Score = 66.2 bits (160), Expect = 5e-11, Method: Compositional matrix adjust.
Identities = 27/59 (45%), Positives = 42/59 (71%)
Query: 19 YKGKNVSIENLHQGFTHIFESTFESTEGVAEYVAHPAHVEYANLFLANLEKVLVIDYKP 77
Y GK+V+ +N +G+THI E TFES E + +Y+ HPAHV + +++ + EK+L+ DY P
Sbjct: 41 YWGKDVTQKNKEEGYTHIVEVTFESVETIQDYIIHPAHVGFGDVYRSFWEKLLIFDYTP 99
Polyketide cyclase which functions in concert with OLS/TKS to form olivetolic acid. Has no intrinsic polyketide synthase activity and requires the presence of OLS to produce olivetolic acid.
Cannabis sativa (taxid: 3483)
EC: 4
EC: .
EC: 4
EC: .
EC: 1
EC: .
EC: 2
EC: 6
>sp|Q9FK81|Y5258_ARATH Uncharacterized protein At5g22580 OS=Arabidopsis thaliana GN=At5g22580 PE=1 SV=1
>gi|159162871|pdb|1Q53|A Chain A, Solution Structure Of Hypothetical Arabidopsis Thaliana Protein At3g17210. Center For Eukaryotic Structural Genomics Target 13081 gi|159162872|pdb|1Q53|B Chain B, Solution Structure Of Hypothetical Arabidopsis Thaliana Protein At3g17210. Center For Eukaryotic Structural Genomics Target 13081
Score = 84 (34.6 bits), Expect = 0.00093, P = 0.00093
Identities = 21/58 (36%), Positives = 28/58 (48%)
Query: 21 GKNVSIENLHQGFTHIFESTFESTEGVAEYVAH-PAHVEYANLFLANLEKVLVIDYKP 77
GK+ S E G TH F + FES E YV+ P H+E +E L +D+ P
Sbjct: 50 GKDHSPEGAQHGMTHAFVAQFESREDRDYYVSKDPVHLELGPRIAPVVETFLCLDFTP 107
Parameters:
V=100
filter=SEG
E=0.001
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.321 0.136 0.391 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 82 82 0.00091 102 3 11 22 0.39 29
29 0.43 30
Statistics:
Database: /share/blast/go-seqdb.fasta
Title: go_20130330-seqdb.fasta
Posted: 5:47:42 AM PDT Apr 1, 2013
Created: 5:47:42 AM PDT Apr 1, 2013
Format: XDF-1
# of letters in database: 169,044,731
# of sequences in database: 368,745
# of database sequences satisfying E: 6
No. of states in DFA: 492 (52 KB)
Total size of DFA: 91 KB (2067 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00
No. of threads or processors used: 24
Search cpu time: 8.67u 0.11s 8.78t Elapsed: 00:00:00
Total cpu time: 8.67u 0.11s 8.78t Elapsed: 00:00:00
Start: Mon May 20 17:50:54 2013 End: Mon May 20 17:50:54 2013
Score = 60.8 bits (148), Expect = 5e-14
Identities = 26/81 (32%), Positives = 40/81 (49%), Gaps = 7/81 (8%)
Query: 1 MIAELIRSCCGL-----ELLAVKYKGKNVSIENLHQGFTHIFESTFESTEGVAEYVAHPA 55
I EL+ + L +L+++ G+NVS E G+ H+ S FE E + Y HPA
Sbjct: 17 DIEELLEALEALKGLIPGILSIEV-GRNVSPEGRSGGYDHVLVSEFEDEEDLDAYQVHPA 75
Query: 56 HVEYANLFLANL-EKVLVIDY 75
HV + L E +V+D+
Sbjct: 76 HVAVVERLVPPLAEDRVVVDF 96
The function of this domain is unknown, but it is upregulated in response to salt stress in Populus balsamifera (balsam poplar). It is also found at the C-terminus of a fructose 1,6-bisphosphate aldolase from Hydrogenophilus thermoluteolus.It is found in the pA01 plasmid, which encodes genes for molybdopterin uptake and degradation of plant alkaloid nicotine. The structure of one has been solved and the domain forms an alpha-beta barrel dimer. Although there is a clear duplication within the domain it is not obviously detectable in the sequence. Length = 97
The function of this family is unknown, but it is upregulated in response to salt stress in Populus balsamifera. It is also found at the C-terminus of an fructose 1,6-bisphosphate aldolase from Hydrogenophilus thermoluteolus. Arthrobacter nicotinovorans ORF106 is found in the pA01 plasmid, which encodes genes for molybdopterin uptake and degradation of plant alkaloid nicotine. The structure of one has been solved and the domain forms an a/b barrel dimer. Although there is a clear duplication within the domain it is not obviously detectable in the sequence. Length = 96
>PF07876 Dabb: Stress responsive A/B Barrel Domain; InterPro: IPR013097 The stress-response A/B barrel domain is found in a class of stress-response proteins in plants
It is also found in some bacterial fructose-bisphosphate aldolase such as at the C terminus of a fructose 1,6-bisphosphate aldolase from Hydrogenophilus thermoluteolus (Q9ZA13 from SWISSPROT) []. Q93NG5 from SWISSPROT is found in the pA01 plasmid, which encodes genes for molybdopterin uptake and degradation of plant alkaloid nicotine. The stress-response A/B barrel domain forms a very stable dimer. This dimer belongs to the superfamily of dimeric alpha+beta barrels in which the two beta-sheets form a beta-barrel. The two molecules in the dimer are related by a 2-fold axis parallel to helix H1 and beta-strands B3 and B4. C-terminal residues extending from the beta4 strand of each monomer wrap around and connect with the beta2 strand and alpha1 helix of the opposing monomer to form the dimer interface [, , ].The outer surface of the beta-sheets of the two molecules forms a beta-barrel-like structure defining a central pore. The function of the stress-response A/B barrel domain is unknown [, , ], but it is upregulated in response to salt stress in Populus balsamifera (balsam poplar) []. Some proteins known to contain a stress response A/B barrel domain are listed below: - Arabidopsis thaliana At3g17210 - Arabidopsis thaliana At5g22580 -Populus tremula stable protein 1 (SP-1)(Populus species), a thermostable stress-responsive protein. - Pseudomonas hydrogenothermophila fructose 1,6-bisphosphate aldolase (cbbA). The structure of one of these proteins has been solved (Q9LUV2 from SWISSPROT) and the domain forms an alpha-beta barrel dimer [].; PDB: 3BB5_E 3FMB_A 3BDE_B 2QYC_A 1Q53_B 2Q3P_A 1Q4R_A 3BN7_A 3BGU_B 1RJJ_B ....
>PF03992 ABM: Antibiotic biosynthesis monooxygenase; InterPro: IPR007138 This domain is found in monooxygenases involved in the biosynthesis of several antibiotics by Streptomyces species, which can carry out oxygenation without the assistance of any of the prosthetic groups, metal ions or cofactors normally associated with activation of molecular oxygen
The structure of ActVA-Orf6 monooxygenase from Streptomyces coelicolor (Q53908 from SWISSPROT), which is involved in actinorhodin biosynthesis, reveals a dimeric alpha+beta barrel topology []. There is also a conserved histidine that is likely to be an active site residue. In S. coelicolor SCO1909 (Q9X9W3 from SWISSPROT) this domain occurs as a repeat. This domain is also found in protein LsrG, involved in the degradation of quorum-sensing molecule autoinducer-2 [], and in several uncharacterised proteins.; PDB: 1X7V_A 3F44_A 4DN9_B 1N5T_B 1LQ9_A 1N5Q_B 1N5V_A 1N5S_A 2GFF_B 3BM7_A ....
>PF07045 DUF1330: Protein of unknown function (DUF1330); InterPro: IPR010753 This family consists of several hypothetical bacterial proteins of around 90 residues in length
>PF01037 AsnC_trans_reg: AsnC family; InterPro: IPR019887 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities
One such family is the AsnC/Lrp subfamily []. The Lrp family of transcriptional regulators appears to be widely distributed among bacteria and archaea, as an important regulatory system of the amino acid metabolism and related processes []. Members of the Lrp family are small DNA-binding proteins with molecular masses of around 15 kDa. Target promoters often contain a number of binding sites that typically lack obvious inverted repeat elements, and to which binding is usually co-operative. LrpA from Pyrococcus furiosus is the first Lrp-like protein to date of which a three-dimensional structure has been solved. In the crystal structure LrpA forms an octamer consisting of four dimers. The structure revealed that the N-terminal part of the protein consists of a helix-turn-helix (HTH) domain, a fold generally involved in DNA binding. The C terminus of Lrp-like proteins has a beta-fold, where the two alpha-helices are located at one side of the four-stranded antiparallel beta-sheet. LrpA forms a homodimer mainly through interactions between the beta-strands of this C-terminal domain, and an octamer through further interactions between the second alpha-helix and fourth beta-strand of the motif. Hence, the C-terminal domain of Lrp-like proteins appears to be involved in ligand-response and activation [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular; PDB: 2DJW_F 2GQQ_A 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2CG4_B 2DBB_B 1I1G_A ....
>COG5470 Uncharacterized conserved protein [Function unknown]
This model represents a small family of proteins of unknown function, each about 105 amino acids in length. Conserved sites in the multiple alignment include a pair of aromatic residues, a histidine, and an aspartate.
>COG3224 Uncharacterized protein conserved in bacteria [Function unknown]
>PF07110 EthD: EthD domain; InterPro: IPR009799 This family consists of several bacterial sequences which are related to the EthD protein of Rhodococcus ruber (Q93EX2 from SWISSPROT)
R. ruber (formerly Gordonia terrae) IFP 2001 is one of a few bacterial strains able to degrade ethyl tert-butyl ether (ETBE), which is a major pollutant from gasoline. This strain was found to undergo a spontaneous 14.3-kbp chromosomal deletion, which results in the loss of the ability to degrade ETBE. Sequence analysis of the region corresponding to the deletion revealed the presence of a gene cluster, ethABCD, encoding a ferredoxin reductase (EthA), a cytochrome P-450 (EthB), a ferredoxin (EthC), and a 10kDa protein of unknown function (EthD), respectively. Upstream of ethABCD lies ethR, which codes for a putative positive transcriptional regulator of the AraC/XylS family. Transformation of the ETBE-negative mutant by a plasmid carrying the ethRABCD genes restored the ability to degrade ETBE. Complementation was abolished if the plasmid carried ethRABC only demonstrating that EthD is essential for the ETBE degradation system [].; PDB: 3BF4_B 2FTR_A.
Boiling Stable Protein Isolated From Populus Tremul
1e-07
>pdb|1Q53|A Chain A, Solution Structure Of Hypothetical Arabidopsis Thaliana Protein At3g17210. Center For Eukaryotic Structural Genomics Target 13081 Length = 112
>pdb|1RJJ|A Chain A, Solution Structure Of A Homodimeric Hypothetical Protein, At5g22580, A Structural Genomics Target From Arabidopsis Thaliana Length = 111
Ferredoxin-like protein of unknown function; ferre
1e-13
3fmb_A
118
Dimeric protein of unknown function and ferredoxi
8e-12
3bn7_A
120
Ferredoxin-like protein; stress responsive A/B bar
7e-11
3bde_A
120
MLL5499 protein; stress responsive A/B barrel doma
1e-10
>1q4r_A Protein AT3G17210; center for eukaryotic structural genom structural genomics, protein structure initiative, CESG, UN function; 1.90A {Arabidopsis thaliana} SCOP: d.58.4.4 PDB: 1q53_A 2q3p_A Length = 112
>1q4r_A Protein AT3G17210; center for eukaryotic structural genom structural genomics, protein structure initiative, CESG, UN function; 1.90A {Arabidopsis thaliana} SCOP: d.58.4.4 PDB: 1q53_A 2q3p_A
>3fmb_A Dimeric protein of unknown function and ferredoxi fold; YP_212648.1, stress responsive A/B barrel domain; HET: MSE; 1.85A {Bacteroides fragilis}
>3bm7_A Protein of unknown function with ferredoxin-like; ferredoxin-like fold, antibiotic biosynthesis monooxygenase, structural genomics; HET: MSE; 1.35A {Caulobacter crescentus}
>2bbe_A Hypothetical protein SO0527; MCSG, structural genomics, PSI, protein structure in midwest center for structural genomics; 1.97A {Shewanella oneidensis}
>4dn9_A Antibiotic biosynthesis monooxygenase; structural genomics,protein structure initiative, NEW YORK S genomix research consortium, nysgrc; 2.05A {Chloroflexus aurantiacus}
>3f44_A Putative monooxygenase; YP_193413.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.55A {Lactobacillus acidophilus ncfm}
>3f44_A Putative monooxygenase; YP_193413.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.55A {Lactobacillus acidophilus ncfm}
