Citrus Sinensis ID: 034809

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--
MNFHIYLAEKENGPKTVNNVQLIHAGKILEDNMTIAESRLPVVELPGTAITMHVVLRPSLPDKKGEKLLSDSSKSRCLCSIL
ccccccccccccccccccccEEEEccEEEccccccEEEccccccccccEEEEEEEEccccccccccccccccccccEEEEEc
cccHccccccccccccHHHEEEEEccHEEEccccccccccccccccccEEEEEEEEEcccccccccccccccccccEEEEEc
MNFHIYLAekengpktvnnVQLIHAGkilednmtiaesrlpvvelpgtaiTMHVvlrpslpdkkgekllsdssksrclcsil
MNFHIYLAekengpktvNNVQLIHAGKILEDNMTIAESRLPVVELPGTAITMHvvlrpslpdkkgekllsdssksrclcsil
MNFHIYLAEKENGPKTVNNVQLIHAGKILEDNMTIAESRLPVVELPGTAITMHVVLRPSLPDKKGEKLLSDSSKSRCLCSIL
****IYLA******KTVNNVQLIHAGKILEDNMTIAESRLPVVELPGTAITMHVVLR*************************
***HIY*******PKTVNNVQLIHAGKILEDNMTIAESRLPVVELPGTAITMHV*********************RCLCSIL
MNFHIYLAEKENGPKTVNNVQLIHAGKILEDNMTIAESRLPVVELPGTAITMHVVLRPSLPDK*******************
*NF*IYLAEKENGPKTVNNVQLIHAGKILEDNMTIAESRLPVVELPGTAITMHVVLRPSL**************SRCLCSIL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNFHIYLAEKENGPKTVNNVQLIHAGKILEDNMTIAESRLPVVELPGTAITMHVVLRPSLPDKKGEKLLSDSSKSRCLCSIL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query82 2.2.26 [Sep-21-2011]
Q8GWJ6119 Membrane-anchored ubiquit yes no 0.939 0.647 0.628 5e-20
Q6Z8K4119 Membrane-anchored ubiquit yes no 0.939 0.647 0.589 3e-19
Q9SH14120 Membrane-anchored ubiquit no no 0.939 0.641 0.537 2e-15
Q7XRU4135 Membrane-anchored ubiquit no no 0.804 0.488 0.534 8e-13
Q75GT2119 Membrane-anchored ubiquit no no 0.926 0.638 0.448 2e-12
Q9MAB9117 Membrane-anchored ubiquit no no 0.926 0.649 0.428 8e-12
Q9SW27118 Membrane-anchored ubiquit no no 0.841 0.584 0.442 4e-10
Q67UI2126 Membrane-anchored ubiquit no no 0.890 0.579 0.453 8e-10
Q8LCS8124 Membrane-anchored ubiquit no no 0.902 0.596 0.421 3e-09
Q9LSD8120 Membrane-anchored ubiquit no no 0.926 0.633 0.395 3e-08
>sp|Q8GWJ6|MUB6_ARATH Membrane-anchored ubiquitin-fold protein 6 OS=Arabidopsis thaliana GN=MUB6 PE=1 SV=1 Back     alignment and function desciption
 Score = 96.3 bits (238), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 49/78 (62%), Positives = 62/78 (79%), Gaps = 1/78 (1%)

Query: 6   YLAEKENGPKTVNNVQLIHAGKILEDNMTIAESRLPVVELPGTAITMHVVLRPSLPDKKG 65
           +  +KEN PKTVN+++LI+AGKILE+N T+AESRLPV ELPG  ITMH+VLR    DKK 
Sbjct: 42  WPKDKENTPKTVNDMKLINAGKILENNRTLAESRLPVCELPGMIITMHIVLRLPTLDKKS 101

Query: 66  EKLLSDSS-KSRCLCSIL 82
           EKL +D   K+RC+C+IL
Sbjct: 102 EKLQNDPPMKNRCVCTIL 119
May serve as docking site to facilitate the association of other proteins to the plasma membrane.
Arabidopsis thaliana (taxid: 3702)
>sp|Q6Z8K4|MUB3_ORYSJ Membrane-anchored ubiquitin-fold protein 3 OS=Oryza sativa subsp. japonica GN=MUB3 PE=3 SV=1 Back     alignment and function description
>sp|Q9SH14|MUB5_ARATH Membrane-anchored ubiquitin-fold protein 5 OS=Arabidopsis thaliana GN=MUB5 PE=1 SV=1 Back     alignment and function description
>sp|Q7XRU4|MUB4_ORYSJ Membrane-anchored ubiquitin-fold protein 4 OS=Oryza sativa subsp. japonica GN=MUB4 PE=2 SV=2 Back     alignment and function description
>sp|Q75GT2|MUB1_ORYSJ Membrane-anchored ubiquitin-fold protein 1 OS=Oryza sativa subsp. japonica GN=MUB1 PE=3 SV=1 Back     alignment and function description
>sp|Q9MAB9|MUB1_ARATH Membrane-anchored ubiquitin-fold protein 1 OS=Arabidopsis thaliana GN=MUB1 PE=1 SV=1 Back     alignment and function description
>sp|Q9SW27|MUB3_ARATH Membrane-anchored ubiquitin-fold protein 3 OS=Arabidopsis thaliana GN=MUB3 PE=1 SV=1 Back     alignment and function description
>sp|Q67UI2|MUB2_ORYSJ Membrane-anchored ubiquitin-fold protein 2 OS=Oryza sativa subsp. japonica GN=MUB2 PE=2 SV=1 Back     alignment and function description
>sp|Q8LCS8|MUB2_ARATH Membrane-anchored ubiquitin-fold protein 2 OS=Arabidopsis thaliana GN=MUB2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LSD8|MUB4_ARATH Membrane-anchored ubiquitin-fold protein 4 OS=Arabidopsis thaliana GN=MUB4 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query82
255545608118 conserved hypothetical protein [Ricinus 0.939 0.652 0.653 5e-20
302769982120 hypothetical protein SELMODRAFT_231107 [ 0.939 0.641 0.641 8e-20
225459396118 PREDICTED: membrane-anchored ubiquitin-f 0.939 0.652 0.653 3e-19
15219188119 membrane-anchored ubiquitin-fold protein 0.939 0.647 0.628 2e-18
297845214119 ubiquitin family protein [Arabidopsis ly 0.939 0.647 0.628 4e-18
115448707119 Os02g0750600 [Oryza sativa Japonica Grou 0.939 0.647 0.589 1e-17
116782631118 unknown [Picea sitchensis] 0.939 0.652 0.589 2e-17
4097587118 NTGP5 [Nicotiana tabacum] 0.939 0.652 0.538 2e-16
413924534119 hypothetical protein ZEAMMB73_605636 [Ze 0.939 0.647 0.551 4e-16
413938909119 hypothetical protein ZEAMMB73_831091 [Ze 0.939 0.647 0.564 5e-16
>gi|255545608|ref|XP_002513864.1| conserved hypothetical protein [Ricinus communis] gi|223546950|gb|EEF48447.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  101 bits (252), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 63/78 (80%), Gaps = 1/78 (1%)

Query: 6   YLAEKENGPKTVNNVQLIHAGKILEDNMTIAESRLPVVELPGTAITMHVVLRPSLPDKKG 65
           +  +KENGPKTVN+++LI+ GKILE+N T+AESRLPV ELPG  ITMHVVLRP +P+K  
Sbjct: 41  WPKDKENGPKTVNDLKLINGGKILENNRTLAESRLPVGELPGGVITMHVVLRPPMPEKIS 100

Query: 66  EKLLSDSS-KSRCLCSIL 82
           +KL  DSS K+ C CSIL
Sbjct: 101 DKLRKDSSKKTGCSCSIL 118

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|302769982|ref|XP_002968410.1| hypothetical protein SELMODRAFT_231107 [Selaginella moellendorffii] gi|302774308|ref|XP_002970571.1| hypothetical protein SELMODRAFT_231614 [Selaginella moellendorffii] gi|300162087|gb|EFJ28701.1| hypothetical protein SELMODRAFT_231614 [Selaginella moellendorffii] gi|300164054|gb|EFJ30664.1| hypothetical protein SELMODRAFT_231107 [Selaginella moellendorffii] Back     alignment and taxonomy information
>gi|225459396|ref|XP_002285815.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3 [Vitis vinifera] gi|302141907|emb|CBI19110.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|15219188|ref|NP_173624.1| membrane-anchored ubiquitin-fold protein 6 [Arabidopsis thaliana] gi|75150987|sp|Q8GWJ6.1|MUB6_ARATH RecName: Full=Membrane-anchored ubiquitin-fold protein 6; Short=AtMUB6; Short=Membrane-anchored ub-fold protein 6; Flags: Precursor gi|26452618|dbj|BAC43392.1| unknown protein [Arabidopsis thaliana] gi|28973097|gb|AAO63873.1| unknown protein [Arabidopsis thaliana] gi|332192068|gb|AEE30189.1| membrane-anchored ubiquitin-fold protein 6 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297845214|ref|XP_002890488.1| ubiquitin family protein [Arabidopsis lyrata subsp. lyrata] gi|297336330|gb|EFH66747.1| ubiquitin family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|115448707|ref|NP_001048133.1| Os02g0750600 [Oryza sativa Japonica Group] gi|75134491|sp|Q6Z8K4.1|MUB3_ORYSJ RecName: Full=Membrane-anchored ubiquitin-fold protein 3; Short=Membrane-anchored ub-fold protein 3; AltName: Full=OsMUB3; Flags: Precursor gi|46390208|dbj|BAD15639.1| putative NTGP5 [Oryza sativa Japonica Group] gi|113537664|dbj|BAF10047.1| Os02g0750600 [Oryza sativa Japonica Group] gi|149392483|gb|ABR26044.1| ubiquitin family protein [Oryza sativa Indica Group] gi|215679386|dbj|BAG96526.1| unnamed protein product [Oryza sativa Japonica Group] gi|215694651|dbj|BAG89842.1| unnamed protein product [Oryza sativa Japonica Group] gi|215737488|dbj|BAG96618.1| unnamed protein product [Oryza sativa Japonica Group] gi|218191587|gb|EEC74014.1| hypothetical protein OsI_08953 [Oryza sativa Indica Group] gi|222623680|gb|EEE57812.1| hypothetical protein OsJ_08399 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|116782631|gb|ABK22583.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|4097587|gb|AAD00119.1| NTGP5 [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|413924534|gb|AFW64466.1| hypothetical protein ZEAMMB73_605636 [Zea mays] Back     alignment and taxonomy information
>gi|413938909|gb|AFW73460.1| hypothetical protein ZEAMMB73_831091 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query82
TAIR|locus:2030616119 MUB6 "AT1G22050" [Arabidopsis 0.890 0.613 0.671 1.3e-20
TAIR|locus:2029466120 MUB5 "AT1G77870" [Arabidopsis 0.902 0.616 0.558 1.4e-16
TAIR|locus:2102172117 MUB1 "AT3G01050" [Arabidopsis 0.890 0.623 0.445 1.6e-13
TAIR|locus:2180937124 MUB2 "AT5G15460" [Arabidopsis 0.865 0.572 0.438 1.9e-12
TAIR|locus:2117383118 ATGP4 "AT4G24990" [Arabidopsis 0.841 0.584 0.442 4.5e-11
TAIR|locus:2091975120 MUB4 "AT3G26980" [Arabidopsis 0.890 0.608 0.423 1.1e-09
ZFIN|ZDB-GENE-030131-3431117 ubl3a "ubiquitin-like 3a" [Dan 0.829 0.581 0.32 0.00013
UNIPROTKB|F1P389109 UBL3 "Uncharacterized protein" 0.829 0.623 0.306 0.00035
UNIPROTKB|F1MYJ9117 UBL3 "Ubiquitin-like protein 3 0.829 0.581 0.306 0.00035
UNIPROTKB|Q2TA46117 UBL3 "Ubiquitin-like protein 3 0.829 0.581 0.306 0.00035
TAIR|locus:2030616 MUB6 "AT1G22050" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 243 (90.6 bits), Expect = 1.3e-20, P = 1.3e-20
 Identities = 51/76 (67%), Positives = 64/76 (84%)

Query:     9 EKENGPKTVNNVQLIHAGKILEDNMTIAESRLPVVELPGTAITMHVVLR-PSLPDKKGEK 67
             +KEN PKTVN+++LI+AGKILE+N T+AESRLPV ELPG  ITMH+VLR P+L DKK EK
Sbjct:    45 DKENTPKTVNDMKLINAGKILENNRTLAESRLPVCELPGMIITMHIVLRLPTL-DKKSEK 103

Query:    68 LLSDSS-KSRCLCSIL 82
             L +D   K+RC+C+IL
Sbjct:   104 LQNDPPMKNRCVCTIL 119
GO:0003674 "molecular_function" evidence=ND
GO:0005886 "plasma membrane" evidence=ISM
TAIR|locus:2029466 MUB5 "AT1G77870" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102172 MUB1 "AT3G01050" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180937 MUB2 "AT5G15460" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2117383 ATGP4 "AT4G24990" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091975 MUB4 "AT3G26980" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-3431 ubl3a "ubiquitin-like 3a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1P389 UBL3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MYJ9 UBL3 "Ubiquitin-like protein 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q2TA46 UBL3 "Ubiquitin-like protein 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6Z8K4MUB3_ORYSJNo assigned EC number0.58970.93900.6470yesno
Q8GWJ6MUB6_ARATHNo assigned EC number0.62820.93900.6470yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query82
pfam13881111 pfam13881, Rad60-SLD_2, Ubiquitin-2 like Rad60 SUM 5e-29
cd01814113 cd01814, NTGP5, Ubiquitin-like NTGP5 and ATGP4 1e-25
>gnl|CDD|206052 pfam13881, Rad60-SLD_2, Ubiquitin-2 like Rad60 SUMO-like Back     alignment and domain information 
 Score = 99.3 bits (248), Expect = 5e-29
 Identities = 37/72 (51%), Positives = 49/72 (68%)

Query: 9   EKENGPKTVNNVQLIHAGKILEDNMTIAESRLPVVELPGTAITMHVVLRPSLPDKKGEKL 68
           +KE GPK+ N+V+LI+AGKILE+N T+ E RLP  E PG  I MHVV+RP LP+   EK 
Sbjct: 40  DKEEGPKSPNDVKLINAGKILENNKTLGECRLPAGETPGGVIVMHVVVRPPLPEPNSEKK 99

Query: 69  LSDSSKSRCLCS 80
            +   ++ C C 
Sbjct: 100 RNKPKQTGCGCC 111

Length = 111
>gnl|CDD|176409 cd01814, NTGP5, Ubiquitin-like NTGP5 and ATGP4 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 82
cd01814113 NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT 99.94
PF13881111 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB 99.92
KOG0004156 consensus Ubiquitin/40S ribosomal protein S27a fus 99.71
cd0179374 Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui 99.59
cd0180774 GDX_N ubiquitin-like domain of GDX. GDX contains a 99.5
cd0181575 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC 99.48
cd0179778 NIRF_N amino-terminal ubiquitin-like domain of Np9 99.47
cd0180076 SF3a120_C Ubiquitin-like domain of Mammalian splic 99.46
KOG0003128 consensus Ubiquitin/60s ribosomal protein L40 fusi 99.45
cd0181074 ISG15_repeat2 ISG15 ubiquitin-like protein, second 99.45
cd01802103 AN1_N ubiquitin-like domain of AN1. AN1 (also know 99.45
cd0179870 parkin_N amino-terminal ubiquitin-like of parkin p 99.41
PTZ0004476 ubiquitin; Provisional 99.38
cd0180676 Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn 99.38
cd0179470 DC_UbP_C dendritic cell derived ubiquitin-like pro 99.35
cd0180871 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC 99.34
cd0180376 Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 99.3
cd0180972 Scythe_N Ubiquitin-like domain of Scythe protein. 99.26
PF0024069 ubiquitin: Ubiquitin family; InterPro: IPR000626 U 99.25
KOG000570 consensus Ubiquitin-like protein [Cell cycle contr 99.23
cd0179173 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know 99.21
cd0180577 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo 99.18
cd0180478 midnolin_N Ubiquitin-like domain of midnolin. midn 99.18
cd0176387 Sumo Small ubiquitin-related modifier (SUMO). Smal 99.17
cd0179671 DDI1_N DNA damage inducible protein 1 ubiquitin-li 99.17
cd0179079 Herp_N Homocysteine-responsive endoplasmic reticul 99.14
cd0179280 ISG15_repeat1 ISG15 ubiquitin-like protein, first 99.11
cd0181271 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter 98.98
cd0179975 Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO 98.89
KOG0010 493 consensus Ubiquitin-like protein [Posttranslationa 98.78
cd0181374 UBP_N UBP ubiquitin processing protease. The UBP ( 98.72
TIGR00601 378 rad23 UV excision repair protein Rad23. All protei 98.65
smart0021364 UBQ Ubiquitin homologues. Ubiquitin-mediated prote 98.63
KOG000175 consensus Ubiquitin and ubiquitin-like proteins [P 98.56
cd0176969 UBL Ubiquitin-like domain of UBL. UBLs function by 98.56
cd01795107 USP48_C USP ubiquitin-specific protease. The USP ( 98.56
PF1197672 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter 98.22
KOG4248 1143 consensus Ubiquitin-like protein, regulator of apo 98.14
cd0178984 Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol 98.04
KOG0011 340 consensus Nucleotide excision repair factor NEF2, 97.75
cd0180177 Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N- 97.52
cd01788119 ElonginB Ubiquitin-like domain of Elongin B. Elong 97.39
KOG0006 446 consensus E3 ubiquitin-protein ligase (Parkin prot 97.21
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 96.85
PF1456087 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K 96.83
PLN02560 308 enoyl-CoA reductase 96.78
KOG176999 consensus Ubiquitin-like proteins [Posttranslation 95.38
PF1030297 DUF2407: DUF2407 ubiquitin-like domain; InterPro: 94.98
PF0881779 YukD: WXG100 protein secretion system (Wss), prote 94.47
PF1106998 DUF2870: Protein of unknown function (DUF2870); In 89.92
KOG4495110 consensus RNA polymerase II transcription elongati 88.37
KOG1872 473 consensus Ubiquitin-specific protease [Posttransla 88.08
>cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4 Back     alignment and domain information 
Probab=99.94  E-value=3e-27  Score=157.54  Aligned_cols=78  Identities=50%  Similarity=0.777  Sum_probs=74.0

Q ss_pred             chhhhhhhhcCCCCCCCceEEEecceecCCccccccCCCCCCCCCCCcEEEEEEeccCCCccccccccCCCCC-CceEE
Q 034809            2 NFHIYLAEKENGPKTVNNVQLIHAGKILEDNMTIAESRLPVVELPGTAITMHVVLRPSLPDKKGEKLLSDSSK-SRCLC   79 (82)
Q Consensus         2 ~~~~w~~e~eg~P~s~~~qrLI~~Gk~Led~~tL~~~~i~~g~~p~~~~Tmhlv~~~~~~~kk~~k~~~~~~~-~~C~C   79 (82)
                      .+++||++|||+|.++++|||||+||+|+|++||++|+++.|++|++++|||||+|++.++++.+|+.+..++ .+|+|
T Consensus        35 I~~~~p~~ke~~P~~~~~qKLIysGKiLeD~~TL~d~~~p~g~~~~~~~TmHvvlr~~~~~~~~~k~~~~~~~~~~c~c  113 (113)
T cd01814          35 VVSQWPKDKEVGPKTVNEVKLISAGKILENSKTVGECRSPVGDIAGGVITMHVVVQPPLADKKTEKKVDKAPKAVICTC  113 (113)
T ss_pred             HHHhcccccccCCCCHHHeEEEeCCeecCCCCcHHHhCCcccccCCCceEEEEEecCCCCCccccccccCCcccCCCCC
Confidence            3578999999999888999999999999999999999999999999999999999999999999888888888 99998

NTGP5 and ATGP4 are plant-specific isoprenylated GTP-binding proteins with a single fold that resembles ubiquitin. The function of these proteins is unknown.
>PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A Back     alignment and domain information
>KOG0004 consensus Ubiquitin/40S ribosomal protein S27a fusion [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01793 Fubi Fubi ubiquitin-like protein Back     alignment and domain information
>cd01807 GDX_N ubiquitin-like domain of GDX Back     alignment and domain information
>cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP Back     alignment and domain information
>cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF Back     alignment and domain information
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 Back     alignment and domain information
>KOG0003 consensus Ubiquitin/60s ribosomal protein L40 fusion [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 Back     alignment and domain information
>cd01802 AN1_N ubiquitin-like domain of AN1 Back     alignment and domain information
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein Back     alignment and domain information
>PTZ00044 ubiquitin; Provisional Back     alignment and domain information
>cd01806 Nedd8 Nebb8-like ubiquitin protein Back     alignment and domain information
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein Back     alignment and domain information
>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 Back     alignment and domain information
>cd01803 Ubiquitin Ubiquitin Back     alignment and domain information
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade Back     alignment and domain information
>KOG0005 consensus Ubiquitin-like protein [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01791 Ubl5 UBL5 ubiquitin-like modifier Back     alignment and domain information
>cd01805 RAD23_N Ubiquitin-like domain of RAD23 Back     alignment and domain information
>cd01804 midnolin_N Ubiquitin-like domain of midnolin Back     alignment and domain information
>cd01763 Sumo Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain Back     alignment and domain information
>cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein Back     alignment and domain information
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 Back     alignment and domain information
>cd01812 BAG1_N Ubiquitin-like domain of BAG1 Back     alignment and domain information
>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 Back     alignment and domain information
>KOG0010 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>cd01813 UBP_N UBP ubiquitin processing protease Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>smart00213 UBQ Ubiquitin homologues Back     alignment and domain information
>KOG0001 consensus Ubiquitin and ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>cd01769 UBL Ubiquitin-like domain of UBL Back     alignment and domain information
>cd01795 USP48_C USP ubiquitin-specific protease Back     alignment and domain information
>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins Back     alignment and domain information
>KOG4248 consensus Ubiquitin-like protein, regulator of apoptosis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B Back     alignment and domain information
>KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair] Back     alignment and domain information
>cd01801 Tsc13_N Ubiquitin-like domain of Tsc13 Back     alignment and domain information
>cd01788 ElonginB Ubiquitin-like domain of Elongin B Back     alignment and domain information
>KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A Back     alignment and domain information
>PLN02560 enoyl-CoA reductase Back     alignment and domain information
>KOG1769 consensus Ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10302 DUF2407: DUF2407 ubiquitin-like domain; InterPro: IPR019413 This entry represents a family of proteins of unknown function found in fungi Back     alignment and domain information
>PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold [] Back     alignment and domain information
>PF11069 DUF2870: Protein of unknown function (DUF2870); InterPro: IPR021298 This is a eukaryotic family of proteins with unknown function Back     alignment and domain information
>KOG4495 consensus RNA polymerase II transcription elongation factor Elongin/SIII, subunit elongin B [Transcription] Back     alignment and domain information
>KOG1872 consensus Ubiquitin-specific protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query82
1se9_A126 Structure Of At3g01050, A Ubiquitin-Fold Protein Fr 6e-13
>pdb|1SE9|A Chain A, Structure Of At3g01050, A Ubiquitin-Fold Protein From Arabidopsis Thaliana Length = 126 Back     alignment and structure 
Iteration: 1

 Score = 68.9 bits (167), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 52/77 (67%), Gaps = 1/77 (1%)
Query: 6   YLAEKENGPKTVNNVQLIHAGKILEDNMTIAESRLPVVELPGTAITMHVVLRPSLPDKKG 65
           +  EKENGPKTV  V+LI AGK+LE++ T+ + R PV  L G   TMHV+++  + +K+ 
Sbjct: 51  WPREKENGPKTVKEVKLISAGKVLENSKTVKDYRSPVSNLAGAVTTMHVIIQAPVTEKE- 109
Query: 66  EKLLSDSSKSRCLCSIL 82
           +K   D   ++C+CS++
Sbjct: 110 KKPKGDPKMNKCVCSVM 126

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query82
1se9_A126 Ubiquitin family; ubiquitin-like, cell-free, wheat 2e-24
2gow_A125 HCG-1 protein, ubiquitin-like protein 3; BC059385, 3e-18
1wgh_A116 Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo 4e-16
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 7e-04
>1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Length = 126 Back     alignment and structure
 Score = 87.4 bits (216), Expect = 2e-24
 Identities = 33/74 (44%), Positives = 51/74 (68%), Gaps = 1/74 (1%)

Query: 9   EKENGPKTVNNVQLIHAGKILEDNMTIAESRLPVVELPGTAITMHVVLRPSLPDKKGEKL 68
           EKENGPKTV  V+LI AGK+LE++ T+ + R PV  L G   TMHV+++  + +K+ +K 
Sbjct: 54  EKENGPKTVKEVKLISAGKVLENSKTVKDYRSPVSNLAGAVTTMHVIIQAPVTEKE-KKP 112

Query: 69  LSDSSKSRCLCSIL 82
             D   ++C+CS++
Sbjct: 113 KGDPKMNKCVCSVM 126
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Length = 125 Back     alignment and structure
>1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Length = 116 Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Length = 90 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query82
1se9_A126 Ubiquitin family; ubiquitin-like, cell-free, wheat 99.97
2gow_A125 HCG-1 protein, ubiquitin-like protein 3; BC059385, 99.91
1wgh_A116 Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo 99.81
3u5c_f152 40S ribosomal protein S31; translation, ribosome, 99.57
4ajy_B118 Transcription elongation factor B polypeptide 2; E 99.54
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 99.54
2fnj_B118 Transcription elongation factor B polypeptide 2; b 99.52
1wju_A100 NEDD8 ultimate buster-1; ubiquitin-like domain, st 99.52
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 99.5
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 99.49
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 99.49
2lxa_A87 Ubiquitin-like protein MDY2; ubiquitin-like domain 99.48
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 99.48
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 99.48
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 99.47
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 99.46
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 99.45
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 99.45
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 99.45
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 99.45
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 99.45
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 99.45
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 99.44
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 99.44
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 99.43
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 99.43
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 99.43
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 99.43
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 99.42
4hcn_B98 Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas 99.42
1we6_A111 Splicing factor, putative; structural genomics, ub 99.41
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 99.4
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 99.4
3v6c_B91 Ubiquitin; structural genomics, structural genomic 99.4
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 99.39
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 99.39
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 99.39
4a20_A98 Ubiquitin-like protein MDY2; protein binding, GET- 99.38
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 99.38
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 99.37
3m62_B106 UV excision repair protein RAD23; armadillo-like r 99.37
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 99.37
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 99.37
3vdz_A111 Ubiquitin-40S ribosomal protein S27A; gadolinium, 99.36
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 99.35
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 99.35
4b6w_A86 Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik 99.35
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 99.03
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 99.35
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 99.34
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 99.34
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 99.33
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 99.32
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 99.32
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 99.32
1x1m_A107 Ubiquitin-like protein SB132; structural genomics, 99.32
2xzm_9189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 99.31
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 99.31
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 99.3
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 99.3
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 99.3
4dbg_A105 Ranbp-type and C3HC4-type zinc finger-containing; 99.28
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 99.28
2daf_A118 FLJ35834 protein; hypothetical protein FLJ35834, u 99.27
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 99.27
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 99.26
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 99.25
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 99.23
1wia_A95 Hypothetical ubiquitin-like protein (riken cDNA 20 99.21
1v2y_A105 3300001G02RIK protein; hypothetical protein, ubiqu 99.2
1wxv_A92 BAG-family molecular chaperone regulator-1; struct 99.18
2kjr_A95 CG11242; UBL, ubiquitin, ubiquitin-like, structura 99.15
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 99.15
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 99.14
2kj6_A97 Tubulin folding cofactor B; methods development, N 99.14
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 99.14
2dzm_A100 FAS-associated factor 1; ubiquitin-like domain, HF 99.12
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 99.07
2io1_B94 Small ubiquitin-related modifier 3 precursor; SUMO 99.04
1v6e_A95 Cytoskeleton-associated protein 1; tubulin-specifi 99.03
2dzj_A88 Synaptic glycoprotein SC2; ubiquitin-like fold, st 99.02
3ai5_A307 Yeast enhanced green fluorescent protein, ubiquit; 99.01
1oqy_A 368 HHR23A, UV excision repair protein RAD23 homolog A 99.0
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 98.95
2io0_B91 Small ubiquitin-related modifier 2 precursor; SUMO 98.9
1t0y_A122 Tubulin folding cofactor B; ubiquitin-like, cytosk 98.9
2d07_B93 Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho 98.88
1wz0_A104 Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li 98.78
2eke_C106 Ubiquitin-like protein SMT3; UBC9, SUMO binding mo 98.78
1wm3_A72 Ubiquitin-like protein SMT3B; ubiquitin fold, half 98.76
1wf9_A107 NPL4 family protein; beta-grAsp fold like domain, 98.72
2k8h_A110 Small ubiquitin protein; SUMO, post-translational 98.67
3a4r_A79 Nfatc2-interacting protein; ubiquitin fold, coiled 98.64
3shq_A 320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 98.55
2kzr_A86 Ubiquitin thioesterase OTU1; structural genomics, 98.53
3pge_A200 SUMO-modified proliferating cell nuclear antigen; 98.37
3kyd_D115 Small ubiquitin-related modifier 1; SUMO, thioeste 98.16
3tix_A207 Ubiquitin-like protein SMT3, RNA-induced transcri 98.0
1wjn_A97 Tubulin-folding protein TBCE; ubiquitin-like domai 97.92
3v7o_A 227 Minor nucleoprotein VP30; ssgcid, seattle structur 97.74
4efo_A94 Serine/threonine-protein kinase TBK1; ubiquitin li 97.7
3goe_A82 DNA repair protein RAD60; SUMO-like domain, sumoyl 97.22
3ix6_A 360 TS, tsase, thymidylate synthase; niaid, ssgcid, se 97.15
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 97.06
4da1_A 389 Protein phosphatase 1K, mitochondrial; metal-ION-a 96.59
2jxx_A97 Nfatc2-interacting protein; nuclear factor of acti 96.51
2l76_A95 Nfatc2-interacting protein; ubiquitin-like domain, 95.87
2bps_A81 YUKD protein; ubiquitin-like protein, ubiquitin; 2 90.29
3qx1_A84 FAS-associated factor 1; UBX, protein binding, P97 87.82
2pjh_A80 Protein NPL4, nuclear protein localization protein 86.48
>1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
Probab=99.97  E-value=2.6e-31  Score=178.53  Aligned_cols=78  Identities=42%  Similarity=0.766  Sum_probs=59.8

Q ss_pred             hhhhhhhhcCCCCCCCceEEEecceecCCccccccCCCCCCCCCCCcEEEEEEeccCCCccccccccCCCCC-CceEEee
Q 034809            3 FHIYLAEKENGPKTVNNVQLIHAGKILEDNMTIAESRLPVVELPGTAITMHVVLRPSLPDKKGEKLLSDSSK-SRCLCSI   81 (82)
Q Consensus         3 ~~~w~~e~eg~P~s~~~qrLI~~Gk~Led~~tL~~~~i~~g~~p~~~~Tmhlv~~~~~~~kk~~k~~~~~~~-~~C~C~i   81 (82)
                      +++||+|+||+|+++++|||||+||+|+|++||++|+|+.+++|++++|||||+|+.+++++  |+.+..++ ++|+|+|
T Consensus        48 ~~~~p~dkegiP~~~~qQrLIy~GK~LeD~~TLsdy~I~~~~~~~~v~tmhlVlrl~g~~kk--kk~~~~pkk~~C~C~I  125 (126)
T 1se9_A           48 ISEWPREKENGPKTVKEVKLISAGKVLENSKTVKDYRSPVSNLAGAVTTMHVIIQAPVTEKE--KKPKGDPKMNKCVCSV  125 (126)
T ss_dssp             HHHSCTTCSSSCCSGGGEEEEETTEECCTTSBGGGGSCCTTSCTTCCEEEEEEECCCSSCCC--C---------------
T ss_pred             HhhcccccccCCCChhhEEEEECCeECcCCCcHHHcCCCcCCccCCcEEEEEEeccCCcccc--ccCCCCCCCCCceEEe
Confidence            67899999999988899999999999999999999999999999999999999999998876  66677777 9999999


Q ss_pred             C
Q 034809           82 L   82 (82)
Q Consensus        82 ~   82 (82)
                      |
T Consensus       126 l  126 (126)
T 1se9_A          126 M  126 (126)
T ss_dssp             -
T ss_pred             C
Confidence            7
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Back     alignment and structure
>1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f Back     alignment and structure
>4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A Back     alignment and structure
>1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Back     alignment and structure
>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Back     alignment and structure
>2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Back     alignment and structure
>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 Back     alignment and structure
>2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Back     alignment and structure
>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 Back     alignment and structure
>1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Back     alignment and structure
>1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Back     alignment and structure
>3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} Back     alignment and structure
>3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3v7o_A Minor nucleoprotein VP30; ssgcid, seattle structural genomics center for infectious disease, SMT, transcription; 2.25A {Reston ebolavirus} Back     alignment and structure
>4efo_A Serine/threonine-protein kinase TBK1; ubiquitin like domain, transferase; 1.77A {Homo sapiens} Back     alignment and structure
>3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* Back     alignment and structure
>3ix6_A TS, tsase, thymidylate synthase; niaid, ssgcid, seattle structural center for infectious DISE brucellosis, orchitis, epididymitis, mastitis; 2.20A {Brucella melitensis} Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A Back     alignment and structure
>2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} Back     alignment and structure
>2l76_A Nfatc2-interacting protein; ubiquitin-like domain, structural genomics, PSI-biology, Pro structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis} Back     alignment and structure
>3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A Back     alignment and structure
>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 82
d1se9a_101 d.15.1.1 (A:) Hypothetical protein At3g01050 {Thal 7e-14
d1wgha_116 d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mous 9e-09
d1wgda_93 d.15.1.1 (A:) Homocysteine-responsive endoplasmic 2e-04
d2c9wb1103 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) 0.002
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 101 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ubiquitin-related
domain: Hypothetical protein At3g01050
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 58.8 bits (142), Expect = 7e-14
 Identities = 28/56 (50%), Positives = 40/56 (71%)

Query: 9   EKENGPKTVNNVQLIHAGKILEDNMTIAESRLPVVELPGTAITMHVVLRPSLPDKK 64
           EKENGPKTV  V+LI AGK+LE++ T+ + R PV  L G   TMHV+++  + +K+
Sbjct: 45  EKENGPKTVKEVKLISAGKVLENSKTVKDYRSPVSNLAGAVTTMHVIIQAPVTEKE 100
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 116 Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query82
d1se9a_101 Hypothetical protein At3g01050 {Thale cress (Arabi 99.88
d1wgha_116 Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu 99.69
d2zeqa178 Ubiquitin-like domain of parkin {Mouse (Mus muscul 99.62
d2faza176 Ubiquitin-like PHD and RING finger domain-containi 99.59
d1wh3a_87 2'-5'-oligoadenylate synthetase-like protein, OASL 99.59
d1bt0a_73 Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI 99.58
d1wy8a176 Ubiquitin-like PHD and RING finger domain-containi 99.57
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 99.57
d1ttna180 Dendritic cell-derived ubiquitin-like protein {Hum 99.55
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 99.54
d1we6a_111 Splicing factor 3 subunit 1, C-terminal domain {Th 99.54
d2bwfa173 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.52
d1zkha186 Splicing factor 3 subunit 1, C-terminal domain {Hu 99.5
d1wx9a173 Large proline-rich protein BAT3 {Human (Homo sapie 99.5
d1yqba184 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 99.48
d1x1ma194 Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta 99.47
d2c9wb1103 Elongin B {Human (Homo sapiens) [TaxId: 9606]} 99.45
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 99.42
d1z2ma176 Interferon-induced 15 kDa protein {Human (Homo sap 99.42
d1uela_95 Ubiquitin-like domain of Rad23 homolog B (Hhr23B) 99.41
d1wx8a183 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 99.39
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 99.36
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 99.32
d1oqya477 Ubiquitin-like domain of Rad23 homolog A (Hhr23a) 99.31
d1wgda_93 Homocysteine-responsive endoplasmic reticulum-resi 99.29
d1v5oa_102 1700011n24rik protein {Mouse (Mus musculus) [TaxId 99.28
d1wjua_100 NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens 99.26
d1euvb_79 SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy 99.19
d1wiaa_95 Ubiquitin-like protein bab25500 (2010008E23Rik) {M 99.15
d1wxva181 Bag-family molecular chaperone regulator-1 {Human 99.14
d1wgga_96 Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M 99.11
d1v5ta_90 8430435i17rik protein {Mouse (Mus musculus) [TaxId 99.1
d1v86a_95 hypothetical D7wsu128e protein {Mouse (Mus musculu 99.03
d1v2ya_105 Ubiquitin-like protein 3300001g02rik {Mouse (Mus m 98.96
d1v6ea_95 Ubiquitin-like domain of tubulin folding cofactor 98.94
d2uyzb177 SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax 98.77
d1wjna_97 Tubulin-folding protein TbcE {Mouse (Mus musculus) 98.56
d1t0ya_90 Ubiquitin-like domain of tubulin folding cofactor 98.51
d1wm3a_72 SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} 97.19
d1wf9a194 NPL4-like protein 1 {Thale cress (Arabidopsis thal 88.44
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ubiquitin-related
domain: Hypothetical protein At3g01050
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.88  E-value=1.3e-23  Score=135.09  Aligned_cols=63  Identities=44%  Similarity=0.727  Sum_probs=59.0

Q ss_pred             chhhhhhhhcCCCCCCCceEEEecceecCCccccccCCCCCCCCCCCcEEEEEEeccCCCccc
Q 034809            2 NFHIYLAEKENGPKTVNNVQLIHAGKILEDNMTIAESRLPVVELPGTAITMHVVLRPSLPDKK   64 (82)
Q Consensus         2 ~~~~w~~e~eg~P~s~~~qrLI~~Gk~Led~~tL~~~~i~~g~~p~~~~Tmhlv~~~~~~~kk   64 (82)
                      .+++||.+|+|+|.+|++|||||+||+|+|++||++|+|..|++++.++|||||+|++.++++
T Consensus        38 I~~~~~~~k~~iP~~~~~qRLIf~Gk~L~D~~tL~dy~i~~g~~~~~~~tmHlVvrpp~~~~~  100 (101)
T d1se9a_          38 VISEWPREKENGPKTVKEVKLISAGKVLENSKTVKDYRSPVSNLAGAVTTMHVIIQAPVTEKE  100 (101)
T ss_dssp             HHHHSCTTCSSSCCSGGGEEEEETTEECCTTSBGGGGSCCTTSCTTCCEEEEEEECCCSSCCC
T ss_pred             HHHhccccccCCCCCcccEEEEECCeEecCCCCHHHcCCCCCCcCCCceEEEEEeCCCCCccC
Confidence            467899999999988899999999999999999999999999999999999999999888764
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure