Citrus Sinensis ID: 034926
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 78 | ||||||
| 449466075 | 100 | PREDICTED: small ubiquitin-related modif | 0.846 | 0.66 | 0.954 | 4e-30 | |
| 224131676 | 103 | predicted protein [Populus trichocarpa] | 0.846 | 0.640 | 0.939 | 9e-30 | |
| 224064888 | 103 | predicted protein [Populus trichocarpa] | 0.846 | 0.640 | 0.924 | 3e-29 | |
| 224064886 | 105 | predicted protein [Populus trichocarpa] | 0.846 | 0.628 | 0.909 | 2e-28 | |
| 449463252 | 100 | PREDICTED: small ubiquitin-related modif | 0.820 | 0.64 | 0.924 | 2e-27 | |
| 225447135 | 101 | PREDICTED: uncharacterized protein LOC10 | 0.846 | 0.653 | 0.880 | 8e-27 | |
| 255577173 | 99 | conserved hypothetical protein [Ricinus | 0.820 | 0.646 | 0.910 | 4e-26 | |
| 351722771 | 99 | uncharacterized protein LOC100500241 [Gl | 0.833 | 0.656 | 0.863 | 3e-25 | |
| 147862318 | 104 | hypothetical protein VITISV_032072 [Viti | 0.833 | 0.625 | 0.830 | 7e-25 | |
| 225470236 | 103 | PREDICTED: small ubiquitin-related modif | 0.833 | 0.631 | 0.830 | 8e-25 |
| >gi|449466075|ref|XP_004150752.1| PREDICTED: small ubiquitin-related modifier 2-like [Cucumis sativus] gi|449505442|ref|XP_004162471.1| PREDICTED: small ubiquitin-related modifier 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Score = 135 bits (339), Expect = 4e-30, Method: Compositional matrix adjust.
Identities = 63/66 (95%), Positives = 65/66 (98%)
Query: 1 MSGVTNTPQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELN 60
MSGVTNT QEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSV+LN
Sbjct: 1 MSGVTNTQQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDLN 60
Query: 61 SIAFLY 66
SIAFL+
Sbjct: 61 SIAFLF 66
|
Source: Cucumis sativus Species: Cucumis sativus Genus: Cucumis Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224131676|ref|XP_002321150.1| predicted protein [Populus trichocarpa] gi|222861923|gb|EEE99465.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224064888|ref|XP_002301601.1| predicted protein [Populus trichocarpa] gi|222843327|gb|EEE80874.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224064886|ref|XP_002301600.1| predicted protein [Populus trichocarpa] gi|222843326|gb|EEE80873.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449463252|ref|XP_004149348.1| PREDICTED: small ubiquitin-related modifier 2-like [Cucumis sativus] gi|449503205|ref|XP_004161886.1| PREDICTED: small ubiquitin-related modifier 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|225447135|ref|XP_002274949.1| PREDICTED: uncharacterized protein LOC100267064 [Vitis vinifera] gi|297739210|emb|CBI28861.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255577173|ref|XP_002529470.1| conserved hypothetical protein [Ricinus communis] gi|223531086|gb|EEF32936.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|351722771|ref|NP_001235208.1| uncharacterized protein LOC100500241 [Glycine max] gi|255629810|gb|ACU15255.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|147862318|emb|CAN79327.1| hypothetical protein VITISV_032072 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225470236|ref|XP_002262911.1| PREDICTED: small ubiquitin-related modifier 2 [Vitis vinifera] gi|296090483|emb|CBI40814.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 78 | ||||||
| TAIR|locus:2116332 | 100 | SUMO1 "AT4G26840" [Arabidopsis | 0.743 | 0.58 | 0.896 | 8.7e-24 | |
| TAIR|locus:2161675 | 116 | SUMO2 "small ubiquitin-like mo | 0.743 | 0.5 | 0.739 | 1.2e-19 | |
| POMBASE|SPBC365.06 | 117 | pmt3 "SUMO" [Schizosaccharomyc | 0.756 | 0.504 | 0.524 | 1.9e-12 | |
| TAIR|locus:2161695 | 111 | SUMO3 "small ubiquitin-like mo | 0.782 | 0.549 | 0.475 | 5e-12 | |
| UNIPROTKB|Q5ZHQ1 | 94 | SUMO3 "Small ubiquitin-related | 0.717 | 0.595 | 0.542 | 7.4e-11 | |
| UNIPROTKB|Q17QV3 | 104 | SUMO3 "Small ubiquitin-related | 0.717 | 0.538 | 0.542 | 7.4e-11 | |
| UNIPROTKB|A8MU27 | 147 | SUMO3 "Small ubiquitin-related | 0.717 | 0.380 | 0.542 | 7.4e-11 | |
| UNIPROTKB|A8MUA9 | 135 | SUMO3 "Small ubiquitin-related | 0.717 | 0.414 | 0.542 | 7.4e-11 | |
| UNIPROTKB|P55854 | 103 | SUMO3 "Small ubiquitin-related | 0.717 | 0.543 | 0.542 | 7.4e-11 | |
| UNIPROTKB|I3LLG3 | 104 | SUMO3 "Uncharacterized protein | 0.717 | 0.538 | 0.542 | 7.4e-11 |
| TAIR|locus:2116332 SUMO1 "AT4G26840" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 273 (101.2 bits), Expect = 8.7e-24, P = 8.7e-24
Identities = 52/58 (89%), Positives = 55/58 (94%)
Query: 9 QEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLY 66
QEEDKKP D AHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSV++NSIAFL+
Sbjct: 5 QEEDKKPGDGGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDMNSIAFLF 62
|
|
| TAIR|locus:2161675 SUMO2 "small ubiquitin-like modifier 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBC365.06 pmt3 "SUMO" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2161695 SUMO3 "small ubiquitin-like modifier 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZHQ1 SUMO3 "Small ubiquitin-related modifier 3" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q17QV3 SUMO3 "Small ubiquitin-related modifier 3" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A8MU27 SUMO3 "Small ubiquitin-related modifier 3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A8MUA9 SUMO3 "Small ubiquitin-related modifier 3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P55854 SUMO3 "Small ubiquitin-related modifier 3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LLG3 SUMO3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_fgenesh4_pm.C_LG_XIV0441 | hypothetical protein (103 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 78 | |||
| cd01763 | 87 | cd01763, Sumo, Small ubiquitin-related modifier (S | 2e-28 | |
| COG5227 | 103 | COG5227, SMT3, Ubiquitin-like protein (sentrin) [P | 3e-16 | |
| pfam11976 | 72 | pfam11976, Rad60-SLD, Ubiquitin-2 like Rad60 SUMO- | 1e-12 | |
| smart00213 | 72 | smart00213, UBQ, Ubiquitin homologues | 7e-07 | |
| pfam00240 | 69 | pfam00240, ubiquitin, Ubiquitin family | 0.004 |
| >gnl|CDD|176359 cd01763, Sumo, Small ubiquitin-related modifier (SUMO) | Back alignment and domain information |
|---|
Score = 96.9 bits (242), Expect = 2e-28
Identities = 37/56 (66%), Positives = 43/56 (76%)
Query: 11 EDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLY 66
E + S HINLKVKGQDGNEVFF+IKRST LKKLM AYC RQ + +NS+ FL+
Sbjct: 1 EKSGKGEISEHINLKVKGQDGNEVFFKIKRSTPLKKLMEAYCQRQGLSMNSVRFLF 56
|
Small ubiquitin-related modifier (SUMO) proteins are conjugated to numerous intracellular targets and serve to modulate protein interaction, localization, activity or stability. SUMO (also known as "Smt3" and "sentrin" in other organisms) is linked to several different pathways, including nucleocytoplasmic transport. Attachment of SUMO to targets proteins is stimulated by PIAS (Protein inhibitor of activated STATs) proteins which serve as E3-like ligases. Length = 87 |
| >gnl|CDD|227552 COG5227, SMT3, Ubiquitin-like protein (sentrin) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|192903 pfam11976, Rad60-SLD, Ubiquitin-2 like Rad60 SUMO-like | Back alignment and domain information |
|---|
| >gnl|CDD|214563 smart00213, UBQ, Ubiquitin homologues | Back alignment and domain information |
|---|
| >gnl|CDD|215813 pfam00240, ubiquitin, Ubiquitin family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 78 | |||
| KOG1769 | 99 | consensus Ubiquitin-like proteins [Posttranslation | 99.94 | |
| COG5227 | 103 | SMT3 Ubiquitin-like protein (sentrin) [Posttransla | 99.91 | |
| cd01763 | 87 | Sumo Small ubiquitin-related modifier (SUMO). Smal | 99.7 | |
| PF11976 | 72 | Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter | 99.6 | |
| cd01806 | 76 | Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn | 98.38 | |
| cd01809 | 72 | Scythe_N Ubiquitin-like domain of Scythe protein. | 98.04 | |
| smart00213 | 64 | UBQ Ubiquitin homologues. Ubiquitin-mediated prote | 97.83 | |
| cd01812 | 71 | BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter | 97.6 | |
| cd01807 | 74 | GDX_N ubiquitin-like domain of GDX. GDX contains a | 97.56 | |
| cd01803 | 76 | Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 | 97.55 | |
| PTZ00044 | 76 | ubiquitin; Provisional | 97.52 | |
| cd01769 | 69 | UBL Ubiquitin-like domain of UBL. UBLs function by | 97.48 | |
| PF11470 | 65 | TUG-UBL1: GLUT4 regulating protein TUG; InterPro: | 97.44 | |
| cd01798 | 70 | parkin_N amino-terminal ubiquitin-like of parkin p | 97.41 | |
| PF00240 | 69 | ubiquitin: Ubiquitin family; InterPro: IPR000626 U | 97.31 | |
| cd01805 | 77 | RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo | 97.18 | |
| cd01791 | 73 | Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know | 97.15 | |
| cd01804 | 78 | midnolin_N Ubiquitin-like domain of midnolin. midn | 97.03 | |
| cd00196 | 69 | UBQ Ubiquitin-like proteins. Ubiquitin homologs; I | 96.97 | |
| cd01792 | 80 | ISG15_repeat1 ISG15 ubiquitin-like protein, first | 96.8 | |
| cd01810 | 74 | ISG15_repeat2 ISG15 ubiquitin-like protein, second | 96.77 | |
| cd01808 | 71 | hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC | 96.59 | |
| cd01802 | 103 | AN1_N ubiquitin-like domain of AN1. AN1 (also know | 96.55 | |
| cd01794 | 70 | DC_UbP_C dendritic cell derived ubiquitin-like pro | 96.22 | |
| cd01796 | 71 | DDI1_N DNA damage inducible protein 1 ubiquitin-li | 96.11 | |
| cd06409 | 86 | PB1_MUG70 The MUG70 protein is a product of the me | 96.1 | |
| cd01793 | 74 | Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui | 96.06 | |
| cd01797 | 78 | NIRF_N amino-terminal ubiquitin-like domain of Np9 | 95.51 | |
| cd01799 | 75 | Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO | 95.09 | |
| smart00455 | 70 | RBD Raf-like Ras-binding domain. | 94.31 | |
| TIGR00601 | 378 | rad23 UV excision repair protein Rad23. All protei | 94.08 | |
| smart00666 | 81 | PB1 PB1 domain. Phox and Bem1p domain, present in | 93.96 | |
| cd01790 | 79 | Herp_N Homocysteine-responsive endoplasmic reticul | 93.74 | |
| PF11543 | 80 | UN_NPL4: Nuclear pore localisation protein NPL4; I | 93.49 | |
| cd06407 | 82 | PB1_NLP A PB1 domain is present in NIN like protei | 92.53 | |
| PF02196 | 71 | RBD: Raf-like Ras-binding domain; InterPro: IPR003 | 92.19 | |
| cd01800 | 76 | SF3a120_C Ubiquitin-like domain of Mammalian splic | 92.02 | |
| KOG0005 | 70 | consensus Ubiquitin-like protein [Cell cycle contr | 91.97 | |
| cd01777 | 87 | SNX27_RA Ubiquitin domain of SNX27 (sorting nexin | 91.92 | |
| PF00564 | 84 | PB1: PB1 domain; InterPro: IPR000270 The Phox and | 91.89 | |
| KOG0010 | 493 | consensus Ubiquitin-like protein [Posttranslationa | 91.85 | |
| KOG0006 | 446 | consensus E3 ubiquitin-protein ligase (Parkin prot | 91.77 | |
| cd01760 | 72 | RBD Ubiquitin-like domain of RBD-like S/T kinases. | 90.93 | |
| cd06396 | 81 | PB1_NBR1 The PB1 domain is an essential part of NB | 90.9 | |
| cd06408 | 86 | PB1_NoxR The PB1 domain is present in the Epichloe | 90.22 | |
| cd05992 | 81 | PB1 The PB1 domain is a modular domain mediating s | 89.86 | |
| cd01813 | 74 | UBP_N UBP ubiquitin processing protease. The UBP ( | 89.71 | |
| smart00295 | 207 | B41 Band 4.1 homologues. Also known as ezrin/radix | 89.58 | |
| PF00789 | 82 | UBX: UBX domain; InterPro: IPR001012 The UBX domai | 89.54 | |
| smart00166 | 80 | UBX Domain present in ubiquitin-regulatory protein | 88.68 | |
| cd01814 | 113 | NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT | 88.26 | |
| cd06406 | 80 | PB1_P67 A PB1 domain is present in p67 proteins wh | 85.34 | |
| PF09379 | 80 | FERM_N: FERM N-terminal domain ; InterPro: IPR0189 | 85.3 | |
| PF00788 | 93 | RA: Ras association (RalGDS/AF-6) domain; InterPro | 84.76 | |
| cd01789 | 84 | Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol | 84.68 | |
| cd01818 | 77 | TIAM1_RBD Ubiquitin domain of Tiam1 guanine nucleo | 83.79 | |
| PHA01623 | 56 | hypothetical protein | 83.74 | |
| PLN02560 | 308 | enoyl-CoA reductase | 81.67 |
| >KOG1769 consensus Ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.94 E-value=3.2e-27 Score=151.49 Aligned_cols=56 Identities=57% Similarity=0.861 Sum_probs=54.2
Q ss_pred CCcEEEEEEccCCCEEEEEEeCCchHHHHHHHHHhhcCCCCCeEEEEECCEeecce
Q 034926 19 SAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLYVHISAFLA 74 (78)
Q Consensus 19 ~~~I~lkV~~qdg~~v~FkIK~~t~l~KLm~aYc~r~gl~~~s~rFlfdG~rI~~~ 74 (78)
..||+|||++|+|++++|+||++|||+|||+|||+|+|+++++|||+|||+||...
T Consensus 18 ~~hi~LKV~gqd~~~~~Fkikr~t~LkKLM~aYc~r~Gl~~~s~RFlFdG~rI~~~ 73 (99)
T KOG1769|consen 18 SEHINLKVKGQDGSVVVFKIKRHTPLKKLMKAYCERQGLSMNSLRFLFDGQRIRET 73 (99)
T ss_pred cceEEEEEecCCCCEEEEEeecCChHHHHHHHHHHHcCCccceEEEEECCcCcCCC
Confidence 68999999999999999999999999999999999999999999999999999865
|
|
| >COG5227 SMT3 Ubiquitin-like protein (sentrin) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01763 Sumo Small ubiquitin-related modifier (SUMO) | Back alignment and domain information |
|---|
| >PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins | Back alignment and domain information |
|---|
| >cd01806 Nedd8 Nebb8-like ubiquitin protein | Back alignment and domain information |
|---|
| >cd01809 Scythe_N Ubiquitin-like domain of Scythe protein | Back alignment and domain information |
|---|
| >smart00213 UBQ Ubiquitin homologues | Back alignment and domain information |
|---|
| >cd01812 BAG1_N Ubiquitin-like domain of BAG1 | Back alignment and domain information |
|---|
| >cd01807 GDX_N ubiquitin-like domain of GDX | Back alignment and domain information |
|---|
| >cd01803 Ubiquitin Ubiquitin | Back alignment and domain information |
|---|
| >PTZ00044 ubiquitin; Provisional | Back alignment and domain information |
|---|
| >cd01769 UBL Ubiquitin-like domain of UBL | Back alignment and domain information |
|---|
| >PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly | Back alignment and domain information |
|---|
| >cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein | Back alignment and domain information |
|---|
| >PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade | Back alignment and domain information |
|---|
| >cd01805 RAD23_N Ubiquitin-like domain of RAD23 | Back alignment and domain information |
|---|
| >cd01791 Ubl5 UBL5 ubiquitin-like modifier | Back alignment and domain information |
|---|
| >cd01804 midnolin_N Ubiquitin-like domain of midnolin | Back alignment and domain information |
|---|
| >cd00196 UBQ Ubiquitin-like proteins | Back alignment and domain information |
|---|
| >cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 | Back alignment and domain information |
|---|
| >cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 | Back alignment and domain information |
|---|
| >cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 | Back alignment and domain information |
|---|
| >cd01802 AN1_N ubiquitin-like domain of AN1 | Back alignment and domain information |
|---|
| >cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein | Back alignment and domain information |
|---|
| >cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain | Back alignment and domain information |
|---|
| >cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain | Back alignment and domain information |
|---|
| >cd01793 Fubi Fubi ubiquitin-like protein | Back alignment and domain information |
|---|
| >cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF | Back alignment and domain information |
|---|
| >cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 | Back alignment and domain information |
|---|
| >smart00455 RBD Raf-like Ras-binding domain | Back alignment and domain information |
|---|
| >TIGR00601 rad23 UV excision repair protein Rad23 | Back alignment and domain information |
|---|
| >smart00666 PB1 PB1 domain | Back alignment and domain information |
|---|
| >cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein | Back alignment and domain information |
|---|
| >PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway | Back alignment and domain information |
|---|
| >cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium) | Back alignment and domain information |
|---|
| >PF02196 RBD: Raf-like Ras-binding domain; InterPro: IPR003116 This is the Ras-binding domain found in proteins related to Ras | Back alignment and domain information |
|---|
| >cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 | Back alignment and domain information |
|---|
| >KOG0005 consensus Ubiquitin-like protein [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01777 SNX27_RA Ubiquitin domain of SNX27 (sorting nexin protein 27) | Back alignment and domain information |
|---|
| >PF00564 PB1: PB1 domain; InterPro: IPR000270 The Phox and Bem1p domain, is present in many eukaryotic cytoplasmic signalling proteins | Back alignment and domain information |
|---|
| >KOG0010 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01760 RBD Ubiquitin-like domain of RBD-like S/T kinases | Back alignment and domain information |
|---|
| >cd06396 PB1_NBR1 The PB1 domain is an essential part of NBR1 protein, next to BRCA1, a scaffold protein mediating specific protein-protein interaction with both titin protein kinase and with another scaffold protein p62 | Back alignment and domain information |
|---|
| >cd06408 PB1_NoxR The PB1 domain is present in the Epichloe festucae NoxR protein (NADPH oxidase regulator), a key regulator of NADPH oxidase isoform, NoxA | Back alignment and domain information |
|---|
| >cd05992 PB1 The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity | Back alignment and domain information |
|---|
| >cd01813 UBP_N UBP ubiquitin processing protease | Back alignment and domain information |
|---|
| >smart00295 B41 Band 4 | Back alignment and domain information |
|---|
| >PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast | Back alignment and domain information |
|---|
| >smart00166 UBX Domain present in ubiquitin-regulatory proteins | Back alignment and domain information |
|---|
| >cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4 | Back alignment and domain information |
|---|
| >cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of NADPH oxidase during phagocytosis | Back alignment and domain information |
|---|
| >PF09379 FERM_N: FERM N-terminal domain ; InterPro: IPR018979 This domain is the N-terminal ubiquitin-like structural domain of the FERM domain | Back alignment and domain information |
|---|
| >PF00788 RA: Ras association (RalGDS/AF-6) domain; InterPro: IPR000159 Proteins with this domain are mostly RasGTP effectors and include guanine-nucleotide releasing factor in mammals [] | Back alignment and domain information |
|---|
| >cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B | Back alignment and domain information |
|---|
| >cd01818 TIAM1_RBD Ubiquitin domain of Tiam1 guanine nucleotide exchange factor | Back alignment and domain information |
|---|
| >PHA01623 hypothetical protein | Back alignment and domain information |
|---|
| >PLN02560 enoyl-CoA reductase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 78 | ||||
| 1a5r_A | 103 | Structure Determination Of The Small Ubiquitin-Rela | 9e-11 | ||
| 3kyd_D | 115 | Human Sumo E1~sumo1-amp Tetrahedral Intermediate Mi | 1e-10 | ||
| 2kqs_A | 99 | Phosphorylation Of Sumo-Interacting Motif By Ck2 En | 1e-10 | ||
| 1y8r_C | 97 | Sumo E1 Activating Enzyme Sae1-Sae2-Sumo1-Mg-Atp Co | 1e-10 | ||
| 3kyc_D | 97 | Human Sumo E1 Complex With A Sumo1-Amp Mimic Length | 1e-10 | ||
| 1wz0_A | 104 | Solution Structure Of Human Sumo-2 (Smt3b), A Ubiqu | 1e-10 | ||
| 2awt_A | 95 | Solution Structure Of Human Small Ubiquitin-Like Mo | 2e-10 | ||
| 2d07_B | 93 | Crystal Structure Of Sumo-3-Modified Thymine-Dna Gl | 2e-10 | ||
| 2io1_B | 94 | Crystal Structure Of Human Senp2 In Complex With Pr | 2e-10 | ||
| 2io3_B | 81 | Crystal Structure Of Human Senp2 In Complex With Ra | 2e-10 | ||
| 1wm3_A | 72 | Crystal Structure Of Human Sumo-2 Protein Length = | 3e-10 | ||
| 2io0_B | 91 | Crystal Structure Of Human Senp2 In Complex With Pr | 3e-10 | ||
| 2ckh_B | 79 | Senp1-sumo2 Complex Length = 79 | 3e-10 | ||
| 3uin_B | 80 | Complex Between Human Rangap1-Sumo2, Ubc9 And The I | 3e-10 | ||
| 2iyd_B | 81 | Senp1 Covalent Complex With Sumo-2 Length = 81 | 3e-10 | ||
| 1wm2_A | 78 | Crystal Structure Of Human Sumo-2 Protein Length = | 3e-10 | ||
| 2k1f_A | 88 | Sumo-3 From Drosophila Melanogaster (Dsmt3) Length | 3e-10 | ||
| 3rzw_C | 99 | Crystal Structure Of The Monobody Ysmb-9 Bound To H | 1e-09 | ||
| 1z5s_B | 82 | Crystal Structure Of A Complex Between Ubc9, Sumo-1 | 2e-09 | ||
| 1tgz_B | 80 | Structure Of Human Senp2 In Complex With Sumo-1 Len | 2e-09 | ||
| 2iy0_B | 82 | Senp1 (Mutant) Sumo1 Rangap Length = 82 | 2e-09 | ||
| 2iy1_B | 83 | Senp1 (Mutant) Full Length Sumo1 Length = 83 | 2e-09 | ||
| 2uyz_B | 79 | Non-Covalent Complex Between Ubc9 And Sumo1 Length | 3e-09 | ||
| 2g4d_B | 78 | Crystal Structure Of Human Senp1 Mutant (C603s) In | 3e-09 | ||
| 2bf8_B | 77 | Crystal Structure Of Sumo Modified Ubiquitin Conjug | 3e-09 | ||
| 1u4a_A | 87 | Solution Structure Of Human Sumo-3 C47s Length = 87 | 4e-09 | ||
| 2k8h_A | 110 | Solution Structure Of Sumo From Trypanosoma Brucei | 1e-08 | ||
| 3uqb_A | 209 | Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C | 1e-08 | ||
| 4ggq_C | 209 | Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C | 1e-08 | ||
| 3vaw_A | 209 | Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C | 1e-08 | ||
| 3uqa_A | 209 | Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C | 1e-08 | ||
| 3uf8_A | 209 | Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C | 2e-08 | ||
| 3pge_A | 200 | Structure Of Sumoylated Pcna Length = 200 | 2e-08 | ||
| 2eke_C | 106 | Structure Of A Sumo-Binding-Motif Mimic Bound To Sm | 2e-08 | ||
| 3qht_A | 98 | Crystal Structure Of The Monobody Ysmb-1 Bound To Y | 2e-08 | ||
| 3tix_A | 207 | Crystal Structure Of The Chp1-Tas3 Complex Core Len | 3e-08 | ||
| 1l2n_A | 101 | Smt3 Solution Structure Length = 101 | 3e-08 | ||
| 1euv_B | 86 | X-Ray Structure Of The C-Terminal Ulp1 Protease Dom | 3e-08 | ||
| 3v60_A | 84 | Structure Of S. Cerevisiae Pcna Conjugated To Sumo | 4e-08 | ||
| 4da1_A | 389 | Crystal Structure Of Branched-Chain Alpha-Ketoacid | 5e-08 | ||
| 3v7o_A | 227 | Crystal Structure Of The C-Terminal Domain Of Ebola | 6e-08 | ||
| 3ix6_A | 360 | Crystal Structure Of Thymidylate Synthase Thya From | 7e-08 | ||
| 3v62_A | 84 | Structure Of The S. Cerevisiae Srs2 C-Terminal Doma | 2e-06 |
| >pdb|1A5R|A Chain A, Structure Determination Of The Small Ubiquitin-Related Modifier Sumo-1, Nmr, 10 Structures Length = 103 | Back alignment and structure |
|
| >pdb|3KYD|D Chain D, Human Sumo E1~sumo1-amp Tetrahedral Intermediate Mimic Length = 115 | Back alignment and structure |
| >pdb|2KQS|A Chain A, Phosphorylation Of Sumo-Interacting Motif By Ck2 Enhances Daxx Sumo Binding Activity Length = 99 | Back alignment and structure |
| >pdb|1Y8R|C Chain C, Sumo E1 Activating Enzyme Sae1-Sae2-Sumo1-Mg-Atp Complex Length = 97 | Back alignment and structure |
| >pdb|3KYC|D Chain D, Human Sumo E1 Complex With A Sumo1-Amp Mimic Length = 97 | Back alignment and structure |
| >pdb|1WZ0|A Chain A, Solution Structure Of Human Sumo-2 (Smt3b), A Ubiquitin- Like Protein Length = 104 | Back alignment and structure |
| >pdb|2AWT|A Chain A, Solution Structure Of Human Small Ubiquitin-Like Modifier Protein Isoform 2 (Sumo-2) Length = 95 | Back alignment and structure |
| >pdb|2D07|B Chain B, Crystal Structure Of Sumo-3-Modified Thymine-Dna Glycosylase Length = 93 | Back alignment and structure |
| >pdb|2IO1|B Chain B, Crystal Structure Of Human Senp2 In Complex With Presumo-3 Length = 94 | Back alignment and structure |
| >pdb|2IO3|B Chain B, Crystal Structure Of Human Senp2 In Complex With Rangap1- Sumo-2 Length = 81 | Back alignment and structure |
| >pdb|1WM3|A Chain A, Crystal Structure Of Human Sumo-2 Protein Length = 72 | Back alignment and structure |
| >pdb|2IO0|B Chain B, Crystal Structure Of Human Senp2 In Complex With Presumo-2 Length = 91 | Back alignment and structure |
| >pdb|2CKH|B Chain B, Senp1-sumo2 Complex Length = 79 | Back alignment and structure |
| >pdb|3UIN|B Chain B, Complex Between Human Rangap1-Sumo2, Ubc9 And The Ir1 Domain From Ranbp2 Length = 80 | Back alignment and structure |
| >pdb|2IYD|B Chain B, Senp1 Covalent Complex With Sumo-2 Length = 81 | Back alignment and structure |
| >pdb|1WM2|A Chain A, Crystal Structure Of Human Sumo-2 Protein Length = 78 | Back alignment and structure |
| >pdb|2K1F|A Chain A, Sumo-3 From Drosophila Melanogaster (Dsmt3) Length = 88 | Back alignment and structure |
| >pdb|3RZW|C Chain C, Crystal Structure Of The Monobody Ysmb-9 Bound To Human Sumo1 Length = 99 | Back alignment and structure |
| >pdb|1Z5S|B Chain B, Crystal Structure Of A Complex Between Ubc9, Sumo-1, Rangap1 And Nup358RANBP2 Length = 82 | Back alignment and structure |
| >pdb|1TGZ|B Chain B, Structure Of Human Senp2 In Complex With Sumo-1 Length = 80 | Back alignment and structure |
| >pdb|2IY0|B Chain B, Senp1 (Mutant) Sumo1 Rangap Length = 82 | Back alignment and structure |
| >pdb|2IY1|B Chain B, Senp1 (Mutant) Full Length Sumo1 Length = 83 | Back alignment and structure |
| >pdb|2UYZ|B Chain B, Non-Covalent Complex Between Ubc9 And Sumo1 Length = 79 | Back alignment and structure |
| >pdb|2G4D|B Chain B, Crystal Structure Of Human Senp1 Mutant (C603s) In Complex With Sumo-1 Length = 78 | Back alignment and structure |
| >pdb|2BF8|B Chain B, Crystal Structure Of Sumo Modified Ubiquitin Conjugating Enzyme E2-25k Length = 77 | Back alignment and structure |
| >pdb|1U4A|A Chain A, Solution Structure Of Human Sumo-3 C47s Length = 87 | Back alignment and structure |
| >pdb|2K8H|A Chain A, Solution Structure Of Sumo From Trypanosoma Brucei Length = 110 | Back alignment and structure |
| >pdb|3UQB|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation D44g From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 | Back alignment and structure |
| >pdb|4GGQ|C Chain C, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Complexed With Cj40 Length = 209 | Back alignment and structure |
| >pdb|3VAW|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation V3i From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 | Back alignment and structure |
| >pdb|3UQA|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation A54e From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 | Back alignment and structure |
| >pdb|3UF8|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With A G95a Surface Mutation From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 | Back alignment and structure |
| >pdb|3PGE|A Chain A, Structure Of Sumoylated Pcna Length = 200 | Back alignment and structure |
| >pdb|2EKE|C Chain C, Structure Of A Sumo-Binding-Motif Mimic Bound To Smt3p- Ubc9p: Conservation Of A Noncovalent Ubiquitin-Like Protein-E2 Complex As A Platform For Selective Interactions Within A Sumo Pathway Length = 106 | Back alignment and structure |
| >pdb|3QHT|A Chain A, Crystal Structure Of The Monobody Ysmb-1 Bound To Yeast Sumo Length = 98 | Back alignment and structure |
| >pdb|3TIX|A Chain A, Crystal Structure Of The Chp1-Tas3 Complex Core Length = 207 | Back alignment and structure |
| >pdb|1L2N|A Chain A, Smt3 Solution Structure Length = 101 | Back alignment and structure |
| >pdb|1EUV|B Chain B, X-Ray Structure Of The C-Terminal Ulp1 Protease Domain In Complex With Smt3, The Yeast Ortholog Of Sumo Length = 86 | Back alignment and structure |
| >pdb|3V60|A Chain A, Structure Of S. Cerevisiae Pcna Conjugated To Sumo On Lysine 164 Length = 84 | Back alignment and structure |
| >pdb|4DA1|A Chain A, Crystal Structure Of Branched-Chain Alpha-Ketoacid Dehydrogenase Phosphatase With Mg (Ii) Ions At The Active Site Length = 389 | Back alignment and structure |
| >pdb|3V7O|A Chain A, Crystal Structure Of The C-Terminal Domain Of Ebola Virus Vp30 (Strain Reston-89) Length = 227 | Back alignment and structure |
| >pdb|3IX6|A Chain A, Crystal Structure Of Thymidylate Synthase Thya From Brucella Melitensis Length = 360 | Back alignment and structure |
| >pdb|3V62|A Chain A, Structure Of The S. Cerevisiae Srs2 C-Terminal Domain In Complex With Pcna Conjugated To Sumo On Lysine 164 Length = 84 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 78 | |||
| 1wyw_B | 97 | Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho | 2e-23 | |
| 3kyd_D | 115 | Small ubiquitin-related modifier 1; SUMO, thioeste | 3e-22 | |
| 1wz0_A | 104 | Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li | 2e-21 | |
| 2d07_B | 93 | Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho | 5e-21 | |
| 2k8h_A | 110 | Small ubiquitin protein; SUMO, post-translational | 6e-21 | |
| 2eke_C | 106 | Ubiquitin-like protein SMT3; UBC9, SUMO binding mo | 1e-20 | |
| 3v7o_A | 227 | Minor nucleoprotein VP30; ssgcid, seattle structur | 2e-20 | |
| 2jxx_A | 97 | Nfatc2-interacting protein; nuclear factor of acti | 2e-20 | |
| 2io1_B | 94 | Small ubiquitin-related modifier 3 precursor; SUMO | 4e-20 | |
| 3tix_A | 207 | Ubiquitin-like protein SMT3, RNA-induced transcri | 4e-20 | |
| 1wm3_A | 72 | Ubiquitin-like protein SMT3B; ubiquitin fold, half | 6e-20 | |
| 2uyz_B | 79 | Small ubiquitin-related modifier 1; sumoylation, c | 9e-20 | |
| 2io0_B | 91 | Small ubiquitin-related modifier 2 precursor; SUMO | 2e-19 | |
| 3a4r_A | 79 | Nfatc2-interacting protein; ubiquitin fold, coiled | 2e-18 | |
| 3pge_A | 200 | SUMO-modified proliferating cell nuclear antigen; | 1e-15 | |
| 2l76_A | 95 | Nfatc2-interacting protein; ubiquitin-like domain, | 2e-10 |
| >1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Length = 97 | Back alignment and structure |
|---|
Score = 84.2 bits (208), Expect = 2e-23
Identities = 29/66 (43%), Positives = 40/66 (60%)
Query: 1 MSGVTNTPQEEDKKPNDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELN 60
MS P ED + +I LKV GQD +E+ F++K +T LKKL +YC RQ V +N
Sbjct: 1 MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMN 60
Query: 61 SIAFLY 66
S+ FL+
Sbjct: 61 SLRFLF 66
|
| >3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 104 | Back alignment and structure |
|---|
| >2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Length = 93 | Back alignment and structure |
|---|
| >2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Length = 110 | Back alignment and structure |
|---|
| >2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 Length = 106 | Back alignment and structure |
|---|
| >3v7o_A Minor nucleoprotein VP30; ssgcid, seattle structural genomics center for infectious disease, SMT, transcription; 2.25A {Reston ebolavirus} Length = 227 | Back alignment and structure |
|---|
| >2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Length = 94 | Back alignment and structure |
|---|
| >3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} Length = 207 | Back alignment and structure |
|---|
| >1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Length = 72 | Back alignment and structure |
|---|
| >2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Length = 79 | Back alignment and structure |
|---|
| >2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Length = 91 | Back alignment and structure |
|---|
| >3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Length = 79 | Back alignment and structure |
|---|
| >3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} Length = 200 | Back alignment and structure |
|---|
| >2l76_A Nfatc2-interacting protein; ubiquitin-like domain, structural genomics, PSI-biology, Pro structure initiative; NMR {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 78 | |||
| 2l76_A | 95 | Nfatc2-interacting protein; ubiquitin-like domain, | 99.91 | |
| 3kyd_D | 115 | Small ubiquitin-related modifier 1; SUMO, thioeste | 99.91 | |
| 2jxx_A | 97 | Nfatc2-interacting protein; nuclear factor of acti | 99.86 | |
| 3pge_A | 200 | SUMO-modified proliferating cell nuclear antigen; | 99.86 | |
| 3tix_A | 207 | Ubiquitin-like protein SMT3, RNA-induced transcri | 99.85 | |
| 2k8h_A | 110 | Small ubiquitin protein; SUMO, post-translational | 99.84 | |
| 2d07_B | 93 | Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho | 99.84 | |
| 2eke_C | 106 | Ubiquitin-like protein SMT3; UBC9, SUMO binding mo | 99.83 | |
| 1wm3_A | 72 | Ubiquitin-like protein SMT3B; ubiquitin fold, half | 99.82 | |
| 1wz0_A | 104 | Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li | 99.82 | |
| 3uf8_A | 209 | Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- | 99.82 | |
| 2io0_B | 91 | Small ubiquitin-related modifier 2 precursor; SUMO | 99.82 | |
| 3a4r_A | 79 | Nfatc2-interacting protein; ubiquitin fold, coiled | 99.81 | |
| 3v7o_A | 227 | Minor nucleoprotein VP30; ssgcid, seattle structur | 99.8 | |
| 2io1_B | 94 | Small ubiquitin-related modifier 3 precursor; SUMO | 99.79 | |
| 4da1_A | 389 | Protein phosphatase 1K, mitochondrial; metal-ION-a | 99.72 | |
| 3ix6_A | 360 | TS, tsase, thymidylate synthase; niaid, ssgcid, se | 99.7 | |
| 3goe_A | 82 | DNA repair protein RAD60; SUMO-like domain, sumoyl | 99.55 | |
| 1wyw_B | 97 | Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho | 99.47 | |
| 2uyz_B | 79 | Small ubiquitin-related modifier 1; sumoylation, c | 99.14 | |
| 3dbh_I | 88 | NEDD8; cell cycle, activating enzyme, apoptosis, m | 98.25 | |
| 4hcn_B | 98 | Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas | 98.18 | |
| 1ttn_A | 106 | DC-UBP, dendritic cell-derived ubiquitin-like prot | 98.16 | |
| 3n3k_B | 85 | Ubiquitin; hydrolase, protease, thiol protease, DU | 98.15 | |
| 1wh3_A | 87 | 59 kDa 2'-5'-oligoadenylate synthetase like protei | 98.13 | |
| 3mtn_B | 85 | UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit | 98.12 | |
| 3v6c_B | 91 | Ubiquitin; structural genomics, structural genomic | 98.12 | |
| 1ndd_A | 76 | NEDD8, protein (ubiquitin-like protein NEDD8); pro | 98.08 | |
| 3phx_B | 79 | Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu | 98.06 | |
| 3vdz_A | 111 | Ubiquitin-40S ribosomal protein S27A; gadolinium, | 98.05 | |
| 1j8c_A | 125 | Ubiquitin-like protein hplic-2; ubiquitin-like dom | 98.03 | |
| 4dwf_A | 90 | HLA-B-associated transcript 3; ubiquitin-like doma | 98.03 | |
| 3a9j_A | 76 | Ubiquitin; protein complex, cytoplasm, isopeptide | 98.01 | |
| 2dzi_A | 81 | Ubiquitin-like protein 4A; GDX, structural genomic | 97.95 | |
| 2hj8_A | 88 | Interferon-induced 17 kDa protein; HR2873B, human | 97.91 | |
| 3k9o_B | 96 | Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b | 97.91 | |
| 2bwf_A | 77 | Ubiquitin-like protein DSK2; signaling protein, UB | 97.87 | |
| 2ojr_A | 111 | Ubiquitin; lanthide-binding TAG, terbium, TB, SAD | 97.87 | |
| 1yx5_B | 98 | Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s | 97.82 | |
| 1wx8_A | 96 | Riken cDNA 4931431F19; ubiquitin-like domain, ubiq | 97.79 | |
| 4eew_A | 88 | Large proline-rich protein BAG6; ubiquitin-like fo | 97.79 | |
| 1wx7_A | 106 | Ubiquilin 3; ubiquitin-like domain, structural gen | 97.74 | |
| 2faz_A | 78 | Ubiquitin-like containing PHD and ring finger DOM | 97.72 | |
| 3u30_A | 172 | Ubiquitin, linear DI-ubiquitin; immune system; 2.4 | 97.72 | |
| 1wy8_A | 89 | NP95-like ring finger protein, isoform A; ubiquiti | 97.68 | |
| 1sif_A | 88 | Ubiquitin; hydrophobic mutants, folding, stability | 97.64 | |
| 3b08_A | 152 | Polyubiquitin-C, ubiquitin; protein complex, signa | 97.6 | |
| 2l7r_A | 93 | Ubiquitin-like protein FUBI; structural genomics, | 97.6 | |
| 1yqb_A | 100 | Ubiquilin 3; structural genomics consortium, ubiqu | 97.6 | |
| 2klc_A | 101 | Ubiquilin-1; ubiquitin-like, structural genomics, | 97.56 | |
| 2daf_A | 118 | FLJ35834 protein; hypothetical protein FLJ35834, u | 97.54 | |
| 2al3_A | 90 | TUG long isoform; TUG UBL1 insulin, endocytosis/ex | 97.53 | |
| 4fbj_B | 88 | NEDD8; effector-HOST target complex, glutamine dea | 97.53 | |
| 2wyq_A | 85 | HHR23A, UV excision repair protein RAD23 homolog A | 97.51 | |
| 1uel_A | 95 | HHR23B, UV excision repair protein RAD23 homolog B | 97.37 | |
| 3plu_A | 93 | Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- | 97.36 | |
| 3rt3_B | 159 | Ubiquitin-like protein ISG15; ubiquitin-like domai | 97.35 | |
| 3m62_B | 106 | UV excision repair protein RAD23; armadillo-like r | 97.3 | |
| 1uh6_A | 100 | Ubiquitin-like 5; beta-grAsp fold, structural geno | 97.27 | |
| 2kk8_A | 84 | Uncharacterized protein AT4G05270; solution arabid | 97.26 | |
| 3b08_A | 152 | Polyubiquitin-C, ubiquitin; protein complex, signa | 97.25 | |
| 3b1l_X | 76 | E3 ubiquitin-protein ligase parkin; proteasome, AL | 96.3 | |
| 2kan_A | 94 | Uncharacterized protein AR3433A; ubiquitin fold, a | 97.2 | |
| 1wia_A | 95 | Hypothetical ubiquitin-like protein (riken cDNA 20 | 97.12 | |
| 2kdi_A | 114 | Ubiquitin, vacuolar protein sorting-associated pro | 97.0 | |
| 3l0w_B | 169 | Monoubiquitinated proliferating cell nuclear antig | 96.99 | |
| 3m63_B | 101 | Ubiquitin domain-containing protein DSK2; armadill | 96.97 | |
| 1we7_A | 115 | SF3A1 protein; structural genomics, ubiquitin-like | 96.88 | |
| 3q3f_A | 189 | Ribonuclease/ubiquitin chimeric protein; domain SW | 96.79 | |
| 1v86_A | 95 | DNA segment, CHR 7, wayne state university 128, ex | 96.73 | |
| 4a20_A | 98 | Ubiquitin-like protein MDY2; protein binding, GET- | 96.63 | |
| 1wgd_A | 93 | Homocysteine-responsive endoplasmic reticulum- res | 96.61 | |
| 2lxa_A | 87 | Ubiquitin-like protein MDY2; ubiquitin-like domain | 96.59 | |
| 1wxv_A | 92 | BAG-family molecular chaperone regulator-1; struct | 96.52 | |
| 1we6_A | 111 | Splicing factor, putative; structural genomics, ub | 96.46 | |
| 3u5e_m | 128 | 60S ribosomal protein L40; translation, ribosome, | 96.39 | |
| 1wju_A | 100 | NEDD8 ultimate buster-1; ubiquitin-like domain, st | 96.25 | |
| 1x1m_A | 107 | Ubiquitin-like protein SB132; structural genomics, | 96.2 | |
| 1wgh_A | 116 | Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo | 96.17 | |
| 1v5o_A | 102 | 1700011N24RIK protein; hypothetical protein, ubiqu | 96.11 | |
| 1v2y_A | 105 | 3300001G02RIK protein; hypothetical protein, ubiqu | 96.07 | |
| 3u30_A | 172 | Ubiquitin, linear DI-ubiquitin; immune system; 2.4 | 96.05 | |
| 1wgg_A | 96 | Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti | 95.98 | |
| 3u5c_f | 152 | 40S ribosomal protein S31; translation, ribosome, | 95.97 | |
| 3rt3_B | 159 | Ubiquitin-like protein ISG15; ubiquitin-like domai | 95.91 | |
| 2gow_A | 125 | HCG-1 protein, ubiquitin-like protein 3; BC059385, | 95.84 | |
| 2kd0_A | 85 | LRR repeats and ubiquitin-like domain-containing p | 95.82 | |
| 1v5t_A | 90 | 8430435I17RIK protein; hypothetical protein, ubiqu | 95.73 | |
| 2kjr_A | 95 | CG11242; UBL, ubiquitin, ubiquitin-like, structura | 95.45 | |
| 1se9_A | 126 | Ubiquitin family; ubiquitin-like, cell-free, wheat | 95.36 | |
| 3ai5_A | 307 | Yeast enhanced green fluorescent protein, ubiquit; | 95.29 | |
| 2kdb_A | 99 | Homocysteine-responsive endoplasmic reticulum- res | 95.15 | |
| 2fnj_B | 118 | Transcription elongation factor B polypeptide 2; b | 95.03 | |
| 2kj6_A | 97 | Tubulin folding cofactor B; methods development, N | 94.4 | |
| 1oqy_A | 368 | HHR23A, UV excision repair protein RAD23 homolog A | 94.13 | |
| 1t0y_A | 122 | Tubulin folding cofactor B; ubiquitin-like, cytosk | 94.09 | |
| 4dbg_A | 105 | Ranbp-type and C3HC4-type zinc finger-containing; | 94.06 | |
| 2kzr_A | 86 | Ubiquitin thioesterase OTU1; structural genomics, | 94.05 | |
| 1wf9_A | 107 | NPL4 family protein; beta-grAsp fold like domain, | 93.93 | |
| 2xzm_9 | 189 | RPS31E; ribosome, translation; 3.93A {Tetrahymena | 93.02 | |
| 1v6e_A | 95 | Cytoskeleton-associated protein 1; tubulin-specifi | 92.9 | |
| 4ajy_B | 118 | Transcription elongation factor B polypeptide 2; E | 92.78 | |
| 4efo_A | 94 | Serine/threonine-protein kinase TBK1; ubiquitin li | 92.59 | |
| 2kvr_A | 130 | Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubi | 92.48 | |
| 2cr5_A | 109 | Reproduction 8; UBX domain, D0H8S2298E protein, st | 92.25 | |
| 2daj_A | 91 | KIAA0977 protein, COBL-like 1; ubiquitin-like doma | 92.18 | |
| 2dzj_A | 88 | Synaptic glycoprotein SC2; ubiquitin-like fold, st | 90.61 | |
| 1oey_A | 83 | P67-PHOX, neutrophil cytosol factor 2; immune syst | 90.41 | |
| 1vd2_A | 89 | Protein kinase C, IOTA type; PB1 domain, OPCA moti | 90.33 | |
| 1wjn_A | 97 | Tubulin-folding protein TBCE; ubiquitin-like domai | 90.03 | |
| 2ylm_A | 530 | Ubiquitin carboxyl-terminal hydrolase 7; UBL; 2.70 | 85.84 | |
| 3qij_A | 296 | Protein 4.1; cytoskeleton, structural genomics, st | 85.45 | |
| 3shq_A | 320 | UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila | 85.45 | |
| 3ivf_A | 371 | Talin-1; FERM domain, cell membrane, cell projecti | 83.88 | |
| 1h4r_A | 314 | Merlin; FERM, neurofibromatosis, NF2, structural p | 82.57 | |
| 3qx1_A | 84 | FAS-associated factor 1; UBX, protein binding, P97 | 82.23 | |
| 1ef1_A | 294 | Moesin; membrane, FERM domain, tail domain, membra | 82.16 | |
| 2dzk_A | 109 | UBX domain-containing protein 2; ubiquitin-like fo | 81.3 |
| >2l76_A Nfatc2-interacting protein; ubiquitin-like domain, structural genomics, PSI-biology, Pro structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.91 E-value=3.3e-24 Score=135.99 Aligned_cols=57 Identities=14% Similarity=0.172 Sum_probs=53.5
Q ss_pred CCCcEEEEEEccCCCEEEEEEeCCchHHHHHHHHHhhcCCCCCeEEEEECCEeeccee
Q 034926 18 QSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLYVHISAFLAW 75 (78)
Q Consensus 18 ~~~~I~lkV~~qdg~~v~FkIK~~t~l~KLm~aYc~r~gl~~~s~rFlfdG~rI~~~~ 75 (78)
.+.+|+|||++ +|++++||||++|||+|||+|||+|+|++++++||+|||.||.++.
T Consensus 18 ~~~~IniKV~~-~g~ev~FkIK~tt~l~KL~~aYc~r~gv~~~sirFlfDG~rI~~~~ 74 (95)
T 2l76_A 18 TPRLFPLKIRC-RADLVRLPLRMSEPLQSVVDHMATHLGVSPSRILLLFGETELSPTA 74 (95)
T ss_dssp CCCCEEEEEEC-SSSEEEEEECSSSCTHHHHHHHHHHHTSCGGGEEEEETTEECCTTS
T ss_pred CCCeEEEEEEc-CCcEEEEEEecCChHHHHHHHHHhhcCCChhhEEEEECCcCCCCCC
Confidence 46789999995 8999999999999999999999999999999999999999998763
|
| >3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A | Back alignment and structure |
|---|
| >2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B | Back alignment and structure |
|---|
| >1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* | Back alignment and structure |
|---|
| >2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A | Back alignment and structure |
|---|
| >3v7o_A Minor nucleoprotein VP30; ssgcid, seattle structural genomics center for infectious disease, SMT, transcription; 2.25A {Reston ebolavirus} | Back alignment and structure |
|---|
| >2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A | Back alignment and structure |
|---|
| >3ix6_A TS, tsase, thymidylate synthase; niaid, ssgcid, seattle structural center for infectious DISE brucellosis, orchitis, epididymitis, mastitis; 2.20A {Brucella melitensis} | Back alignment and structure |
|---|
| >3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* | Back alignment and structure |
|---|
| >1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C | Back alignment and structure |
|---|
| >2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B | Back alignment and structure |
|---|
| >3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I | Back alignment and structure |
|---|
| >4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B | Back alignment and structure |
|---|
| >1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A | Back alignment and structure |
|---|
| >3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A | Back alignment and structure |
|---|
| >1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A | Back alignment and structure |
|---|
| >3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... | Back alignment and structure |
|---|
| >2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A | Back alignment and structure |
|---|
| >2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S | Back alignment and structure |
|---|
| >2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B | Back alignment and structure |
|---|
| >1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} | Back alignment and structure |
|---|
| >1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B | Back alignment and structure |
|---|
| >2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 | Back alignment and structure |
|---|
| >4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B | Back alignment and structure |
|---|
| >2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A | Back alignment and structure |
|---|
| >1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A | Back alignment and structure |
|---|
| >3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A | Back alignment and structure |
|---|
| >3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B | Back alignment and structure |
|---|
| >3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A | Back alignment and structure |
|---|
| >2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B | Back alignment and structure |
|---|
| >3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A | Back alignment and structure |
|---|
| >3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} | Back alignment and structure |
|---|
| >1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A | Back alignment and structure |
|---|
| >1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p | Back alignment and structure |
|---|
| >1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} | Back alignment and structure |
|---|
| >1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f | Back alignment and structure |
|---|
| >3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A | Back alignment and structure |
|---|
| >2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A | Back alignment and structure |
|---|
| >2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* | Back alignment and structure |
|---|
| >2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A | Back alignment and structure |
|---|
| >2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A | Back alignment and structure |
|---|
| >1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A | Back alignment and structure |
|---|
| >2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 | Back alignment and structure |
|---|
| >1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* | Back alignment and structure |
|---|
| >4efo_A Serine/threonine-protein kinase TBK1; ubiquitin like domain, transferase; 1.77A {Homo sapiens} | Back alignment and structure |
|---|
| >2kvr_A Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubiquitin-like domain, UBL, ubiquitin specific protease, HOST-virus interaction, nucleus, protease; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 | Back alignment and structure |
|---|
| >2daj_A KIAA0977 protein, COBL-like 1; ubiquitin-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1oey_A P67-PHOX, neutrophil cytosol factor 2; immune system, PB1 heterodimer/complex, NADPH oxidase, PB1 D heterodimerization; 2.0A {Homo sapiens} SCOP: d.15.2.2 | Back alignment and structure |
|---|
| >1vd2_A Protein kinase C, IOTA type; PB1 domain, OPCA motif, APKC, ZIP/P62, MEK5, molecular recognition, transferase; NMR {Homo sapiens} SCOP: d.15.2.2 PDB: 1wmh_A | Back alignment and structure |
|---|
| >1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2ylm_A Ubiquitin carboxyl-terminal hydrolase 7; UBL; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A | Back alignment and structure |
|---|
| >3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A | Back alignment and structure |
|---|
| >1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A | Back alignment and structure |
|---|
| >3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A | Back alignment and structure |
|---|
| >1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A | Back alignment and structure |
|---|
| >2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 78 | ||||
| d1wm3a_ | 72 | d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: | 2e-19 | |
| d2uyzb1 | 77 | d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human | 9e-17 | |
| d1euvb_ | 79 | d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yea | 5e-14 |
| >d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-Grasp (ubiquitin-like) superfamily: Ubiquitin-like family: Ubiquitin-related domain: SUMO-2 species: Human (Homo sapiens) [TaxId: 9606]
Score = 72.5 bits (178), Expect = 2e-19
Identities = 27/46 (58%), Positives = 33/46 (71%)
Query: 21 HINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLY 66
HINLKV GQDG+ V F+IKR T L KLM AYC+RQ + + I F +
Sbjct: 1 HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRF 46
|
| >d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Length = 79 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 78 | |||
| d1wm3a_ | 72 | SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.84 | |
| d2uyzb1 | 77 | SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax | 99.79 | |
| d1euvb_ | 79 | SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy | 99.73 | |
| d1ttna1 | 80 | Dendritic cell-derived ubiquitin-like protein {Hum | 98.01 | |
| d1z2ma2 | 76 | Interferon-induced 15 kDa protein {Human (Homo sap | 97.95 | |
| d1j8ca_ | 103 | Ubiquitin-like N-terminal domain of PLIC-2 {Human | 97.94 | |
| d1uh6a_ | 100 | Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu | 97.94 | |
| d1m94a_ | 73 | Ubiquitin-like modifier protein hub1 {Baker's yeas | 97.77 | |
| d1ogwa_ | 76 | Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} | 97.75 | |
| d1wh3a_ | 87 | 2'-5'-oligoadenylate synthetase-like protein, OASL | 97.71 | |
| d1wgha_ | 116 | Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu | 97.68 | |
| d1bt0a_ | 73 | Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI | 97.64 | |
| d1wx8a1 | 83 | 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] | 97.62 | |
| d1wx9a1 | 73 | Large proline-rich protein BAT3 {Human (Homo sapie | 97.6 | |
| d1oqya4 | 77 | Ubiquitin-like domain of Rad23 homolog A (Hhr23a) | 97.58 | |
| d2al3a1 | 76 | Tether containing UBX domain for GLUT4 (Tug) {Mous | 97.49 | |
| d1yqba1 | 84 | Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | 97.42 | |
| d2zeqa1 | 78 | Ubiquitin-like domain of parkin {Mouse (Mus muscul | 97.39 | |
| d2bwfa1 | 73 | DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 97.33 | |
| d2faza1 | 76 | Ubiquitin-like PHD and RING finger domain-containi | 97.22 | |
| d1zkha1 | 86 | Splicing factor 3 subunit 1, C-terminal domain {Hu | 97.07 | |
| d1wgga_ | 96 | Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M | 97.06 | |
| d1se9a_ | 101 | Hypothetical protein At3g01050 {Thale cress (Arabi | 96.93 | |
| d1wy8a1 | 76 | Ubiquitin-like PHD and RING finger domain-containi | 96.81 | |
| d1uela_ | 95 | Ubiquitin-like domain of Rad23 homolog B (Hhr23B) | 96.78 | |
| d1v5oa_ | 102 | 1700011n24rik protein {Mouse (Mus musculus) [TaxId | 96.64 | |
| d1z2ma1 | 76 | Interferon-induced 15 kDa protein {Human (Homo sap | 96.58 | |
| d1wjua_ | 100 | NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens | 96.57 | |
| d2c9wb1 | 103 | Elongin B {Human (Homo sapiens) [TaxId: 9606]} | 96.3 | |
| d1v86a_ | 95 | hypothetical D7wsu128e protein {Mouse (Mus musculu | 95.98 | |
| d1wgda_ | 93 | Homocysteine-responsive endoplasmic reticulum-resi | 95.83 | |
| d1we6a_ | 111 | Splicing factor 3 subunit 1, C-terminal domain {Th | 95.78 | |
| d2cr5a1 | 96 | UBX domain-containing protein 6 (Reproduction 8) { | 95.67 | |
| d1wxva1 | 81 | Bag-family molecular chaperone regulator-1 {Human | 95.29 | |
| d1wiaa_ | 95 | Ubiquitin-like protein bab25500 (2010008E23Rik) {M | 95.16 | |
| d1v2ya_ | 105 | Ubiquitin-like protein 3300001g02rik {Mouse (Mus m | 95.01 | |
| d1wjna_ | 97 | Tubulin-folding protein TbcE {Mouse (Mus musculus) | 94.67 | |
| d2npta1 | 105 | Mitogen activated protein kinase kinase 5, Map2k5 | 93.18 | |
| d1ef1a3 | 84 | Moesin {Human (Homo sapiens) [TaxId: 9606]} | 93.12 | |
| d1v5ta_ | 90 | 8430435i17rik protein {Mouse (Mus musculus) [TaxId | 93.0 | |
| d1wxma1 | 73 | A-Raf proto-oncogene serine/threonine-protein kina | 91.5 | |
| d1ip9a_ | 85 | Bud emergence mediator Bemp1 {Baker's yeast (Sacch | 90.81 | |
| d1h4ra3 | 84 | Merlin {Human (Homo sapiens) [TaxId: 9606]} | 90.63 | |
| d1c1yb_ | 77 | c-Raf1 RBD {Human (Homo sapiens) [TaxId: 9606]} | 90.29 | |
| d1gg3a3 | 81 | Erythroid membrane protein 4.1R {Human (Homo sapie | 86.83 | |
| d1wgra_ | 100 | Growth factor receptor-bound protein 7, GRB-7 {Hum | 85.92 | |
| d1wgya_ | 104 | Rap guanine nucleotide exchange factor 5, RapGEF5 | 84.42 | |
| d1h8ca_ | 82 | Fas-associated factor 1, Faf1 {Human (Homo sapiens | 82.79 |
| >d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-Grasp (ubiquitin-like) superfamily: Ubiquitin-like family: Ubiquitin-related domain: SUMO-2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.84 E-value=2.7e-21 Score=114.42 Aligned_cols=55 Identities=49% Similarity=0.716 Sum_probs=53.0
Q ss_pred cEEEEEEccCCCEEEEEEeCCchHHHHHHHHHhhcCCCCCeEEEEECCEeeccee
Q 034926 21 HINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLYVHISAFLAW 75 (78)
Q Consensus 21 ~I~lkV~~qdg~~v~FkIK~~t~l~KLm~aYc~r~gl~~~s~rFlfdG~rI~~~~ 75 (78)
||+|+|++++|++++|+||++++|++||++||++.|++++.++|+|||.+|.+..
T Consensus 1 ~I~lkv~~~~g~~v~f~vk~~t~l~kl~~~y~~~~~~~~~~~~f~fdG~~i~~~~ 55 (72)
T d1wm3a_ 1 HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETD 55 (72)
T ss_dssp CEEEEEECTTSCEEEEEECTTSCTHHHHHHHHHHHTCCTTTCEEEETTEECCTTC
T ss_pred CEEEEEECCCCCEEEEEEcCCChHHHHHHHHHHHhCCCccceEEEECCEEcCCCC
Confidence 7999999999999999999999999999999999999999999999999998754
|
| >d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2npta1 d.15.2.2 (A:4-108) Mitogen activated protein kinase kinase 5, Map2k5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ef1a3 d.15.1.4 (A:4-87) Moesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wxma1 d.15.1.5 (A:8-80) A-Raf proto-oncogene serine/threonine-protein kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ip9a_ d.15.2.2 (A:) Bud emergence mediator Bemp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1h4ra3 d.15.1.4 (A:20-103) Merlin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c1yb_ d.15.1.5 (B:) c-Raf1 RBD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gg3a3 d.15.1.4 (A:1-81) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgra_ d.15.1.5 (A:) Growth factor receptor-bound protein 7, GRB-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgya_ d.15.1.5 (A:) Rap guanine nucleotide exchange factor 5, RapGEF5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|