Citrus Sinensis ID: 034783


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80---
MAEIFPINMKGLAGSLVIFIHHCINWTITFTFHFMMEWSKTGTFSIFWVICAAGVAFVTFLVPETKGRTLEEIQASITKLSRR
cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcccc
ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccccc
MAEIFPINMKGLAGSLVIFIHHCINWTITFTFHFMMEWSKTGTFSIFWVICAAGVAFVTFlvpetkgrtLEEIQASITKLSRR
MAEIFPINMKGLAGSLVIFIHHCINWTITFTFHFMMEWSKTGTFSIFWVICAAGVAFVTFlvpetkgrtleeiqasitklsrr
MAEIFPINMKGLAGSLVIFIHHCINWTITFTFHFMMEWSKTGTFSIFWVICAAGVAFVTFLVPETKGRTLEEIQASITKLSRR
***IFPINMKGLAGSLVIFIHHCINWTITFTFHFMMEWSKTGTFSIFWVICAAGVAFVTFLVPETKG****************
MAEIFPINMKGLAGSLVIFIHHCINWTITFTFHFMMEWSKTGTFSIFWVICAAGVAFVTFLVPETKGRTLEEIQA********
MAEIFPINMKGLAGSLVIFIHHCINWTITFTFHFMMEWSKTGTFSIFWVICAAGVAFVTFLVPETKGRTLEEIQ*********
**EIFPINMKGLAGSLVIFIHHCINWTITFTFHFMMEWSKTGTFSIFWVICAAGVAFVTFLVPETKGRTLEEIQASIT*****
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEIFPINMKGLAGSLVIFIHHCINWTITFTFHFMMEWSKTGTFSIFWVICAAGVAFVTFLVPETKGRTLEEIQASITKLSRR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query83 2.2.26 [Sep-21-2011]
Q3ECP7470 Sugar transporter ERD6-li yes no 0.927 0.163 0.597 5e-20
Q94KE0470 Sugar transporter ERD6-li no no 0.951 0.168 0.531 6e-20
Q8LBI9482 Sugar transporter ERD6-li no no 0.951 0.163 0.531 2e-19
Q0WQ63470 Sugar transporter ERD6-li no no 0.903 0.159 0.546 2e-18
O04036496 Sugar transporter ERD6 OS no no 0.903 0.151 0.56 4e-18
Q4F7G0462 Sugar transporter ERD6-li no no 0.975 0.175 0.518 6e-17
P93051463 Sugar transporter ERD6-li no no 0.903 0.161 0.506 1e-16
Q9FRL3487 Sugar transporter ERD6-li no no 0.903 0.154 0.493 3e-16
Q9LTP6488 Putative sugar transporte no no 0.951 0.161 0.468 4e-16
Q93YP9488 Sugar transporter ERD6-li no no 0.903 0.153 0.48 6e-16
>sp|Q3ECP7|ERDL5_ARATH Sugar transporter ERD6-like 5 OS=Arabidopsis thaliana GN=At1g54730 PE=2 SV=2 Back     alignment and function desciption
 Score = 96.3 bits (238), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 46/77 (59%), Positives = 57/77 (74%)

Query: 1   MAEIFPINMKGLAGSLVIFIHHCINWTITFTFHFMMEWSKTGTFSIFWVICAAGVAFVTF 60
           M+EIFPI++KG AGSLV  +    +W I+FTF+F+M W+  GTF +F  +C A V FV  
Sbjct: 389 MSEIFPIDIKGSAGSLVTVVSWVGSWIISFTFNFLMNWNPAGTFYVFATVCGATVIFVAK 448

Query: 61  LVPETKGRTLEEIQASI 77
           LVPETKGRTLEEIQ SI
Sbjct: 449 LVPETKGRTLEEIQYSI 465




Sugar transporter.
Arabidopsis thaliana (taxid: 3702)
>sp|Q94KE0|ERDL3_ARATH Sugar transporter ERD6-like 3 OS=Arabidopsis thaliana GN=SUGTL2 PE=2 SV=1 Back     alignment and function description
>sp|Q8LBI9|EDL16_ARATH Sugar transporter ERD6-like 16 OS=Arabidopsis thaliana GN=At5g18840 PE=2 SV=2 Back     alignment and function description
>sp|Q0WQ63|ERDL8_ARATH Sugar transporter ERD6-like 8 OS=Arabidopsis thaliana GN=At3g05150 PE=2 SV=1 Back     alignment and function description
>sp|O04036|ERD6_ARATH Sugar transporter ERD6 OS=Arabidopsis thaliana GN=ERD6 PE=1 SV=3 Back     alignment and function description
>sp|Q4F7G0|ERDL2_ARATH Sugar transporter ERD6-like 2 OS=Arabidopsis thaliana GN=SUGTL3 PE=2 SV=1 Back     alignment and function description
>sp|P93051|ERDL7_ARATH Sugar transporter ERD6-like 7 OS=Arabidopsis thaliana GN=At2g48020 PE=2 SV=2 Back     alignment and function description
>sp|Q9FRL3|ERDL6_ARATH Sugar transporter ERD6-like 6 OS=Arabidopsis thaliana GN=At1g75220 PE=1 SV=1 Back     alignment and function description
>sp|Q9LTP6|EDL13_ARATH Putative sugar transporter ERD6-like 13 OS=Arabidopsis thaliana GN=At3g20460 PE=3 SV=2 Back     alignment and function description
>sp|Q93YP9|ERDL4_ARATH Sugar transporter ERD6-like 4 OS=Arabidopsis thaliana GN=At1g19450 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query83
225451069 488 PREDICTED: putative ERD6-like transporte 1.0 0.170 0.602 8e-20
255542516 476 sugar transporter, putative [Ricinus com 0.939 0.163 0.589 8e-20
298205031 517 unnamed protein product [Vitis vinifera] 1.0 0.160 0.602 8e-20
359487967 1179 PREDICTED: uncharacterized protein LOC10 0.939 0.066 0.641 2e-19
298205019 874 unnamed protein product [Vitis vinifera] 0.939 0.089 0.564 3e-19
298205021 490 unnamed protein product [Vitis vinifera] 0.939 0.159 0.641 3e-19
224125374 442 predicted protein [Populus trichocarpa] 1.0 0.187 0.578 3e-19
310877874 473 putative ERD6-like transporter [Vitis vi 0.939 0.164 0.564 3e-19
255542520 488 sugar transporter, putative [Ricinus com 0.975 0.165 0.592 6e-19
310877862 483 putative ERD6-like transporter [Vitis vi 0.987 0.169 0.573 6e-19
>gi|225451069|ref|XP_002263418.1| PREDICTED: putative ERD6-like transporter [Vitis vinifera] gi|310877850|gb|ADP37156.1| putative ERD6-like transporter [Vitis vinifera] Back     alignment and taxonomy information
 Score =  100 bits (250), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 60/83 (72%)

Query: 1   MAEIFPINMKGLAGSLVIFIHHCINWTITFTFHFMMEWSKTGTFSIFWVICAAGVAFVTF 60
           M+EIFPINMKG AGSLV  +    +W I++ F+F+M+WS  GTF IF  IC   V FV  
Sbjct: 400 MSEIFPINMKGSAGSLVTLVSWLGSWIISYAFNFLMKWSSAGTFFIFSSICGITVLFVAK 459

Query: 61  LVPETKGRTLEEIQASITKLSRR 83
           LVPETKGRTLEEIQAS+  LS +
Sbjct: 460 LVPETKGRTLEEIQASMNPLSAK 482




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255542516|ref|XP_002512321.1| sugar transporter, putative [Ricinus communis] gi|223548282|gb|EEF49773.1| sugar transporter, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|298205031|emb|CBI34338.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359487967|ref|XP_002263811.2| PREDICTED: uncharacterized protein LOC100264207 [Vitis vinifera] Back     alignment and taxonomy information
>gi|298205019|emb|CBI34326.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|298205021|emb|CBI34328.3| unnamed protein product [Vitis vinifera] gi|310877870|gb|ADP37166.1| putative ERD6-like transporter [Vitis vinifera] Back     alignment and taxonomy information
>gi|224125374|ref|XP_002319570.1| predicted protein [Populus trichocarpa] gi|222857946|gb|EEE95493.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|310877874|gb|ADP37168.1| putative ERD6-like transporter [Vitis vinifera] Back     alignment and taxonomy information
>gi|255542520|ref|XP_002512323.1| sugar transporter, putative [Ricinus communis] gi|223548284|gb|EEF49775.1| sugar transporter, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|310877862|gb|ADP37162.1| putative ERD6-like transporter [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query83
TAIR|locus:2199539470 AT1G54730 [Arabidopsis thalian 0.927 0.163 0.597 3.3e-19
TAIR|locus:2144975482 AT5G18840 "AT5G18840" [Arabido 0.951 0.163 0.531 7.5e-19
TAIR|locus:2096219470 AT3G05150 [Arabidopsis thalian 0.903 0.159 0.546 2.4e-18
TAIR|locus:2036084496 ERD6 "EARLY RESPONSE TO DEHYDR 0.903 0.151 0.56 4.7e-18
TAIR|locus:2036009462 AT1G08900 [Arabidopsis thalian 0.975 0.175 0.518 1.4e-17
TAIR|locus:2066400463 AT2G48020 [Arabidopsis thalian 0.927 0.166 0.493 1.7e-16
TAIR|locus:2016407488 AT1G19450 [Arabidopsis thalian 0.903 0.153 0.48 1.9e-16
TAIR|locus:2025132487 ERDL6 "ERD6-like 6" [Arabidops 0.903 0.154 0.493 2.5e-16
TAIR|locus:2036039464 AT1G08890 [Arabidopsis thalian 0.975 0.174 0.518 2.8e-16
TAIR|locus:2092379488 AT3G20460 [Arabidopsis thalian 0.951 0.161 0.468 6.8e-16
TAIR|locus:2199539 AT1G54730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 236 (88.1 bits), Expect = 3.3e-19, P = 3.3e-19
 Identities = 46/77 (59%), Positives = 57/77 (74%)

Query:     1 MAEIFPINMKGLAGSLVIFIHHCINWTITFTFHFMMEWSKTGTFSIFWVICAAGVAFVTF 60
             M+EIFPI++KG AGSLV  +    +W I+FTF+F+M W+  GTF +F  +C A V FV  
Sbjct:   389 MSEIFPIDIKGSAGSLVTVVSWVGSWIISFTFNFLMNWNPAGTFYVFATVCGATVIFVAK 448

Query:    61 LVPETKGRTLEEIQASI 77
             LVPETKGRTLEEIQ SI
Sbjct:   449 LVPETKGRTLEEIQYSI 465




GO:0005215 "transporter activity" evidence=IEA
GO:0005351 "sugar:hydrogen symporter activity" evidence=ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0006810 "transport" evidence=IEA
GO:0015144 "carbohydrate transmembrane transporter activity" evidence=ISS
GO:0016020 "membrane" evidence=IEA;ISS
GO:0016021 "integral to membrane" evidence=IEA
GO:0022857 "transmembrane transporter activity" evidence=IEA
GO:0022891 "substrate-specific transmembrane transporter activity" evidence=IEA
GO:0055085 "transmembrane transport" evidence=IEA
TAIR|locus:2144975 AT5G18840 "AT5G18840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096219 AT3G05150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036084 ERD6 "EARLY RESPONSE TO DEHYDRATION 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036009 AT1G08900 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2066400 AT2G48020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2016407 AT1G19450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025132 ERDL6 "ERD6-like 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036039 AT1G08890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092379 AT3G20460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query83
TIGR00879481 TIGR00879, SP, MFS transporter, sugar porter (SP) 2e-10
pfam00083449 pfam00083, Sugar_tr, Sugar (and other) transporter 1e-09
PRK10077479 PRK10077, xylE, D-xylose transporter XylE; Provisi 2e-07
TIGR00887502 TIGR00887, 2A0109, phosphate:H+ symporter 0.001
>gnl|CDD|233165 TIGR00879, SP, MFS transporter, sugar porter (SP) family Back     alignment and domain information
 Score = 54.7 bits (132), Expect = 2e-10
 Identities = 28/74 (37%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 1   MAEIFPINMKGLAGSLVIFIHHCINWTITFTFHFMMEWSKTGTFSIFW-VICAAGVAFVT 59
           ++EIFP++++    S+ +  +   N+ + F F  M+E    G   IF+  +   G+ FV 
Sbjct: 408 VSEIFPLSLRPKGISIAVAANWLANFIVGFLFPTMLESIGVGGVFIFFGGLNVLGLIFVY 467

Query: 60  FLVPETKGRTLEEI 73
           F +PETKGRTLEEI
Sbjct: 468 FFLPETKGRTLEEI 481


This model represent the sugar porter subfamily of the major facilitator superfamily (pfam00083) [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]. Length = 481

>gnl|CDD|215702 pfam00083, Sugar_tr, Sugar (and other) transporter Back     alignment and domain information
>gnl|CDD|182225 PRK10077, xylE, D-xylose transporter XylE; Provisional Back     alignment and domain information
>gnl|CDD|129965 TIGR00887, 2A0109, phosphate:H+ symporter Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 83
KOG0569485 consensus Permease of the major facilitator superf 99.67
PF00083451 Sugar_tr: Sugar (and other) transporter; InterPro: 99.48
PRK10077479 xylE D-xylose transporter XylE; Provisional 99.4
KOG0254513 consensus Predicted transporter (major facilitator 99.39
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 99.39
KOG0253528 consensus Synaptic vesicle transporter SV2 (major 99.02
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 98.98
KOG0252538 consensus Inorganic phosphate transporter [Inorgan 98.9
TIGR00898505 2A0119 cation transport protein. 98.87
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 98.81
PRK10489417 enterobactin exporter EntS; Provisional 98.68
PRK10642490 proline/glycine betaine transporter; Provisional 98.57
KOG0255521 consensus Synaptic vesicle transporter SVOP and re 98.5
TIGR00880141 2_A_01_02 Multidrug resistance protein. 98.42
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 98.31
TIGR00893 399 2A0114 d-galactonate transporter. 98.28
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 98.2
PRK11663434 regulatory protein UhpC; Provisional 98.17
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 98.14
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 98.13
PRK03545 390 putative arabinose transporter; Provisional 98.13
PRK10213 394 nepI ribonucleoside transporter; Reviewed 98.1
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 98.1
PRK10473 392 multidrug efflux system protein MdtL; Provisional 98.09
PRK15403 413 multidrug efflux system protein MdtM; Provisional 98.09
PRK09952438 shikimate transporter; Provisional 98.08
COG2814 394 AraJ Arabinose efflux permease [Carbohydrate trans 98.0
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 97.98
PLN00028 476 nitrate transmembrane transporter; Provisional 97.98
PRK10406432 alpha-ketoglutarate transporter; Provisional 97.98
TIGR00889418 2A0110 nucleoside transporter. This family of prot 97.97
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 97.96
TIGR00895 398 2A0115 benzoate transport. 97.95
TIGR00901 356 2A0125 AmpG-related permease. 97.94
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 97.94
PRK10091 382 MFS transport protein AraJ; Provisional 97.94
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 97.93
PRK11663 434 regulatory protein UhpC; Provisional 97.93
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 97.91
PRK10054 395 putative transporter; Provisional 97.9
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 97.86
PRK11646 400 multidrug resistance protein MdtH; Provisional 97.86
PRK09874 408 drug efflux system protein MdtG; Provisional 97.85
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 97.83
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 97.79
PF07690 352 MFS_1: Major Facilitator Superfamily; InterPro: IP 97.78
KOG2532 466 consensus Permease of the major facilitator superf 97.76
PRK12307426 putative sialic acid transporter; Provisional 97.74
PRK14995 495 methyl viologen resistance protein SmvA; Provision 97.73
TIGR00900 365 2A0121 H+ Antiporter protein. 97.73
TIGR00891 405 2A0112 putative sialic acid transporter. 97.7
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 97.68
TIGR00893399 2A0114 d-galactonate transporter. 97.66
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 97.65
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 97.65
PRK10077 479 xylE D-xylose transporter XylE; Provisional 97.61
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 97.59
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 97.58
PRK12382392 putative transporter; Provisional 97.54
PRK05122399 major facilitator superfamily transporter; Provisi 97.53
TIGR00886 366 2A0108 nitrite extrusion protein (nitrite facilita 97.52
PRK09705393 cynX putative cyanate transporter; Provisional 97.51
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 97.5
TIGR00898 505 2A0119 cation transport protein. 97.48
PRK15462 493 dipeptide/tripeptide permease D; Provisional 97.48
PRK12307 426 putative sialic acid transporter; Provisional 97.47
PRK10504 471 putative transporter; Provisional 97.46
KOG0569 485 consensus Permease of the major facilitator superf 97.45
PRK11010 491 ampG muropeptide transporter; Validated 97.45
PRK11652 394 emrD multidrug resistance protein D; Provisional 97.44
PRK15075434 citrate-proton symporter; Provisional 97.43
PRK11043 401 putative transporter; Provisional 97.4
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 97.4
PRK11195 393 lysophospholipid transporter LplT; Provisional 97.39
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 97.38
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 97.32
KOG0255 521 consensus Synaptic vesicle transporter SVOP and re 97.3
PRK03893 496 putative sialic acid transporter; Provisional 97.3
PRK09528420 lacY galactoside permease; Reviewed 97.3
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 97.29
PRK10489 417 enterobactin exporter EntS; Provisional 97.26
cd06174 352 MFS The Major Facilitator Superfamily (MFS) is a l 97.24
PRK10642 490 proline/glycine betaine transporter; Provisional 97.22
PRK11902 402 ampG muropeptide transporter; Reviewed 97.2
PRK15011393 sugar efflux transporter B; Provisional 97.2
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 97.19
TIGR00805 633 oat sodium-independent organic anion transporter. 97.18
PRK03699 394 putative transporter; Provisional 97.17
PTZ00207 591 hypothetical protein; Provisional 97.16
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 97.13
PRK10406 432 alpha-ketoglutarate transporter; Provisional 97.11
TIGR00892 455 2A0113 monocarboxylate transporter 1. 97.1
TIGR00897402 2A0118 polyol permease family. This family of prot 97.06
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 97.04
PRK03893496 putative sialic acid transporter; Provisional 97.04
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 97.01
PRK10207 489 dipeptide/tripeptide permease B; Provisional 97.0
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 97.0
TIGR00892455 2A0113 monocarboxylate transporter 1. 96.88
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 96.87
KOG1330 493 consensus Sugar transporter/spinster transmembrane 96.85
PRK15075 434 citrate-proton symporter; Provisional 96.83
TIGR01272 310 gluP glucose/galactose transporter. Disruption of 96.83
PRK09952 438 shikimate transporter; Provisional 96.79
TIGR00883 394 2A0106 metabolite-proton symporter. This model rep 96.79
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 96.79
PRK03545390 putative arabinose transporter; Provisional 96.77
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 96.75
PRK09874408 drug efflux system protein MdtG; Provisional 96.62
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 96.61
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 96.58
PRK15011 393 sugar efflux transporter B; Provisional 96.53
KOG2816 463 consensus Predicted transporter ADD1 (major facili 96.52
KOG2533 495 consensus Permease of the major facilitator superf 96.52
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 96.49
PRK12382 392 putative transporter; Provisional 96.47
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 96.44
PRK09584 500 tppB putative tripeptide transporter permease; Rev 96.41
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 96.41
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 96.37
TIGR00897 402 2A0118 polyol permease family. This family of prot 96.36
KOG2615 451 consensus Permease of the major facilitator superf 96.34
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 96.3
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 96.29
TIGR00924475 yjdL_sub1_fam amino acid/peptide transporter (Pept 96.23
PF13347 428 MFS_2: MFS/sugar transport protein 96.21
PRK09705 393 cynX putative cyanate transporter; Provisional 96.18
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 96.12
KOG0254 513 consensus Predicted transporter (major facilitator 95.99
PRK05122 399 major facilitator superfamily transporter; Provisi 95.95
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 95.93
TIGR02718 390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 95.87
TIGR00891405 2A0112 putative sialic acid transporter. 95.87
TIGR00896 355 CynX cyanate transporter. This family of proteins 95.84
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 95.84
PRK03633381 putative MFS family transporter protein; Provision 95.72
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 95.71
PF06813250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 95.67
TIGR00788468 fbt folate/biopterin transporter. The only functio 95.63
TIGR00881379 2A0104 phosphoglycerate transporter family protein 95.61
PRK11646400 multidrug resistance protein MdtH; Provisional 95.59
PRK11462 460 putative transporter; Provisional 95.51
KOG3764 464 consensus Vesicular amine transporter [Intracellul 95.46
KOG2504 509 consensus Monocarboxylate transporter [Carbohydrat 95.37
PRK11010491 ampG muropeptide transporter; Validated 95.35
PRK09528 420 lacY galactoside permease; Reviewed 95.23
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 95.21
PRK10504471 putative transporter; Provisional 95.2
PRK10054395 putative transporter; Provisional 95.1
PRK03633 381 putative MFS family transporter protein; Provision 94.91
PRK09669 444 putative symporter YagG; Provisional 94.76
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 94.72
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 94.7
PRK15402406 multidrug efflux system translocase MdfA; Provisio 94.58
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 94.43
TIGR00895398 2A0115 benzoate transport. 94.03
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 93.97
TIGR00902382 2A0127 phenyl proprionate permease family protein. 93.91
PLN00028476 nitrate transmembrane transporter; Provisional 93.9
TIGR00900365 2A0121 H+ Antiporter protein. 93.79
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 93.77
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 93.71
PRK11128 382 putative 3-phenylpropionic acid transporter; Provi 93.68
PRK15034462 nitrate/nitrite transport protein NarU; Provisiona 93.3
PF03092 433 BT1: BT1 family; InterPro: IPR004324 Members of th 93.29
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 93.16
TIGR00902 382 2A0127 phenyl proprionate permease family protein. 92.96
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 92.92
COG2211 467 MelB Na+/melibiose symporter and related transport 92.91
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 92.91
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transp 92.52
PF03092433 BT1: BT1 family; InterPro: IPR004324 Members of th 92.03
PF11700 477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 91.56
PRK15403413 multidrug efflux system protein MdtM; Provisional 91.32
KOG2563 480 consensus Permease of the major facilitator superf 91.31
PRK03699394 putative transporter; Provisional 91.18
PRK09584500 tppB putative tripeptide transporter permease; Rev 90.92
PRK11195393 lysophospholipid transporter LplT; Provisional 90.68
TIGR00788 468 fbt folate/biopterin transporter. The only functio 90.26
PRK09848448 glucuronide transporter; Provisional 89.55
PF04281137 Tom22: Mitochondrial import receptor subunit Tom22 89.18
PRK10473392 multidrug efflux system protein MdtL; Provisional 89.18
PRK10091382 MFS transport protein AraJ; Provisional 88.55
PRK11462460 putative transporter; Provisional 88.25
TIGR00926654 2A1704 Peptide:H+ symporter (also transports b-lac 87.99
PF03209 403 PUCC: PUCC protein; InterPro: IPR004896 This prote 87.95
COG5336116 Uncharacterized protein conserved in bacteria [Fun 87.77
PRK11043401 putative transporter; Provisional 87.75
PF00854 372 PTR2: POT family; InterPro: IPR000109 This entry r 87.41
TIGR01301477 GPH_sucrose GPH family sucrose/H+ symporter. This 87.3
COG3104 498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 87.19
PRK10429 473 melibiose:sodium symporter; Provisional 86.91
COG2270438 Permeases of the major facilitator superfamily [Ge 86.64
KOG2325 488 consensus Predicted transporter/transmembrane prot 86.38
PRK10133 438 L-fucose transporter; Provisional 86.06
KOG4686459 consensus Predicted sugar transporter [Carbohydrat 86.0
KOG3762618 consensus Predicted transporter [General function 85.59
TIGR00986145 3a0801s05tom22 mitochondrial import receptor subun 85.27
PF10183105 ESSS: ESSS subunit of NADH:ubiquinone oxidoreducta 84.24
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 84.18
PRK11902402 ampG muropeptide transporter; Reviewed 83.12
PRK10207489 dipeptide/tripeptide permease B; Provisional 82.93
COG2807395 CynX Cyanate permease [Inorganic ion transport and 81.55
TIGR00711485 efflux_EmrB drug resistance transporter, EmrB/QacA 81.48
PF06379 344 RhaT: L-rhamnose-proton symport protein (RhaT); In 80.04
>KOG0569 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
Probab=99.67  E-value=5.5e-16  Score=100.04  Aligned_cols=80  Identities=28%  Similarity=0.345  Sum_probs=74.4

Q ss_pred             CCCCCCcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHhcccCCCCCHHHHHHHHhhc
Q 034783            1 MAEIFPINMKGLAGSLVIFIHHCINWTITFTFHFMMEWSKTGTFSIFWVICAAGVAFVTFLVPETKGRTLEEIQASITKL   80 (83)
Q Consensus         1 ~~Elfp~~~R~~~~s~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~et~~~~~~~~~~~~~~~   80 (83)
                      .+|+||++.|+++++++..++|+.++++.+.+|++.+.-+...|++|.+.+++..++.++++|||||++..|+.++++++
T Consensus       393 ~aELf~~~~R~aa~s~~~~~~w~~~fiv~~~fp~l~~~~g~~~filF~i~~~~~~i~~~~~lPETkgr~~~eI~~~~~~~  472 (485)
T KOG0569|consen  393 GAELFPQSARSAAQSVATAVNWLSNFIVGFAFPPLQNVIGPYVFILFVIPLAIFLIYLYRYLPETKGRTPYEIIEELEKR  472 (485)
T ss_pred             HHHhCCccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcchhhHHHHHHHHHHHHHHHHhCcccCCCCHHHHHHHHHhC
Confidence            37999999999999999999999999999999999995445899999999999999999999999999999998887765



>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>KOG0254 consensus Predicted transporter (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>KOG0253 consensus Synaptic vesicle transporter SV2 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>KOG0252 consensus Inorganic phosphate transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>KOG0255 consensus Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>KOG2532 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>KOG0569 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>KOG0255 consensus Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>KOG1330 consensus Sugar transporter/spinster transmembrane protein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>KOG2816 consensus Predicted transporter ADD1 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>KOG2533 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>KOG2615 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>KOG0254 consensus Predicted transporter (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>KOG3764 consensus Vesicular amine transporter [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2504 consensus Monocarboxylate transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>KOG2563 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>PF04281 Tom22: Mitochondrial import receptor subunit Tom22 ; InterPro: IPR005683 The mitochondrial protein translocase family, which is responsible for movement of nuclear encoded pre-proteins into mitochondria, is very complex with at least 19 components Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>COG5336 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PF00854 PTR2: POT family; InterPro: IPR000109 This entry represents the POT (proton-dependent oligopeptide transport) family, which all appear to be proton dependent transporters Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>KOG2325 consensus Predicted transporter/transmembrane protein [General function prediction only] Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>KOG4686 consensus Predicted sugar transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3762 consensus Predicted transporter [General function prediction only] Back     alignment and domain information
>TIGR00986 3a0801s05tom22 mitochondrial import receptor subunit Tom22 Back     alignment and domain information
>PF10183 ESSS: ESSS subunit of NADH:ubiquinone oxidoreductase (complex I) ; InterPro: IPR019329 NADH:ubiquinone oxidoreductase (complex I) (1 Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PF06379 RhaT: L-rhamnose-proton symport protein (RhaT); InterPro: IPR004673 These proteins are members of the L-Rhamnose Symporter (RhaT) family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query83
4gby_A491 The Structure Of The Mfs (Major Facilitator Superfa 3e-04
>pdb|4GBY|A Chain A, The Structure Of The Mfs (Major Facilitator Superfamily) Proton:xylose Symporter Xyle Bound To D-Xylose Length = 491 Back     alignment and structure

Iteration: 1

Score = 40.4 bits (93), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 28/83 (33%), Positives = 46/83 (55%), Gaps = 9/83 (10%) Query: 1 MAEIFPINMKGLAGSLVIFIHHCINWTITFTFHFMMEWSKT-----GTFSIFWVICAAGV 55 ++EIFP ++G A ++ + N+ +++TF M + S FS +W+ GV Sbjct: 395 LSEIFPNAIRGKALAIAVAAQWLANYFVSWTFPMMDKNSWLVAHFHNGFS-YWIYGCMGV 453 Query: 56 AFVTFL---VPETKGRTLEEIQA 75 F+ VPETKG+TLEE++A Sbjct: 454 LAALFMWKFVPETKGKTLEELEA 476 Database: pdbaa

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query83
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 99.78
2cfq_A417 Lactose permease; transport, transport mechanism, 98.2
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 98.1
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 98.03
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 97.94
2xut_A524 Proton/peptide symporter family protein; transport 97.89
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 97.67
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 97.64
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 97.47
2xut_A 524 Proton/peptide symporter family protein; transport 97.26
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 96.84
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 96.37
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 93.88
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
Probab=99.78  E-value=4.2e-19  Score=111.77  Aligned_cols=81  Identities=28%  Similarity=0.463  Sum_probs=69.7

Q ss_pred             CCCCCcchHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------hhhHHHHHHHHHHHHHHHHHHHHhcccCCCCCHHHHH
Q 034783            2 AEIFPINMKGLAGSLVIFIHHCINWTITFTFHFMME-------WSKTGTFSIFWVICAAGVAFVTFLVPETKGRTLEEIQ   74 (83)
Q Consensus         2 ~Elfp~~~R~~~~s~~~~~~~~~~~~~~~~~~~l~~-------~~~~~~~~~~~~~~~~~~~~~~~~~~et~~~~~~~~~   74 (83)
                      +|+||++.|++++|+++.++|+++++.++++|.+.+       .+....|+++++++++..++.++++|||||+++||+|
T Consensus       396 ~E~fPt~~R~~~~g~~~~~~~~~~~i~~~~~p~l~~~~~~~~~~~~~~~~~i~~~~~~~~~i~~~~~~PETkg~tLeei~  475 (491)
T 4gc0_A          396 SEIFPNAIRGKALAIAVAAQWLANYFVSWTFPMMDKNSWLVAHFHNGFSYWIYGCMGVLAALFMWKFVPETKGKTLEELE  475 (491)
T ss_dssp             HHSSCTTTHHHHHHHHHHHHHHHHHHHHTHHHHHCHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHHCCCCTTCCHHHHG
T ss_pred             HHhCCHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHHHHHHheecCCCCCCHHHHH
Confidence            699999999999999999999999999999998764       2334578899999999999999999999999999999


Q ss_pred             HHHhhccC
Q 034783           75 ASITKLSR   82 (83)
Q Consensus        75 ~~~~~~~~   82 (83)
                      +.++++++
T Consensus       476 ~~f~~~~~  483 (491)
T 4gc0_A          476 ALWEPETK  483 (491)
T ss_dssp             GGTC----
T ss_pred             HHhCCCCc
Confidence            88866543



>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query83
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 98.52
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 98.11
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 97.85
d1pv7a_ 417 Lactose permease {Escherichia coli [TaxId: 562]} 94.85
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: LacY-like proton/sugar symporter
domain: Lactose permease
species: Escherichia coli [TaxId: 562]
Probab=98.52  E-value=3.2e-07  Score=53.91  Aligned_cols=71  Identities=8%  Similarity=0.064  Sum_probs=59.9

Q ss_pred             CCCCCcchHHHHHHHHHH-HHHHHHHHHHHHHHHHHH-hhhHHHHHHHHHHHHHHHHHHHHhcccCCCCCHHH
Q 034783            2 AEIFPINMKGLAGSLVIF-IHHCINWTITFTFHFMME-WSKTGTFSIFWVICAAGVAFVTFLVPETKGRTLEE   72 (83)
Q Consensus         2 ~Elfp~~~R~~~~s~~~~-~~~~~~~~~~~~~~~l~~-~~~~~~~~~~~~~~~~~~~~~~~~~~et~~~~~~~   72 (83)
                      +|.+|++.|+++.++... .+.++.++.+.+.+.+.+ .+....|++.+++.++..++..+.+++++..+..+
T Consensus       338 ~~~~~~~~~~~~~~~~~~~~~~~g~~i~~~~~G~l~~~~g~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~r  410 (417)
T d1pv7a_         338 TSQFEVRFSATIYLVCFCFFKQLAMIFMSVLAGNMYESIGFQGAYLVLGLVALGFTLISVFTLSGPGPLSLLR  410 (417)
T ss_dssp             HHHSCGGGHHHHHHHHHTTTHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHSCCSSCTTHHH
T ss_pred             HHHCCHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHhhcCCCccchhH
Confidence            578999999999998654 567889999999999998 67777888999998888888888888888877754



>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure