26
PLN03212 249 Transcription repressor MYB5; Provisional 99.12
PLN03212 249 Transcription repressor MYB5; Provisional 99.11
KOG0048 238 consensus Transcription factor, Myb superfamily [T 99.0
PLN03091 459 hypothetical protein; Provisional 98.99
PLN03091 459 hypothetical protein; Provisional 98.98
KOG0048 238 consensus Transcription factor, Myb superfamily [T 98.92
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 98.82
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 98.63
COG5259 531 RSC8 RSC chromatin remodeling complex subunit RSC8 98.55
KOG0049 939 consensus Transcription factor, Myb superfamily [T 98.42
KOG1279 506 consensus Chromatin remodeling factor subunit and 98.34
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 98.14
KOG0724 335 consensus Zuotin and related molecular chaperones 98.09
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 97.97
KOG4167 907 consensus Predicted DNA-binding protein, contains 97.91
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 97.6
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 97.54
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 97.41
COG5147 512 REB1 Myb superfamily proteins, including transcrip 97.3
KOG0049 939 consensus Transcription factor, Myb superfamily [T 97.24
KOG0051 607 consensus RNA polymerase I termination factor, Myb 97.19
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 97.18
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 96.94
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 96.91
KOG0051607 consensus RNA polymerase I termination factor, Myb 96.53
KOG4282 345 consensus Transcription factor GT-2 and related pr 96.4
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 95.9
KOG4468 782 consensus Polycomb-group transcriptional regulator 95.83
COG5147 512 REB1 Myb superfamily proteins, including transcrip 95.81
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 95.77
PRK13923170 putative spore coat protein regulator protein YlbO 95.53
KOG1194 534 consensus Predicted DNA-binding protein, contains 95.32
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 95.25
smart0059589 MADF subfamily of SANT domain. 95.12
KOG4329445 consensus DNA-binding protein [General function pr 94.78
KOG3841 455 consensus TEF-1 and related transcription factor, 94.43
PF11035 344 SnAPC_2_like: Small nuclear RNA activating complex 94.35
PF1340442 HTH_AsnC-type: AsnC-type helix-turn-helix domain; 93.57
PF1054585 MADF_DNA_bdg: Alcohol dehydrogenase transcription 93.12
KOG2656 445 consensus DNA methyltransferase 1-associated prote 91.89
smart0042668 TEA TEA domain. 91.32
PF0450498 DUF573: Protein of unknown function, DUF573; Inter 91.18
PF07750162 GcrA: GcrA cell cycle regulator; InterPro: IPR0116 90.05
PF0454550 Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 89.93
PRK11179153 DNA-binding transcriptional regulator AsnC; Provis 89.48
PLN031421033 Probable chromatin-remodeling complex ATPase chain 88.57
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 87.47
PRK11169164 leucine-responsive transcriptional regulator; Prov 87.42
KOG3554 693 consensus Histone deacetylase complex, MTA1 compon 87.35
PF13325 199 MCRS_N: N-terminal region of micro-spherule protei 86.01
PF01285 431 TEA: TEA/ATTS domain family; InterPro: IPR000818 T 84.37
PF05263130 DUF722: Protein of unknown function (DUF722); Inte 83.76
PF0004657 Homeobox: Homeobox domain not present here.; Inter 83.33
KOG1194534 consensus Predicted DNA-binding protein, contains 81.77
smart00344108 HTH_ASNC helix_turn_helix ASNC type. AsnC: an auto 80.85
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
Probab=99.62  E-value=1.1e-15  Score=87.12  Aligned_cols=45  Identities=29%  Similarity=0.686  Sum_probs=40.6

Q ss_pred             CCCCHHHHHHHHHHHHhcCCCCCchHHHHHHHcC-CCCHHHHHHHHHHH
Q 034697           14 SSWTVKQNKQFETALAFYDKDTPDRWDNVAKAVS-GKTVEDVKKHYELL   61 (86)
Q Consensus        14 ~~WT~eEdk~Le~al~~~~~~~~~rW~~IA~~vp-gRT~~qc~~ry~~L   61 (86)
                      ..||.+|+.+|.++|.+|+.+   +|..||..|| |||..||+.||..+
T Consensus         2 ~~Wt~eE~~~l~~~v~~~g~~---~W~~Ia~~~~~~Rt~~qc~~~~~~~   47 (48)
T PF00249_consen    2 GPWTEEEDEKLLEAVKKYGKD---NWKKIAKRMPGGRTAKQCRSRYQNL   47 (48)
T ss_dssp             -SS-HHHHHHHHHHHHHSTTT---HHHHHHHHHSSSSTHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHhCCc---HHHHHHHHcCCCCCHHHHHHHHHhh
Confidence            589999999999999999854   7999999999 99999999999876



These belong to the SANT domain family that specifically recognise the sequence YAAC(G/T)G [, ]. In myb, one of the most conserved regions consisting of three tandem repeats has been shown to be involved in DNA-binding [].; PDB: 1X41_A 2XAF_B 2XAG_B 2XAH_B 2UXN_B 2Y48_B 2XAQ_B 2X0L_B 2IW5_B 2XAJ_B ....

>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>KOG4468 consensus Polycomb-group transcriptional regulator [Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>smart00595 MADF subfamily of SANT domain Back     alignment and domain information
>KOG4329 consensus DNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG3841 consensus TEF-1 and related transcription factor, TEAD family [Transcription] Back     alignment and domain information
>PF11035 SnAPC_2_like: Small nuclear RNA activating complex subunit 2-like; InterPro: IPR021281 This family of proteins is SnAPC subunit 2-like Back     alignment and domain information
>PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B Back     alignment and domain information
>PF10545 MADF_DNA_bdg: Alcohol dehydrogenase transcription factor Myb/SANT-like; InterPro: IPR006578 The MADF (myb/SANT-like domain in Adf-1) domain is an approximately 80-amino-acid module that directs sequence specific DNA binding to a site consisting of multiple tri-nucleotide repeats Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>smart00426 TEA TEA domain Back     alignment and domain information
>PF04504 DUF573: Protein of unknown function, DUF573; InterPro: IPR007592 This is a family of uncharacterised proteins Back     alignment and domain information
>PF07750 GcrA: GcrA cell cycle regulator; InterPro: IPR011681 GcrA, together with CtrA (see IPR001789 from INTERPRO and IPR001867 from INTERPRO), form a master cell cycle regulator Back     alignment and domain information
>PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK11179 DNA-binding transcriptional regulator AsnC; Provisional Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>PRK11169 leucine-responsive transcriptional regulator; Provisional Back     alignment and domain information
>KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>PF01285 TEA: TEA/ATTS domain family; InterPro: IPR000818 Transcriptional enhancer activators are nuclear proteins that contain a TEA/ATTSdomain, a DNA-binding region of 66-68 amino acids Back     alignment and domain information
>PF05263 DUF722: Protein of unknown function (DUF722); InterPro: IPR007927 This entry is represented by Bacteriophage bIL285, Orf38 Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>smart00344 HTH_ASNC helix_turn_helix ASNC type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query86
2cjj_A93 Crystal Structure Of The Myb Domain Of The Rad Tran 7e-22
4eef_G74 Crystal Structure Of The Designed Inhibitor Protein 3e-09
2m2e_A73 Solution Nmr Structure Of The Sant Domain Of Human 4e-05
2cqr_A73 Solution Structure Of Rsgi Ruh-043, A Myb Dna-Bindi 3e-04
>pdb|2CJJ|A Chain A, Crystal Structure Of The Myb Domain Of The Rad Transcription Factor From Antirrhinum Majus Length = 93 Back     alignment and structure

Iteration: 1

Score = 98.6 bits (244), Expect = 7e-22, Method: Compositional matrix adjust. Identities = 45/66 (68%), Positives = 54/66 (81%) Query: 18 VKQNKQFETALAFYDKDTPDRWDNVAKAVSGKTVEDVKKHYELLVKDINDIEAGRYPHPN 77 K+NK FE ALA YDKDTPDRW NVA+AV G+T E+VKKHYE+LV+DI IE+G+ P PN Sbjct: 13 AKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYIESGKVPFPN 72 Query: 78 YRSTTG 83 YR+T G Sbjct: 73 YRTTGG 78
>pdb|4EEF|G Chain G, Crystal Structure Of The Designed Inhibitor Protein F-Hb80.4 In Complex With The 1918 Influenza Virus Hemagglutinin. Length = 74 Back     alignment and structure
>pdb|2M2E|A Chain A, Solution Nmr Structure Of The Sant Domain Of Human Dnajc2, Northeast Structural Genomics Consortium Target Hr8254a Length = 73 Back     alignment and structure
>pdb|2CQR|A Chain A, Solution Structure Of Rsgi Ruh-043, A Myb Dna-Binding Domain In Human Cdna Length = 73 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query86
2cjj_A93 Radialis; plant development, DNA-binding protein, 1e-37
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 1e-28
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 2e-23
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 4e-08
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 4e-06
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 4e-06
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 6e-06
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 1e-05
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 2e-05
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 6e-05
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 8e-05
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 4e-04
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Length = 93 Back     alignment and structure
 Score =  120 bits (302), Expect = 1e-37
 Identities = 51/81 (62%), Positives = 62/81 (76%)

Query: 6  MTSSRSSGSSWTVKQNKQFETALAFYDKDTPDRWDNVAKAVSGKTVEDVKKHYELLVKDI 65
          M S+R SG  W+ K+NK FE ALA YDKDTPDRW NVA+AV G+T E+VKKHYE+LV+DI
Sbjct: 1  MASTRGSGRPWSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDI 60

Query: 66 NDIEAGRYPHPNYRSTTGTGN 86
            IE+G+ P PNYR+T G   
Sbjct: 61 KYIESGKVPFPNYRTTGGNMK 81


>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Length = 74 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Length = 94 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Length = 235 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query86
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.96
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 99.93
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.85
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 99.84
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 99.83
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.73
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.69
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.69
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.65
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.65
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.64
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.64
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.63
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.62
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.61
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.58
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.58
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.54
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.48
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.46
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.45
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.16
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.43
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.43
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.43
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.42
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.4
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.37
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.35
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.34
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.33
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.32
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.26
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.26
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.18
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 99.17
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 99.14
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.14
2crg_A70 Metastasis associated protein MTA3; transcription 99.12
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.11
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.09
1ign_A 246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.09
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 98.97
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.72
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 98.66
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 98.62
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.54
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 97.82
1ofc_X 304 ISWI protein; nuclear protein, chromatin remodelin 98.26
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 98.05
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 97.93
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 97.79
2xag_B 482 REST corepressor 1; amine oxidase, chromatin regul 97.65
4b4c_A 211 Chromodomain-helicase-DNA-binding protein 1; chrom 97.19
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 97.03
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 96.88
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 95.99
2y9y_A 374 Imitation switch protein 1 (DEL_ATPase); transcrip 95.73
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 94.44
2xb0_X 270 Chromo domain-containing protein 1; hydrolase, DNA 92.62
2hzd_A82 Transcriptional enhancer factor TEF-1; DNA-binding 89.57
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 86.19
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 85.96
2cxy_A125 BAF250B subunit, HBAF250B; DNA-binding domain, str 85.19
1qgp_A77 Protein (double stranded RNA adenosine deaminase); 81.32
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
Probab=99.96  E-value=3.7e-29  Score=161.39  Aligned_cols=77  Identities=65%  Similarity=1.100  Sum_probs=62.0

Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHhcCCCCCchHHHHHHHcCCCCHHHHHHHHHHHHHHHhhhhcCCCCCCCCCCCC
Q 034697            6 MTSSRSSGSSWTVKQNKQFETALAFYDKDTPDRWDNVAKAVSGKTVEDVKKHYELLVKDINDIEAGRYPHPNYRSTT   82 (86)
Q Consensus         6 ~~~~~~~~~~WT~eEdk~Le~al~~~~~~~~~rW~~IA~~vpgRT~~qc~~ry~~L~~dv~~ie~g~v~~P~y~~~~   82 (86)
                      |+||.++...||.|||++|++||++|+.+.++||.+||++|||||++||++||+.|++||+.||+|.||+|.|..+|
T Consensus         1 ~~~~~~~~~~WT~eEd~~L~~al~~~~~~~~~rW~~IA~~vpGRT~~q~k~ry~~l~~dv~~iesg~vp~P~y~~~~   77 (93)
T 2cjj_A            1 MASTRGSGRPWSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYIESGKVPFPNYRTTG   77 (93)
T ss_dssp             -------CCSCCHHHHHHHHHHHHHSCTTCTTHHHHHHHHSTTCCHHHHHHHHHHHHHHHHHHHHSSCCC-------
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHcCCCCCchHHHHHHHcCCCCHHHHHHHHHHHHHHHHHhhcCCCCCCCCCCCC
Confidence            77888888999999999999999999988889999999999999999999999999999999999999999998765



>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2hzd_A Transcriptional enhancer factor TEF-1; DNA-binding, helix-turn-helix, gene regulation; NMR {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2cxy_A BAF250B subunit, HBAF250B; DNA-binding domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.60A {Homo sapiens} PDB: 2eh9_A 1ryu_A Back     alignment and structure
>1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 86
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 3e-18
d2cqqa159 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 4e-18
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 7e-09
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 3e-05
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 0.001
d2crga157 a.4.1.3 (A:8-64) Metastasis associated protein MTA 0.001
d1ofcx152 a.4.1.3 (X:799-850) SANT domain of the nucleosome 0.001
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: Radialis
species: Garden snapdragon (Antirrhinum majus) [TaxId: 4151]
 Score = 69.2 bits (169), Expect = 3e-18
 Identities = 41/62 (66%), Positives = 50/62 (80%)

Query: 13 GSSWTVKQNKQFETALAFYDKDTPDRWDNVAKAVSGKTVEDVKKHYELLVKDINDIEAGR 72
          G  W+ K+NK FE ALA YDKDTPDRW NVA+AV G+T E+VKKHYE+LV+DI  IE+G+
Sbjct: 1  GRPWSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYIESGK 60

Query: 73 YP 74
           P
Sbjct: 61 VP 62


>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 52 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query86
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.92
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.81
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.8
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.65
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.63
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.63
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.6
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.56
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.49
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.47
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.47
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.44
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.37
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.32
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 99.29
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 99.18
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 99.1
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 98.25
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 97.94
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 96.92
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 95.97
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 94.85
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 93.76
d2cg4a163 Regulatory protein AsnC {Escherichia coli [TaxId: 91.16
d2cyya160 Putative transcriptional regulator PH1519 {Archaeo 90.36
d2cfxa163 Transcriptional regulator LrpC {Bacillus subtilis 89.66
d1i1ga160 LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} 88.33
d1fs1b155 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 88.07
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 85.94
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 85.67
d1lvaa364 C-terminal fragment of elongation factor SelB {Moo 85.21
d1rp3a271 Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta 83.55
d1kkxa_102 Transcription regulator Adr6 (Swi1) {Baker's yeast 83.25
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 82.63
d1nexa170 Centromere DNA-binding protein complex Cbf3 subuni 82.6
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 82.58
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: Radialis
species: Garden snapdragon (Antirrhinum majus) [TaxId: 4151]
Probab=99.92  E-value=1.8e-25  Score=132.86  Aligned_cols=62  Identities=65%  Similarity=1.102  Sum_probs=60.0

Q ss_pred             CCCCHHHHHHHHHHHHhcCCCCCchHHHHHHHcCCCCHHHHHHHHHHHHHHHhhhhcCCCCC
Q 034697           14 SSWTVKQNKQFETALAFYDKDTPDRWDNVAKAVSGKTVEDVKKHYELLVKDINDIEAGRYPH   75 (86)
Q Consensus        14 ~~WT~eEdk~Le~al~~~~~~~~~rW~~IA~~vpgRT~~qc~~ry~~L~~dv~~ie~g~v~~   75 (86)
                      ++||.|||++|++||.+|+.+.+++|.+||++|||||++||++||+.|.+||+.||+|+|||
T Consensus         2 ~~WT~eEd~~L~~~v~~~~~~~~~~W~~Ia~~l~gRt~~qc~~r~~~L~~dik~iesg~vpf   63 (63)
T d2cjja1           2 RPWSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYIESGKVPF   63 (63)
T ss_dssp             CSCCHHHHHHHHHHHHHSCTTCTTHHHHHHHHSTTCCHHHHHHHHHHHHHHHHHHHHSSCCC
T ss_pred             cCCCHHHHHHHHHHHHHHCCCCchHHHHHHHHcCCCCHHHHHHHHHHHHHHhhccccCCCCC
Confidence            58999999999999999999888999999999999999999999999999999999999986



>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fs1b1 a.157.1.1 (B:86-140) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lvaa3 a.4.5.35 (A:511-574) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1kkxa_ a.4.3.1 (A:) Transcription regulator Adr6 (Swi1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nexa1 a.157.1.1 (A:116-185) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure