Citrus Sinensis ID: 034762


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80----
MNAPDRYERFVVPEGTKKVSYERDTKIINAASFTIEREEHTIGNILRMQLHRDENVLFAGYKLPHPLQYKIIVRAELAKHSRVY
cccccccccEEcccccEEEEEEcccccccEEEEEEcccccHHHHHHHHHHHccccEEEEEcccccccccEEEEEEEEccccccc
cccccccEEEEEccccEEEEEEEcccccccEEEEEEccccHHHHHHHHHHHccccEEEEEEEcccccccEEEEEEEEccccccc
mnapdryerfvvpegtkkvsyERDTKIINAASFTIEREEHTIGNILRMQLhrdenvlfagyklphplqYKIIVRAELAKHSRVY
mnapdryerfvvpegtkkvsyerdtkiinaasftiereeHTIGNILRMQLHRDENVLFAGYKLPHPLQYKIIVRAELAKHSRVY
MNAPDRYERFVVPEGTKKVSYERDTKIINAASFTIEREEHTIGNILRMQLHRDENVLFAGYKLPHPLQYKIIVRAELAKHSRVY
*********FVV****KKVSYERDTKIINAASFTIEREEHTIGNILRMQLHRDENVLFAGYKLPHPLQYKIIVRAEL*******
**APDRYERFVVPEGTKKVSYERDTKIINAASFTIEREEHTIGNILRMQLHRDENVLFAGYKLPHPLQYKIIVRAELA******
MNAPDRYERFVVPEGTKKVSYERDTKIINAASFTIEREEHTIGNILRMQLHRDENVLFAGYKLPHPLQYKIIVRAELAKHSRVY
****DRYERFVVPEGTKKVSYERDTKIINAASFTIEREEHTIGNILRMQLHRDENVLFAGYKLPHPLQYKIIVRAELAKHS***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNAPDRYERFVVPEGTKKVSYERDTKIINAASFTIEREEHTIGNILRMQLHRDENVLFAGYKLPHPLQYKIIVRAELAKHSRVY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query84 2.2.26 [Sep-21-2011]
Q38859116 DNA-directed RNA polymera yes no 0.964 0.698 0.839 6e-36
Q86JJ5120 DNA-directed RNA polymera yes no 0.964 0.675 0.543 3e-23
P52435117 DNA-directed RNA polymera yes no 0.904 0.649 0.552 6e-21
Q32P79117 DNA-directed RNA polymera yes no 0.904 0.649 0.552 6e-21
O08740117 DNA-directed RNA polymera yes no 0.904 0.649 0.552 7e-21
Q9VJE4117 DNA-directed RNA polymera yes no 0.880 0.632 0.581 8e-21
Q7PVQ9117 DNA-directed RNA polymera yes no 0.880 0.632 0.567 7e-20
Q9GZM3115 DNA-directed RNA polymera yes no 0.892 0.652 0.539 2e-19
Q9H1A7115 DNA-directed RNA polymera yes no 0.892 0.652 0.526 5e-19
Q60SM4122 Probable DNA-directed RNA N/A no 0.892 0.614 0.539 2e-18
>sp|Q38859|RPB11_ARATH DNA-directed RNA polymerase II subunit RPB11 OS=Arabidopsis thaliana GN=RPB13.6 PE=2 SV=1 Back     alignment and function desciption
 Score =  149 bits (375), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 68/81 (83%), Positives = 75/81 (92%)

Query: 1  MNAPDRYERFVVPEGTKKVSYERDTKIINAASFTIEREEHTIGNILRMQLHRDENVLFAG 60
          MNAP+RYERFVVPEGTKKVSY+RDTKIINAASFT+ERE+HTIGNI+RMQLHRDENVLFAG
Sbjct: 1  MNAPERYERFVVPEGTKKVSYDRDTKIINAASFTVEREDHTIGNIVRMQLHRDENVLFAG 60

Query: 61 YKLPHPLQYKIIVRAELAKHS 81
          Y+LPHPL+YKIIVR      S
Sbjct: 61 YQLPHPLKYKIIVRIHTTSQS 81




DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB11 is part of the core element with the central large cleft.
Arabidopsis thaliana (taxid: 3702)
>sp|Q86JJ5|RPB11_DICDI DNA-directed RNA polymerase II subunit rpb11 OS=Dictyostelium discoideum GN=polr2j PE=3 SV=1 Back     alignment and function description
>sp|P52435|RPB11_HUMAN DNA-directed RNA polymerase II subunit RPB11-a OS=Homo sapiens GN=POLR2J PE=1 SV=1 Back     alignment and function description
>sp|Q32P79|RPB11_BOVIN DNA-directed RNA polymerase II subunit RPB11 OS=Bos taurus GN=POLR2J PE=3 SV=1 Back     alignment and function description
>sp|O08740|RPB11_MOUSE DNA-directed RNA polymerase II subunit RPB11 OS=Mus musculus GN=Polr2j PE=2 SV=1 Back     alignment and function description
>sp|Q9VJE4|RPB11_DROME DNA-directed RNA polymerase II subunit RPB11 OS=Drosophila melanogaster GN=Rpb11 PE=3 SV=1 Back     alignment and function description
>sp|Q7PVQ9|RPB11_ANOGA DNA-directed RNA polymerase II subunit RPB11 OS=Anopheles gambiae GN=Rpb11 PE=2 SV=2 Back     alignment and function description
>sp|Q9GZM3|RPB1B_HUMAN DNA-directed RNA polymerase II subunit RPB11-b1 OS=Homo sapiens GN=POLR2J2 PE=1 SV=1 Back     alignment and function description
>sp|Q9H1A7|RPB1C_HUMAN DNA-directed RNA polymerase II subunit RPB11-b2 OS=Homo sapiens GN=POLR2J3 PE=2 SV=1 Back     alignment and function description
>sp|Q60SM4|RPB11_CAEBR Probable DNA-directed RNA polymerase II subunit RPB11 OS=Caenorhabditis briggsae GN=rpb-11 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query84
449464004116 PREDICTED: DNA-directed RNA polymerase I 0.964 0.698 0.925 7e-37
255553542156 DNA-directed RNA polymerase II 13.6 kD p 0.964 0.519 0.888 3e-36
388516987116 unknown [Lotus japonicus] 0.964 0.698 0.913 3e-36
225430537116 PREDICTED: DNA-directed RNA polymerase I 0.964 0.698 0.888 3e-36
358248360116 uncharacterized protein LOC100784219 [Gl 0.964 0.698 0.913 4e-36
356531671116 PREDICTED: DNA-directed RNA polymerase I 0.964 0.698 0.913 4e-36
115470799120 Os07g0172500 [Oryza sativa Japonica Grou 0.964 0.675 0.876 2e-35
224103945116 predicted protein [Populus trichocarpa] 0.964 0.698 0.876 2e-35
413937790112 hypothetical protein ZEAMMB73_270623 [Ze 0.964 0.723 0.864 3e-35
226504996120 uncharacterized protein LOC100274213 [Ze 0.964 0.675 0.864 3e-35
>gi|449464004|ref|XP_004149719.1| PREDICTED: DNA-directed RNA polymerase II subunit RPB11-like [Cucumis sativus] gi|449516703|ref|XP_004165386.1| PREDICTED: DNA-directed RNA polymerase II subunit RPB11-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  157 bits (397), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 75/81 (92%), Positives = 75/81 (92%)

Query: 1  MNAPDRYERFVVPEGTKKVSYERDTKIINAASFTIEREEHTIGNILRMQLHRDENVLFAG 60
          MNAPDRYERFVVPEGTKKVSYERDTKIINAASFTIEREEHTIGNILRMQLHRDENVLFAG
Sbjct: 1  MNAPDRYERFVVPEGTKKVSYERDTKIINAASFTIEREEHTIGNILRMQLHRDENVLFAG 60

Query: 61 YKLPHPLQYKIIVRAELAKHS 81
          YKLPHPLQYKIIVR      S
Sbjct: 61 YKLPHPLQYKIIVRIHTTSQS 81




Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255553542|ref|XP_002517812.1| DNA-directed RNA polymerase II 13.6 kD polypeptide, putative [Ricinus communis] gi|223543084|gb|EEF44619.1| DNA-directed RNA polymerase II 13.6 kD polypeptide, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|388516987|gb|AFK46555.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|225430537|ref|XP_002285578.1| PREDICTED: DNA-directed RNA polymerase II subunit RPB11 [Vitis vinifera] gi|296082163|emb|CBI21168.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|358248360|ref|NP_001240124.1| uncharacterized protein LOC100784219 [Glycine max] gi|255626235|gb|ACU13462.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356531671|ref|XP_003534400.1| PREDICTED: DNA-directed RNA polymerase II subunit RPB11 [Glycine max] Back     alignment and taxonomy information
>gi|115470799|ref|NP_001058998.1| Os07g0172500 [Oryza sativa Japonica Group] gi|34394446|dbj|BAC83620.1| putative DNA-directed RNA polymerase II 13.6K chain [Oryza sativa Japonica Group] gi|113610534|dbj|BAF20912.1| Os07g0172500 [Oryza sativa Japonica Group] gi|215704597|dbj|BAG94225.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|224103945|ref|XP_002313254.1| predicted protein [Populus trichocarpa] gi|118484276|gb|ABK94017.1| unknown [Populus trichocarpa] gi|222849662|gb|EEE87209.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|413937790|gb|AFW72341.1| hypothetical protein ZEAMMB73_270623 [Zea mays] Back     alignment and taxonomy information
>gi|226504996|ref|NP_001142057.1| uncharacterized protein LOC100274213 [Zea mays] gi|194696560|gb|ACF82364.1| unknown [Zea mays] gi|194699868|gb|ACF84018.1| unknown [Zea mays] gi|194706942|gb|ACF87555.1| unknown [Zea mays] gi|195615212|gb|ACG29436.1| DNA-directed RNA polymerase II subunit J [Zea mays] gi|195628620|gb|ACG36140.1| DNA-directed RNA polymerase II subunit J [Zea mays] gi|195656859|gb|ACG47897.1| DNA-directed RNA polymerase II subunit J [Zea mays] gi|413937791|gb|AFW72342.1| DNA-directed RNA polymerase II subunit J isoform 1 [Zea mays] gi|413937792|gb|AFW72343.1| DNA-directed RNA polymerase II subunit J isoform 2 [Zea mays] gi|413937793|gb|AFW72344.1| DNA-directed RNA polymerase II subunit J isoform 3 [Zea mays] gi|413937794|gb|AFW72345.1| DNA-directed RNA polymerase II subunit J isoform 4 [Zea mays] gi|413937795|gb|AFW72346.1| DNA-directed RNA polymerase II subunit J isoform 5 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query84
DICTYBASE|DDB_G0277677120 rpb11 "RNA polymerase II core 0.904 0.633 0.578 3.4e-22
FB|FBgn0032634117 Rpb11 "Rpb11" [Drosophila mela 0.904 0.649 0.565 1e-20
UNIPROTKB|Q32P79117 POLR2J "DNA-directed RNA polym 0.904 0.649 0.552 2.1e-20
UNIPROTKB|E2RD80117 LOC100686835 "Uncharacterized 0.904 0.649 0.552 2.1e-20
UNIPROTKB|F1PXE5130 LOC100686835 "Uncharacterized 0.904 0.584 0.552 2.1e-20
UNIPROTKB|P52435117 POLR2J "DNA-directed RNA polym 0.904 0.649 0.552 2.1e-20
UNIPROTKB|Q9H1A6127 POLR2J1 "DNA-directed RNA poly 0.904 0.598 0.552 2.1e-20
MGI|MGI:109582117 Polr2j "polymerase (RNA) II (D 0.904 0.649 0.552 2.1e-20
RGD|1310198117 Polr2j "polymerase (RNA) II (D 0.904 0.649 0.552 2.1e-20
ZFIN|ZDB-GENE-050522-120117 polr2j "polymerase (RNA) II (D 0.904 0.649 0.526 3.5e-20
DICTYBASE|DDB_G0277677 rpb11 "RNA polymerase II core subunit" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
 Score = 258 (95.9 bits), Expect = 3.4e-22, P = 3.4e-22
 Identities = 44/76 (57%), Positives = 64/76 (84%)

Query:     1 MNAPDRYERFVVPEGTKKVSYERDTKIINAASFTIEREEHTIGNILRMQLHRDENVLFAG 60
             MNAPDR+E FV+P+G KKV+  RDTKI NA+ FTI +E+HTIGN++RMQL  D++++FAG
Sbjct:     1 MNAPDRFELFVLPDGAKKVTMVRDTKIPNASMFTILKEDHTIGNLIRMQLIADQDIIFAG 60

Query:    61 YKLPHPLQYKIIVRAE 76
             Y++PHPL++ + +R +
Sbjct:    61 YRMPHPLEHNVNIRIQ 76




GO:0046983 "protein dimerization activity" evidence=IEA
GO:0006351 "transcription, DNA-dependent" evidence=IEA
GO:0003899 "DNA-directed RNA polymerase activity" evidence=IEA;ISS
GO:0003677 "DNA binding" evidence=IEA
GO:0006366 "transcription from RNA polymerase II promoter" evidence=ISS
GO:0005665 "DNA-directed RNA polymerase II, core complex" evidence=ISS
GO:0005634 "nucleus" evidence=IEA
GO:0044351 "macropinocytosis" evidence=RCA
FB|FBgn0032634 Rpb11 "Rpb11" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q32P79 POLR2J "DNA-directed RNA polymerase II subunit RPB11" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RD80 LOC100686835 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PXE5 LOC100686835 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P52435 POLR2J "DNA-directed RNA polymerase II subunit RPB11-a" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H1A6 POLR2J1 "DNA-directed RNA polymerase II subunit RPB11-a" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:109582 Polr2j "polymerase (RNA) II (DNA directed) polypeptide J" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1310198 Polr2j "polymerase (RNA) II (DNA directed) polypeptide J" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050522-120 polr2j "polymerase (RNA) II (DNA directed) polypeptide J" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q86JJ5RPB11_DICDINo assigned EC number0.54320.96420.675yesno
Q9GZM3RPB1B_HUMANNo assigned EC number0.53940.89280.6521yesno
P52435RPB11_HUMANNo assigned EC number0.55260.90470.6495yesno
P87123RPB11_SCHPONo assigned EC number0.52630.89280.6097yesno
Q9VJE4RPB11_DROMENo assigned EC number0.58100.88090.6324yesno
O08740RPB11_MOUSENo assigned EC number0.55260.90470.6495yesno
Q7PVQ9RPB11_ANOGANo assigned EC number0.56750.88090.6324yesno
Q32P79RPB11_BOVINNo assigned EC number0.55260.90470.6495yesno
Q9XVH6RPB11_CAEELNo assigned EC number0.50610.95230.6557yesno
Q38859RPB11_ARATHNo assigned EC number0.83950.96420.6982yesno
Q9H1A7RPB1C_HUMANNo assigned EC number0.52630.89280.6521yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.7LOW CONFIDENCE prediction!
4th Layer2.7.7.6LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query84
cd0692693 cd06926, RNAP_II_RPB11, RPB11 subunit of Eukaryoti 2e-34
pfam1365677 pfam13656, RNA_pol_L_2, RNA polymerase Rpb3/Rpb11 1e-15
COG176199 COG1761, RPB11, DNA-directed RNA polymerase, subun 2e-13
cd0702985 cd07029, RNAP_I_III_AC19, AC19 subunit of Eukaryot 6e-12
cd0702783 cd07027, RNAP_RPB11_like, RPB11 subunit of RNA pol 5e-11
PRK0114685 PRK01146, PRK01146, DNA-directed RNA polymerase su 2e-07
pfam0119388 pfam01193, RNA_pol_L, RNA polymerase Rpb3/Rpb11 di 2e-07
cd0692783 cd06927, RNAP_L, L subunit of Archaeal RNA polymer 2e-06
cd0046086 cd00460, RNAP_RPB11_RPB3, RPB11 and RPB3 subunits 0.001
>gnl|CDD|132902 cd06926, RNAP_II_RPB11, RPB11 subunit of Eukaryotic RNA polymerase II Back     alignment and domain information
 Score =  112 bits (283), Expect = 2e-34
 Identities = 40/62 (64%), Positives = 55/62 (88%)

Query: 13 PEGTKKVSYERDTKIINAASFTIEREEHTIGNILRMQLHRDENVLFAGYKLPHPLQYKII 72
          PEG KK++ ++DTK+ NAA+FTI +E+HT+GN+LRMQL +D NVLFAGYK+PHPL++KI 
Sbjct: 1  PEGEKKITEKKDTKVPNAATFTINKEDHTLGNLLRMQLLKDPNVLFAGYKVPHPLEHKIE 60

Query: 73 VR 74
          +R
Sbjct: 61 LR 62


The eukaryotic RPB11 subunit of RNA polymerase (RNAP) II is involved in the assembly of RNAP subunits. RNAP is a large multi-subunit complex responsible for the synthesis of RNA. It is the principal enzyme of the transcription process, and is a final target in many regulatory pathways that control gene expression in all living cells. At least three distinct RNAP complexes are found in eukaryotic nuclei: RNAP I, RNAP II, and RNAP III. RNAP II is responsible for the synthesis of mRNA precursor. The RPB11 subunit heterodimerizes with the RPB3 subunit, and together with RPB10 and RPB12, anchors the two largest subunits, RPB1 and RPB2, and stabilizes their association. Length = 93

>gnl|CDD|222292 pfam13656, RNA_pol_L_2, RNA polymerase Rpb3/Rpb11 dimerisation domain Back     alignment and domain information
>gnl|CDD|224675 COG1761, RPB11, DNA-directed RNA polymerase, subunit L [Transcription] Back     alignment and domain information
>gnl|CDD|132907 cd07029, RNAP_I_III_AC19, AC19 subunit of Eukaryotic RNA polymerase (RNAP) I and RNAP III Back     alignment and domain information
>gnl|CDD|132905 cd07027, RNAP_RPB11_like, RPB11 subunit of RNA polymerase Back     alignment and domain information
>gnl|CDD|234909 PRK01146, PRK01146, DNA-directed RNA polymerase subunit L; Provisional Back     alignment and domain information
>gnl|CDD|216354 pfam01193, RNA_pol_L, RNA polymerase Rpb3/Rpb11 dimerisation domain Back     alignment and domain information
>gnl|CDD|132903 cd06927, RNAP_L, L subunit of Archaeal RNA polymerase Back     alignment and domain information
>gnl|CDD|132901 cd00460, RNAP_RPB11_RPB3, RPB11 and RPB3 subunits of RNA polymerase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 84
KOG4392117 consensus RNA polymerase, subunit L [Transcription 100.0
cd0692693 RNAP_II_RPB11 RPB11 subunit of Eukaryotic RNA poly 99.97
PRK0114685 DNA-directed RNA polymerase subunit L; Provisional 99.96
cd0702985 RNAP_I_III_AC19 AC19 subunit of Eukaryotic RNA pol 99.95
cd0692783 RNAP_L L subunit of Archaeal RNA polymerase. The a 99.95
cd0702783 RNAP_RPB11_like RPB11 subunit of RNA polymerase. T 99.95
PF1365677 RNA_pol_L_2: RNA polymerase Rpb3/Rpb11 dimerisatio 99.95
COG176199 RPB11 DNA-directed RNA polymerase, subunit L [Tran 99.93
KOG3438105 consensus DNA-directed RNA polymerase, subunit L [ 99.92
cd0046086 RNAP_RPB11_RPB3 RPB11 and RPB3 subunits of RNA pol 99.85
PF0119366 RNA_pol_L: RNA polymerase Rpb3/Rpb11 dimerisation 99.32
PRK00783 263 DNA-directed RNA polymerase subunit D; Provisional 96.32
cd07030 259 RNAP_D D subunit of Archaeal RNA polymerase. The D 95.98
cd07028 212 RNAP_RPB3_like RPB3 subunit of RNA polymerase. The 95.49
PRK05182 310 DNA-directed RNA polymerase subunit alpha; Provisi 94.68
PRK14979 195 DNA-directed RNA polymerase subunit D; Provisional 94.61
cd07031 265 RNAP_II_RPB3 RPB3 subunit of Eukaryotic RNA polyme 94.44
cd06928 215 RNAP_alpha_NTD N-terminal domain of the Alpha subu 93.86
COG0202 317 RpoA DNA-directed RNA polymerase, alpha subunit/40 92.67
smart00662 224 RPOLD RNA polymerases D. DNA-directed RNA polymera 92.04
CHL00013 327 rpoA RNA polymerase alpha subunit 89.4
COG2805 353 PilT Tfp pilus assembly protein, pilus retraction 82.31
TIGR02027 297 rpoA DNA-directed RNA polymerase, alpha subunit, b 82.04
>KOG4392 consensus RNA polymerase, subunit L [Transcription] Back     alignment and domain information
Probab=100.00  E-value=2.6e-38  Score=214.66  Aligned_cols=82  Identities=54%  Similarity=0.904  Sum_probs=80.3

Q ss_pred             CCCCcccceeeeCCCceeeEEeecCCCcceeEEEEecCCcchHHHHHHHHhcCCceeEEeeeCCCCCCcceEEEEEeccC
Q 034762            1 MNAPDRYERFVVPEGTKKVSYERDTKIINAASFTIEREEHTIGNILRMQLHRDENVLFAGYKLPHPLQYKIIVRAELAKH   80 (84)
Q Consensus         1 mn~p~~~~~~~l~~ge~Ki~~~~~~~~~n~~~~~i~~EdHTLgNlLr~~Ll~~~~V~fAgY~vpHPl~~~i~l~Iqt~~~   80 (84)
                      ||||+|||+|+|++|++||++..++|.+|++.|+|.+|||||||+|+.+|++||+|.||||++|||+.+++.|||||+.+
T Consensus         1 MNaP~~fE~fll~eg~kKvtin~DtKvpNA~~fTiekEDHTLGNii~~qLl~D~~vLFagYkvpHPl~~~~~LRiqtt~d   80 (117)
T KOG4392|consen    1 MNAPPAFESFLLFEGEKKITINKDTKVPNAALFTIEKEDHTLGNIIKSQLLKDPRVLFAGYKVPHPLEHKIILRVQTTED   80 (117)
T ss_pred             CCCchhhhhheeccCCceeEEecCCCCCceEEEEEecccchHHHHHHHHHccCccceEeeecCCCcccccEEEEEecCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999987


Q ss_pred             cc
Q 034762           81 SR   82 (84)
Q Consensus        81 ~~   82 (84)
                      .+
T Consensus        81 ~~   82 (117)
T KOG4392|consen   81 CS   82 (117)
T ss_pred             CC
Confidence            54



>cd06926 RNAP_II_RPB11 RPB11 subunit of Eukaryotic RNA polymerase II Back     alignment and domain information
>PRK01146 DNA-directed RNA polymerase subunit L; Provisional Back     alignment and domain information
>cd07029 RNAP_I_III_AC19 AC19 subunit of Eukaryotic RNA polymerase (RNAP) I and RNAP III Back     alignment and domain information
>cd06927 RNAP_L L subunit of Archaeal RNA polymerase Back     alignment and domain information
>cd07027 RNAP_RPB11_like RPB11 subunit of RNA polymerase Back     alignment and domain information
>PF13656 RNA_pol_L_2: RNA polymerase Rpb3/Rpb11 dimerisation domain; PDB: 2Y0S_L 1I3Q_K 4A3D_K 2JA8_K 3GTP_K 1R9T_K 3PO2_K 4A3J_K 3HOX_K 2JA7_K Back     alignment and domain information
>COG1761 RPB11 DNA-directed RNA polymerase, subunit L [Transcription] Back     alignment and domain information
>KOG3438 consensus DNA-directed RNA polymerase, subunit L [Transcription] Back     alignment and domain information
>cd00460 RNAP_RPB11_RPB3 RPB11 and RPB3 subunits of RNA polymerase Back     alignment and domain information
>PF01193 RNA_pol_L: RNA polymerase Rpb3/Rpb11 dimerisation domain; InterPro: IPR011261 DNA-directed RNA polymerases 2 Back     alignment and domain information
>PRK00783 DNA-directed RNA polymerase subunit D; Provisional Back     alignment and domain information
>cd07030 RNAP_D D subunit of Archaeal RNA polymerase Back     alignment and domain information
>cd07028 RNAP_RPB3_like RPB3 subunit of RNA polymerase Back     alignment and domain information
>PRK05182 DNA-directed RNA polymerase subunit alpha; Provisional Back     alignment and domain information
>PRK14979 DNA-directed RNA polymerase subunit D; Provisional Back     alignment and domain information
>cd07031 RNAP_II_RPB3 RPB3 subunit of Eukaryotic RNA polymerase II Back     alignment and domain information
>cd06928 RNAP_alpha_NTD N-terminal domain of the Alpha subunit of Bacterial RNA polymerase Back     alignment and domain information
>COG0202 RpoA DNA-directed RNA polymerase, alpha subunit/40 kD subunit [Transcription] Back     alignment and domain information
>smart00662 RPOLD RNA polymerases D Back     alignment and domain information
>CHL00013 rpoA RNA polymerase alpha subunit Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02027 rpoA DNA-directed RNA polymerase, alpha subunit, bacterial and chloroplast-type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query84
3h0g_K123 Rna Polymerase Ii From Schizosaccharomyces Pombe Le 5e-17
1i3q_K120 Rna Polymerase Ii Crystal Form I At 3.1 A Resolutio 2e-15
2pa8_L92 X-Ray Crystal Structure Of The DL SUBCOMPLEX OF THE 1e-05
2waq_L92 The Complete Structure Of The Archaeal 13-Subunit D 3e-05
>pdb|3H0G|K Chain K, Rna Polymerase Ii From Schizosaccharomyces Pombe Length = 123 Back     alignment and structure

Iteration: 1

Score = 82.8 bits (203), Expect = 5e-17, Method: Compositional matrix adjust. Identities = 40/76 (52%), Positives = 53/76 (69%), Gaps = 1/76 (1%) Query: 1 MNAPDRYERFVVPEGTKKVSYERDTKIINAASFTIEREEHTIGNILRMQLHRDENVLFAG 60 MN P+RYE + G KV+YE D+K NAA T+E+E+HT+ N+L QL DE VLFAG Sbjct: 1 MNQPERYE-LIELMGLPKVTYELDSKSPNAAVVTLEKEDHTLANMLANQLLSDERVLFAG 59 Query: 61 YKLPHPLQYKIIVRAE 76 YK+PHPL + I+R + Sbjct: 60 YKVPHPLNHNFILRVQ 75
>pdb|1I3Q|K Chain K, Rna Polymerase Ii Crystal Form I At 3.1 A Resolution Length = 120 Back     alignment and structure
>pdb|2PA8|L Chain L, X-Ray Crystal Structure Of The DL SUBCOMPLEX OF THE SULFOLOBUS Solfataricus Rna Polymerase Length = 92 Back     alignment and structure
>pdb|2WAQ|L Chain L, The Complete Structure Of The Archaeal 13-Subunit Dna- Directed Rna Polymerase Length = 92 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query84
1twf_K120 B13.6, DNA-directed RNA polymerase II 13.6 kDa pol 7e-32
3h0g_K123 DNA-directed RNA polymerase II subunit RPB11; tran 7e-30
2pa8_L92 DNA-directed RNA polymerase subunit L; ferredoxin- 4e-17
1xpp_A115 TA1416, DNA-directed RNA polymerase subunit L; str 4e-16
>1twf_K B13.6, DNA-directed RNA polymerase II 13.6 kDa polypepti; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: d.74.3.2 PDB: 1i3q_K 1i6h_K 1k83_K* 1nik_K 1nt9_K 1pqv_K 1r5u_K 1r9s_K* 1r9t_K* 1sfo_K* 1twa_K* 1twc_K* 1i50_K* 1twg_K* 1twh_K* 1wcm_K 1y1v_K 1y1w_K 1y1y_K 1y77_K* ... Length = 120 Back     alignment and structure
 Score =  106 bits (266), Expect = 7e-32
 Identities = 35/74 (47%), Positives = 49/74 (66%)

Query: 1  MNAPDRYERFVVPEGTKKVSYERDTKIINAASFTIEREEHTIGNILRMQLHRDENVLFAG 60
          MNAPDR+E F++ EG  K+  + DTK  NA   T E+E+HT+GN++R +L  D  VLFA 
Sbjct: 1  MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61 YKLPHPLQYKIIVR 74
          YK+ HP   +  +R
Sbjct: 61 YKVEHPFFARFKLR 74


>3h0g_K DNA-directed RNA polymerase II subunit RPB11; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 123 Back     alignment and structure
>2pa8_L DNA-directed RNA polymerase subunit L; ferredoxin-like Fe-S binding motif, platform for RNA polymer assembly, transferase; 1.76A {Sulfolobus solfataricus} PDB: 2pmz_L 3hkz_L 2waq_L 2wb1_L 2y0s_L Length = 92 Back     alignment and structure
>1xpp_A TA1416, DNA-directed RNA polymerase subunit L; structural genomics, protein structure initiative, MCSG; 1.60A {Thermoplasma acidophilum} SCOP: d.74.3.2 Length = 115 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query84
1twf_K120 B13.6, DNA-directed RNA polymerase II 13.6 kDa pol 100.0
3h0g_K123 DNA-directed RNA polymerase II subunit RPB11; tran 100.0
1xpp_A115 TA1416, DNA-directed RNA polymerase subunit L; str 99.97
2pa8_L92 DNA-directed RNA polymerase subunit L; ferredoxin- 99.96
2pa8_D 265 DNA-directed RNA polymerase subunit D; ferredoxin- 96.41
1bdf_A 235 RNA polymerase alpha subunit; nucleotidyltransfera 95.36
1twf_C 318 B44.5, DNA-directed RNA polymerase II 45 kDa polyp 95.34
3h0g_C 297 DNA-directed RNA polymerase II subunit RPB3; trans 94.95
2a6h_A 315 DNA-directed RNA polymerase alpha chain; RNA polym 94.02
3lu0_A 329 DNA-directed RNA polymerase subunit alpha; E. coli 93.68
>1twf_K B13.6, DNA-directed RNA polymerase II 13.6 kDa polypepti; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: d.74.3.2 PDB: 1i3q_K 1i6h_K 1k83_K* 1nik_K 1nt9_K 1pqv_K 1r5u_K 1r9s_K* 1r9t_K* 1sfo_K* 1twa_K* 1twc_K* 1i50_K* 1twg_K* 1twh_K* 1wcm_K 1y1v_K 1y1w_K 1y1y_K 1y77_K* ... Back     alignment and structure
Probab=100.00  E-value=9e-43  Score=236.30  Aligned_cols=82  Identities=43%  Similarity=0.717  Sum_probs=80.4

Q ss_pred             CCCCcccceeeeCCCceeeEEeecCCCcceeEEEEecCCcchHHHHHHHHhcCCceeEEeeeCCCCCCcceEEEEEeccC
Q 034762            1 MNAPDRYERFVVPEGTKKVSYERDTKIINAASFTIEREEHTIGNILRMQLHRDENVLFAGYKLPHPLQYKIIVRAELAKH   80 (84)
Q Consensus         1 mn~p~~~~~~~l~~ge~Ki~~~~~~~~~n~~~~~i~~EdHTLgNlLr~~Ll~~~~V~fAgY~vpHPl~~~i~l~Iqt~~~   80 (84)
                      ||||||||+|+|+||++||++..+++.+|+++|+|.||||||||+||++|+++|+|+||||+|||||+++++|||||+|+
T Consensus         1 mnap~~~e~f~l~~ge~K~~~~~~~k~~n~~~f~i~~EDHTLgNlLr~~Llk~p~V~fAgY~vpHPl~~~~~lrIqT~~~   80 (120)
T 1twf_K            1 MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG   80 (120)
T ss_dssp             CCSCCSGGGTSCCTTCCSCCEEECSSSTTEEEEEEESCCHHHHHHHHHHHTTCTTEEEEEEECSCTTSCEEEEEEEECTT
T ss_pred             CCCCCccceeecCCCCceEEEEeccCCCCeEEEEEeCCCchHHHHHHHHHhhCCCeeEEeeecCCCCCCccEEEEEECCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999987


Q ss_pred             cc
Q 034762           81 SR   82 (84)
Q Consensus        81 ~~   82 (84)
                      .+
T Consensus        81 ~~   82 (120)
T 1twf_K           81 YD   82 (120)
T ss_dssp             CC
T ss_pred             CC
Confidence            54



>3h0g_K DNA-directed RNA polymerase II subunit RPB11; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>1xpp_A TA1416, DNA-directed RNA polymerase subunit L; structural genomics, protein structure initiative, MCSG; 1.60A {Thermoplasma acidophilum} SCOP: d.74.3.2 Back     alignment and structure
>2pa8_L DNA-directed RNA polymerase subunit L; ferredoxin-like Fe-S binding motif, platform for RNA polymer assembly, transferase; 1.76A {Sulfolobus solfataricus} PDB: 2pmz_L 3hkz_L 2waq_L 2wb1_L 2y0s_L Back     alignment and structure
>2pa8_D DNA-directed RNA polymerase subunit D; ferredoxin-like Fe-S binding motif, platform for RNA polymer assembly, transferase; 1.76A {Sulfolobus solfataricus} PDB: 2pmz_D 3hkz_D 2waq_D 2wb1_D 2y0s_D Back     alignment and structure
>1bdf_A RNA polymerase alpha subunit; nucleotidyltransferase, assemble; 2.50A {Escherichia coli} SCOP: d.74.3.1 d.181.1.1 Back     alignment and structure
>1twf_C B44.5, DNA-directed RNA polymerase II 45 kDa polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: d.74.3.1 d.181.1.1 PDB: 1i3q_C 1i6h_C 1k83_C* 1nik_C 1nt9_C 1pqv_C 1r5u_C 1r9s_C* 1r9t_C* 1sfo_C* 1twa_C* 1twc_C* 1i50_C* 1twg_C* 1twh_C* 1wcm_C 1y1v_C 1y1w_C 1y1y_C 1y77_C* ... Back     alignment and structure
>3h0g_C DNA-directed RNA polymerase II subunit RPB3; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>2a6h_A DNA-directed RNA polymerase alpha chain; RNA polymerase holoenzyme, streptolydigin, antibiotic, transcription regulation; HET: STD; 2.40A {Thermus thermophilus} SCOP: d.74.3.1 d.181.1.1 PDB: 1smy_A* 1zyr_A* 1iw7_A* 2a69_A* 2a6e_A 2a68_A* 2be5_A* 2cw0_A 2o5i_A 2o5j_A* 2ppb_A* 3aoh_A* 3aoi_A* 3dxj_A* 3eql_A* 1i6v_A* 1ynj_A* 1l9z_A 1l9u_A* 1ynn_A* ... Back     alignment and structure
>3lu0_A DNA-directed RNA polymerase subunit alpha; E. coli RNA polymerase, nucleotidyltransferase, transcription, transferase; 11.20A {Escherichia coli} PDB: 3iyd_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 84
d1twfk_114 d.74.3.2 (K:) RPB11 {Baker's yeast (Saccharomyces 1e-32
d1xppa_99 d.74.3.2 (A:) DNA-directed RNA polymerase subunit 3e-15
>d1twfk_ d.74.3.2 (K:) RPB11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 114 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: DCoH-like
superfamily: RBP11-like subunits of RNA polymerase
family: RBP11/RpoL
domain: RPB11
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score =  107 bits (268), Expect = 1e-32
 Identities = 35/74 (47%), Positives = 49/74 (66%)

Query: 1  MNAPDRYERFVVPEGTKKVSYERDTKIINAASFTIEREEHTIGNILRMQLHRDENVLFAG 60
          MNAPDR+E F++ EG  K+  + DTK  NA   T E+E+HT+GN++R +L  D  VLFA 
Sbjct: 1  MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61 YKLPHPLQYKIIVR 74
          YK+ HP   +  +R
Sbjct: 61 YKVEHPFFARFKLR 74


>d1xppa_ d.74.3.2 (A:) DNA-directed RNA polymerase subunit L, RpoL {Thermoplasma acidophilum [TaxId: 2303]} Length = 99 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query84
d1twfk_114 RPB11 {Baker's yeast (Saccharomyces cerevisiae) [T 100.0
d1xppa_99 DNA-directed RNA polymerase subunit L, RpoL {Therm 99.94
d1bdfa1105 RNA polymerase alpha {Escherichia coli [TaxId: 562 95.96
d1smya1106 RNA polymerase alpha {Thermus thermophilus [TaxId: 94.15
d1twfc1135 RPB3 {Baker's yeast (Saccharomyces cerevisiae) [Ta 88.94
>d1twfk_ d.74.3.2 (K:) RPB11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: DCoH-like
superfamily: RBP11-like subunits of RNA polymerase
family: RBP11/RpoL
domain: RPB11
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=100.00  E-value=8.9e-38  Score=207.51  Aligned_cols=82  Identities=43%  Similarity=0.717  Sum_probs=80.1

Q ss_pred             CCCCcccceeeeCCCceeeEEeecCCCcceeEEEEecCCcchHHHHHHHHhcCCceeEEeeeCCCCCCcceEEEEEeccC
Q 034762            1 MNAPDRYERFVVPEGTKKVSYERDTKIINAASFTIEREEHTIGNILRMQLHRDENVLFAGYKLPHPLQYKIIVRAELAKH   80 (84)
Q Consensus         1 mn~p~~~~~~~l~~ge~Ki~~~~~~~~~n~~~~~i~~EdHTLgNlLr~~Ll~~~~V~fAgY~vpHPl~~~i~l~Iqt~~~   80 (84)
                      ||||||||+|+|++|++||++..+++.+|+++|+|.+|||||||+|++.|+++|+|.||||++|||+++++.|||||+++
T Consensus         1 mn~p~~~~~~~l~~~e~ki~i~~~~~~~n~~~~~i~~EdhTlGnlL~~~L~~~~~V~fagY~~pHPl~~~i~irI~t~~~   80 (114)
T d1twfk_           1 MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG   80 (114)
T ss_dssp             CCSCCSGGGTSCCTTCCSCCEEECSSSTTEEEEEEESCCHHHHHHHHHHHTTCTTEEEEEEECSCTTSCEEEEEEEECTT
T ss_pred             CCCcchhhhcccCCCCceEEEEecCCCCceEEEEEeCCCchHHHHHHHHHhcCCCceEEEeecCCCCCCeeEEEEEeCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999987


Q ss_pred             cc
Q 034762           81 SR   82 (84)
Q Consensus        81 ~~   82 (84)
                      .+
T Consensus        81 ~~   82 (114)
T d1twfk_          81 YD   82 (114)
T ss_dssp             CC
T ss_pred             CC
Confidence            54



>d1xppa_ d.74.3.2 (A:) DNA-directed RNA polymerase subunit L, RpoL {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1bdfa1 d.74.3.1 (A:2-52,A:179-232) RNA polymerase alpha {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1smya1 d.74.3.1 (A:1-49,A:173-229) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1twfc1 d.74.3.1 (C:3-41,C:173-268) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure