Citrus Sinensis ID: 035093

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70---
MLSLTFQLIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG
cccccccccHHHHHHHHHHHccccccccEEccccccccEEEEEEccccEEEcccccEEccccEEEEEEccccc
ccccccEEEHHHHHHHHHHHHHHcccHHEEcccccccEEEEEEEccccEEcccccEEEccccEEEEEEEcccc
MLSLTFQLIMKDLLSWVGTnlikerpemfmkgdsvrpgvlVLVNdcdwelsgqldttleeKDVVVFISTLHGG
MLSLTFQLIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDWELsgqldttleekdVVVFISTLHGG
MLSLTFQLIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG
***LTFQLIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTL***
*****FQLIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHG*
MLSLTFQLIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG
**SLTFQLIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLH**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooo
iiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSLTFQLIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query73 2.2.26 [Sep-21-2011]
B3H7G299 Ubiquitin-related modifie yes no 0.904 0.666 0.924 2e-29
A0MDQ1101 Ubiquitin-related modifie no no 0.876 0.633 0.906 2e-27
Q0D6M1100 Ubiquitin-related modifie yes no 0.917 0.67 0.805 5e-26
Q7GBC8100 Ubiquitin-related modifie N/A no 0.917 0.67 0.805 5e-26
B6SXH2101 Ubiquitin-related modifie N/A no 0.917 0.663 0.805 7e-25
Q5ZJU4101 Ubiquitin-related modifie yes no 0.876 0.633 0.640 3e-20
A9YUB5101 Ubiquitin-related modifie N/A no 0.876 0.633 0.656 8e-20
Q148F0101 Ubiquitin-related modifie yes no 0.876 0.633 0.656 8e-20
Q9BTM9101 Ubiquitin-related modifie yes no 0.876 0.633 0.640 8e-20
Q9D2P4101 Ubiquitin-related modifie yes no 0.876 0.633 0.625 1e-19
>sp|B3H7G2|URM12_ARATH Ubiquitin-related modifier 1 homolog 2 OS=Arabidopsis thaliana GN=URM1-2 PE=3 SV=1 Back     alignment and function desciption
 Score =  127 bits (318), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 61/66 (92%), Positives = 64/66 (96%)

Query: 8  LIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFI 67
          L MKDLLSWV TNLIKERPEMFMKGD+VRPGVLVLVNDCDWELSGQLDTTLE+KDV+VFI
Sbjct: 34 LTMKDLLSWVRTNLIKERPEMFMKGDTVRPGVLVLVNDCDWELSGQLDTTLEDKDVIVFI 93

Query: 68 STLHGG 73
          STLHGG
Sbjct: 94 STLHGG 99
Acts as a sulfur carrier required for 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Serves as sulfur donor in tRNA 2-thiolation reaction by thiocarboxylated (-COSH) at its C-terminus by MOCS3. The sulfur is then transferred to tRNA to form 2-thiolation of mcm(5)S(2)U. May also act as an ubiquitin-like protein that is covalently conjugated to other proteins; the relevance of such function is however unclear in vivo.
Arabidopsis thaliana (taxid: 3702)
>sp|A0MDQ1|URM11_ARATH Ubiquitin-related modifier 1 homolog 1 OS=Arabidopsis thaliana GN=URM1-1 PE=3 SV=2 Back     alignment and function description
>sp|Q0D6M1|URM1_ORYSJ Ubiquitin-related modifier 1 homolog OS=Oryza sativa subsp. japonica GN=URM1 PE=3 SV=1 Back     alignment and function description
>sp|Q7GBC8|URM1_ORYSI Ubiquitin-related modifier 1 homolog OS=Oryza sativa subsp. indica GN=URM1 PE=3 SV=1 Back     alignment and function description
>sp|B6SXH2|URM1_MAIZE Ubiquitin-related modifier 1 homolog OS=Zea mays GN=URM1 PE=3 SV=1 Back     alignment and function description
>sp|Q5ZJU4|URM1_CHICK Ubiquitin-related modifier 1 homolog OS=Gallus gallus GN=URM1 PE=3 SV=1 Back     alignment and function description
>sp|A9YUB5|URM1_CAPHI Ubiquitin-related modifier 1 homolog OS=Capra hircus GN=URM1 PE=3 SV=1 Back     alignment and function description
>sp|Q148F0|URM1_BOVIN Ubiquitin-related modifier 1 homolog OS=Bos taurus GN=URM1 PE=3 SV=1 Back     alignment and function description
>sp|Q9BTM9|URM1_HUMAN Ubiquitin-related modifier 1 homolog OS=Homo sapiens GN=URM1 PE=1 SV=1 Back     alignment and function description
>sp|Q9D2P4|URM1_MOUSE Ubiquitin-related modifier 1 homolog OS=Mus musculus GN=Urm1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query73
147851956105 hypothetical protein VITISV_018251 [Viti 0.917 0.638 0.925 2e-28
449472681101 PREDICTED: ubiquitin-related modifier 1 0.917 0.663 0.925 3e-28
44945449899 PREDICTED: ubiquitin-related modifier 1 0.917 0.676 0.925 3e-28
22545387199 PREDICTED: ubiquitin-related modifier 1 0.917 0.676 0.925 3e-28
449531059101 PREDICTED: ubiquitin-related modifier 1 0.917 0.663 0.925 4e-28
25554142699 Protein C9orf74, putative [Ricinus commu 0.917 0.676 0.925 5e-28
18651126999 ubiquitin-related modifier 1-2 [Arabidop 0.904 0.666 0.924 1e-27
29782095894 predicted protein [Arabidopsis lyrata su 0.904 0.702 0.909 3e-27
388492868101 unknown [Medicago truncatula] 0.917 0.663 0.910 4e-27
35650524299 PREDICTED: ubiquitin-related modifier 1 0.917 0.676 0.880 4e-27
>gi|147851956|emb|CAN82245.1| hypothetical protein VITISV_018251 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 62/67 (92%), Positives = 64/67 (95%)

Query: 7   QLIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVF 66
           +L MKDLLSWV  NLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDV+VF
Sbjct: 39  KLTMKDLLSWVRANLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVIVF 98

Query: 67  ISTLHGG 73
           ISTLHGG
Sbjct: 99  ISTLHGG 105

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449472681|ref|XP_004153667.1| PREDICTED: ubiquitin-related modifier 1 homolog 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449454498|ref|XP_004144991.1| PREDICTED: ubiquitin-related modifier 1 homolog 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225453871|ref|XP_002278537.1| PREDICTED: ubiquitin-related modifier 1 homolog 2 isoform 1 [Vitis vinifera] gi|296089135|emb|CBI38838.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449531059|ref|XP_004172505.1| PREDICTED: ubiquitin-related modifier 1 homolog 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255541426|ref|XP_002511777.1| Protein C9orf74, putative [Ricinus communis] gi|223548957|gb|EEF50446.1| Protein C9orf74, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|186511269|ref|NP_001118872.1| ubiquitin-related modifier 1-2 [Arabidopsis thaliana] gi|238692413|sp|B3H7G2.1|URM12_ARATH RecName: Full=Ubiquitin-related modifier 1 homolog 2 gi|332646635|gb|AEE80156.1| ubiquitin-related modifier 1-2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297820958|ref|XP_002878362.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297324200|gb|EFH54621.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|388492868|gb|AFK34500.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|356505242|ref|XP_003521401.1| PREDICTED: ubiquitin-related modifier 1 homolog 2-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query73
TAIR|locus:451510329299 AT3G61113 "AT3G61113" [Arabido 0.904 0.666 0.924 3.4e-29
TAIR|locus:4010713712101 AT2G45695 "AT2G45695" [Arabido 0.876 0.633 0.906 1.7e-27
ZFIN|ZDB-GENE-091204-300101 urm1 "ubiquitin related modifi 0.876 0.633 0.687 1.5e-21
RGD|1306599101 Urm1 "ubiquitin related modifi 0.876 0.633 0.640 1.3e-20
UNIPROTKB|Q5ZJU4101 URM1 "Ubiquitin-related modifi 0.876 0.633 0.640 2.7e-20
UNIPROTKB|Q148F0101 URM1 "Ubiquitin-related modifi 0.876 0.633 0.656 4.4e-20
UNIPROTKB|Q9BTM9101 URM1 "Ubiquitin-related modifi 0.876 0.633 0.640 4.4e-20
UNIPROTKB|A9YUB5101 URM1 "Ubiquitin-related modifi 0.876 0.633 0.656 4.4e-20
UNIPROTKB|E2QUA4101 URM1 "Uncharacterized protein" 0.876 0.633 0.640 5.7e-20
UNIPROTKB|F1RR84101 URM1 "Uncharacterized protein" 0.876 0.633 0.625 5.7e-20
TAIR|locus:4515103292 AT3G61113 "AT3G61113" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 324 (119.1 bits), Expect = 3.4e-29, P = 3.4e-29
 Identities = 61/66 (92%), Positives = 64/66 (96%)

Query:     8 LIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFI 67
             L MKDLLSWV TNLIKERPEMFMKGD+VRPGVLVLVNDCDWELSGQLDTTLE+KDV+VFI
Sbjct:    34 LTMKDLLSWVRTNLIKERPEMFMKGDTVRPGVLVLVNDCDWELSGQLDTTLEDKDVIVFI 93

Query:    68 STLHGG 73
             STLHGG
Sbjct:    94 STLHGG 99
GO:0003674 "molecular_function" evidence=ND
GO:0005737 "cytoplasm" evidence=ISM;IEA
GO:0034227 "tRNA thio-modification" evidence=IEA
TAIR|locus:4010713712 AT2G45695 "AT2G45695" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-091204-300 urm1 "ubiquitin related modifier 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1306599 Urm1 "ubiquitin related modifier 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZJU4 URM1 "Ubiquitin-related modifier 1 homolog" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q148F0 URM1 "Ubiquitin-related modifier 1 homolog" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BTM9 URM1 "Ubiquitin-related modifier 1 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A9YUB5 URM1 "Ubiquitin-related modifier 1 homolog" [Capra hircus (taxid:9925)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUA4 URM1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RR84 URM1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9BTM9URM1_HUMANNo assigned EC number0.64060.87670.6336yesno
Q9D2P4URM1_MOUSENo assigned EC number0.6250.87670.6336yesno
Q5ZJU4URM1_CHICKNo assigned EC number0.64060.87670.6336yesno
Q7GBC8URM1_ORYSINo assigned EC number0.80590.91780.67N/Ano
Q54QN0URM1_DICDINo assigned EC number0.53730.91780.6979yesno
B6SXH2URM1_MAIZENo assigned EC number0.80590.91780.6633N/Ano
B3H7G2URM12_ARATHNo assigned EC number0.92420.90410.6666yesno
Q0D6M1URM1_ORYSJNo assigned EC number0.80590.91780.67yesno
Q7KU86URM1_DROMENo assigned EC number0.59370.87670.6336yesno
A0MDQ1URM11_ARATHNo assigned EC number0.90620.87670.6336nono
Q6CQU4URM1_KLULANo assigned EC number0.51560.84930.6138yesno
Q148F0URM1_BOVINNo assigned EC number0.65620.87670.6336yesno
B5DQK2URM1_DROPSNo assigned EC number0.59370.87670.6464yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query73
pfam0913896 pfam09138, Urm1, Urm1 (Ubiquitin related modifier) 9e-35
cd0176494 cd01764, Urm1, Urm1-like ubuitin domain 2e-29
COG513196 COG5131, URM1, Ubiquitin-like protein [Posttransla 4e-13
>gnl|CDD|220123 pfam09138, Urm1, Urm1 (Ubiquitin related modifier) Back     alignment and domain information 
 Score =  113 bits (284), Expect = 9e-35
 Identities = 42/64 (65%), Positives = 54/64 (84%)

Query: 10 MKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFIST 69
          M DL+ ++  NLIKERPE+F++GD+VRPG+LVL+NDCDWEL G+LD  LE+ D + FIST
Sbjct: 33 MGDLIDYIKKNLIKERPEVFLEGDTVRPGILVLINDCDWELLGELDYVLEDGDKITFIST 92

Query: 70 LHGG 73
          LHGG
Sbjct: 93 LHGG 96

Urm1 is a ubiquitin related protein that modifies proteins in the yeast ubiquitin-like pathway urmylation. Structural comparisons and phylogenetic analysis of the ubiquitin superfamily has indicated that Urm1 has the most conserved structural and sequence features of the common ancestor of the entire superfamily. Length = 96
>gnl|CDD|176360 cd01764, Urm1, Urm1-like ubuitin domain Back     alignment and domain information
>gnl|CDD|227460 COG5131, URM1, Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 73
cd0176494 Urm1 Urm1-like ubuitin domain. Urm1 (Ubiquitin-Rel 99.96
TIGR0168788 moaD_arch MoaD family protein, archaeal. Members o 99.88
PF0913896 Urm1: Urm1 (Ubiquitin related modifier); InterPro: 99.87
KOG4146101 consensus Ubiquitin-like protein [Posttranslationa 99.81
PF0259777 ThiS: ThiS family; InterPro: IPR003749 ThiS (thiam 99.76
cd0075480 MoaD Ubiquitin domain of MoaD-like proteins. MoaD 99.74
COG513196 URM1 Ubiquitin-like protein [Posttranslational mod 99.74
TIGR0168280 moaD molybdopterin converting factor, subunit 1, n 99.7
PLN0279982 Molybdopterin synthase sulfur carrier subunit 99.67
PRK1113081 moaD molybdopterin synthase small subunit; Provisi 99.66
COG197784 MoaD Molybdopterin converting factor, small subuni 99.55
PRK0694465 sulfur carrier protein ThiS; Provisional 99.45
cd0056565 ThiS ThiaminS ubiquitin-like sulfur carrier protei 99.4
TIGR0168364 thiS thiamine biosynthesis protein ThiS. This mode 99.3
PRK0836470 sulfur carrier protein ThiS; Provisional 99.17
PRK0648865 sulfur carrier protein ThiS; Validated 99.14
PRK0805366 sulfur carrier protein ThiS; Provisional 99.11
PRK0643767 hypothetical protein; Provisional 99.06
PRK0565966 sulfur carrier protein ThiS; Validated 98.95
PRK0177795 hypothetical protein; Validated 98.79
PRK0586365 sulfur carrier protein ThiS; Provisional 98.78
PRK0744070 hypothetical protein; Provisional 98.73
COG210468 ThiS Sulfur transfer protein involved in thiamine 98.65
PRK0769667 sulfur carrier protein ThiS; Provisional 98.57
PRK0608384 sulfur carrier protein ThiS; Provisional 98.54
PRK11840 326 bifunctional sulfur carrier protein/thiazole synth 98.4
KOG347484 consensus Molybdopterin converting factor, small s 98.1
PF0680582 Lambda_tail_I: Bacteriophage lambda tail assembly 97.91
PF1445181 Ub-Mut7C: Mut7-C ubiquitin 97.91
PF0282460 TGS: TGS domain; InterPro: IPR004095 The TGS domai 97.28
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 97.24
PF0365884 Ub-RnfH: RnfH family Ubiquitin; InterPro: IPR00534 96.9
cd0161660 TGS The TGS domain, named after the ThrRS, GTPase, 96.77
cd0166860 TGS_RelA_SpoT TGS_RelA_SpoT: The RelA (SpoT) prote 96.69
cd0166675 TGS_DRG_C TGS_DRG_C: DRG (developmentally regulate 96.08
cd0166976 TGS_Ygr210_C TGS_Ygr210_C: The C-terminal TGS doma 95.38
cd0180676 Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn 95.37
cd0180478 midnolin_N Ubiquitin-like domain of midnolin. midn 95.28
cd0180376 Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 94.17
PF13085110 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; 93.52
TIGR00691 683 spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( 93.37
cd0493876 TGS_Obg-like TGS_Obg-like: The C-terminal TGS doma 93.0
cd0166761 TGS_ThrRS_N TGS _ThrRS_N: ThrRS (threonyl-tRNA Syn 92.99
cd0181074 ISG15_repeat2 ISG15 ubiquitin-like protein, second 92.87
PF1445357 ThiS-like: ThiS-like ubiquitin 92.36
COG4723 198 Phage-related protein, tail component [Function un 92.16
cd0180076 SF3a120_C Ubiquitin-like domain of Mammalian splic 92.12
COG250173 S4-like RNA binding protein [Replication, recombin 91.98
PTZ0004476 ubiquitin; Provisional 91.79
PF1154380 UN_NPL4: Nuclear pore localisation protein NPL4; I 90.97
TIGR0298859 YaaA_near_RecF S4 domain protein YaaA. This small 90.76
PF0049868 FHA: FHA domain; InterPro: IPR000253 The forkhead- 90.67
cd0179374 Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui 90.38
PRK10872 743 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; 89.86
cd0181271 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter 89.33
COG291499 Uncharacterized protein conserved in bacteria [Fun 88.73
PRK07570 250 succinate dehydrogenase/fumarate reductase iron-su 88.71
cd01802103 AN1_N ubiquitin-like domain of AN1. AN1 (also know 88.64
cd0176387 Sumo Small ubiquitin-related modifier (SUMO). Smal 88.62
TIGR00384 220 dhsB succinate dehydrogenase and fumarate reductas 87.68
PRK13552 239 frdB fumarate reductase iron-sulfur subunit; Provi 87.2
PRK11092 702 bifunctional (p)ppGpp synthetase II/ guanosine-3', 86.88
smart0036360 S4 S4 RNA-binding domain. 86.48
KOG176999 consensus Ubiquitin-like proteins [Posttranslation 86.47
PF0147948 S4: S4 domain; InterPro: IPR002942 Ribosomes are t 84.98
cd0179173 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know 84.65
cd0180577 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo 84.08
cd0181575 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC 83.95
PF1447868 DUF4430: Domain of unknown function (DUF4430); PDB 82.66
PRK05950 232 sdhB succinate dehydrogenase iron-sulfur subunit; 82.51
PRK1150770 ribosome-associated protein; Provisional 82.32
PF1327565 S4_2: S4 domain; PDB: 1P9K_A. 82.2
PF1197672 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter 82.13
PRK12385 244 fumarate reductase iron-sulfur subunit; Provisiona 81.47
PRK12577 329 succinate dehydrogenase iron-sulfur subunit; Provi 81.14
cd0181374 UBP_N UBP ubiquitin processing protease. The UBP ( 80.99
COG1163365 DRG Predicted GTPase [General function prediction 80.79
PF14950358 DUF4502: Domain of unknown function (DUF4502) 80.33
PF1183469 DUF3354: Domain of unknown function (DUF3354); Int 80.13
PF0024069 ubiquitin: Ubiquitin family; InterPro: IPR000626 U 80.11
>cd01764 Urm1 Urm1-like ubuitin domain Back     alignment and domain information 
Probab=99.96  E-value=1.7e-29  Score=154.67  Aligned_cols=68  Identities=57%  Similarity=1.029  Sum_probs=66.6

Q ss_pred             ccCcHHHHHHHHHHhcCcccccccccCCcccCceEEEEcCccccccCCccCccCCCCEEEEEecCCCC
Q 035093            6 FQLIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG   73 (73)
Q Consensus         6 ~~~TV~~ll~~L~~~~~~~~~~l~~~~g~lr~~v~ilvNg~~i~~l~g~~t~l~dgD~V~i~PpvaGG   73 (73)
                      +++||++||++|+++||..++++|.++|++||+|+|||||+||++++|++|+|++||+|+||||+|||
T Consensus        27 ~~~tV~dll~~L~~~~~~~~~~lf~~~g~lr~~i~VlvN~~di~~l~g~~t~L~dgD~v~i~P~v~GG   94 (94)
T cd01764          27 KPVTVGDLLDYVASNLLEERPDLFIEGGSVRPGIIVLINDTDWELLGEEDYILEDGDHVVFISTLHGG   94 (94)
T ss_pred             CCCcHHHHHHHHHHhCchhhhhhEecCCcccCCEEEEECCccccccCCcccCCCCcCEEEEECCCCCC
Confidence            68999999999999999999999999999999999999999999999999999999999999999998

Urm1 (Ubiquitin-Related Modifier1) The Urm1 fold, like those of two closely related proteins MoaD (molybdopterin synthase) and ThiS (sulfur carrier protein), is similar to that of ubiquitin although there is little or no sequence similarity. The C-terminal glycines of Urm1 are conjugated to an E1-like protein Uba4 as part of a novel conjugation system in yeast. The Urm1 fold is found only in eukaryotes.
>TIGR01687 moaD_arch MoaD family protein, archaeal Back     alignment and domain information
>PF09138 Urm1: Urm1 (Ubiquitin related modifier); InterPro: IPR015221 Ubiquitin related modifier 1 (Urm1) is a ubiquitin related protein that modifies proteins in the yeast ubiquitin-like urmylation pathway [] Back     alignment and domain information
>KOG4146 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02597 ThiS: ThiS family; InterPro: IPR003749 ThiS (thiaminS) is a 66 aa protein involved in sulphur transfer Back     alignment and domain information
>cd00754 MoaD Ubiquitin domain of MoaD-like proteins Back     alignment and domain information
>COG5131 URM1 Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01682 moaD molybdopterin converting factor, subunit 1, non-archaeal Back     alignment and domain information
>PLN02799 Molybdopterin synthase sulfur carrier subunit Back     alignment and domain information
>PRK11130 moaD molybdopterin synthase small subunit; Provisional Back     alignment and domain information
>COG1977 MoaD Molybdopterin converting factor, small subunit [Coenzyme metabolism] Back     alignment and domain information
>PRK06944 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>cd00565 ThiS ThiaminS ubiquitin-like sulfur carrier protein Back     alignment and domain information
>TIGR01683 thiS thiamine biosynthesis protein ThiS Back     alignment and domain information
>PRK08364 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PRK06488 sulfur carrier protein ThiS; Validated Back     alignment and domain information
>PRK08053 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PRK06437 hypothetical protein; Provisional Back     alignment and domain information
>PRK05659 sulfur carrier protein ThiS; Validated Back     alignment and domain information
>PRK01777 hypothetical protein; Validated Back     alignment and domain information
>PRK05863 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PRK07440 hypothetical protein; Provisional Back     alignment and domain information
>COG2104 ThiS Sulfur transfer protein involved in thiamine biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK07696 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PRK06083 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>KOG3474 consensus Molybdopterin converting factor, small subunit [Energy production and conversion] Back     alignment and domain information
>PF06805 Lambda_tail_I: Bacteriophage lambda tail assembly protein I; InterPro: IPR010654 This family consists of several Bacteriophage lambda tail assembly protein I and related phage and bacterial sequences Back     alignment and domain information
>PF14451 Ub-Mut7C: Mut7-C ubiquitin Back     alignment and domain information
>PF02824 TGS: TGS domain; InterPro: IPR004095 The TGS domain is present in a number of enzymes, for example, in threonyl-tRNA synthetase (ThrRS), GTPase, and guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase (SpoT) [] Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>PF03658 Ub-RnfH: RnfH family Ubiquitin; InterPro: IPR005346 This is a small family of proteins of unknown function Back     alignment and domain information
>cd01616 TGS The TGS domain, named after the ThrRS, GTPase, and SpoT/RelA proteins where it occurs, is structurally similar to ubiquitin Back     alignment and domain information
>cd01668 TGS_RelA_SpoT TGS_RelA_SpoT: The RelA (SpoT) protein, also referred to as ppGpp hydrolase/synthetase, is a ribosome-associated protein that is activated during amino acid starvation and thought to mediate the stringent response Back     alignment and domain information
>cd01666 TGS_DRG_C TGS_DRG_C: DRG (developmentally regulated GTP-binding protein) represents a family of GTP-binding proteins that includes two members, DRG1 and DRG2 Back     alignment and domain information
>cd01669 TGS_Ygr210_C TGS_Ygr210_C: The C-terminal TGS domain of Ygr210 GTP-binding protein which is a member of Obg-like family of GTPases, and present in archaea Back     alignment and domain information
>cd01806 Nedd8 Nebb8-like ubiquitin protein Back     alignment and domain information
>cd01804 midnolin_N Ubiquitin-like domain of midnolin Back     alignment and domain information
>cd01803 Ubiquitin Ubiquitin Back     alignment and domain information
>PF13085 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; PDB: 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N 1KF6_B 3P4P_N 3P4S_B 1L0V_B 1ZOY_B Back     alignment and domain information
>TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family Back     alignment and domain information
>cd04938 TGS_Obg-like TGS_Obg-like: The C-terminal TGS domain of Obg-like GTPases such as those present in DRG (developmentally regulated GTP-binding protein), and GTP-binding proteins Ygr210 and YchF Back     alignment and domain information
>cd01667 TGS_ThrRS_N TGS _ThrRS_N: ThrRS (threonyl-tRNA Synthetase) is a class II tRNA synthetase that couples threonine to its cognate tRNA Back     alignment and domain information
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 Back     alignment and domain information
>PF14453 ThiS-like: ThiS-like ubiquitin Back     alignment and domain information
>COG4723 Phage-related protein, tail component [Function unknown] Back     alignment and domain information
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 Back     alignment and domain information
>COG2501 S4-like RNA binding protein [Replication, recombination, and repair] Back     alignment and domain information
>PTZ00044 ubiquitin; Provisional Back     alignment and domain information
>PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway Back     alignment and domain information
>TIGR02988 YaaA_near_RecF S4 domain protein YaaA Back     alignment and domain information
>PF00498 FHA: FHA domain; InterPro: IPR000253 The forkhead-associated (FHA) domain [] is a phosphopeptide recognition domain found in many regulatory proteins Back     alignment and domain information
>cd01793 Fubi Fubi ubiquitin-like protein Back     alignment and domain information
>PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional Back     alignment and domain information
>cd01812 BAG1_N Ubiquitin-like domain of BAG1 Back     alignment and domain information
>COG2914 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated Back     alignment and domain information
>cd01802 AN1_N ubiquitin-like domain of AN1 Back     alignment and domain information
>cd01763 Sumo Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
>TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein Back     alignment and domain information
>PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional Back     alignment and domain information
>smart00363 S4 S4 RNA-binding domain Back     alignment and domain information
>KOG1769 consensus Ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01479 S4: S4 domain; InterPro: IPR002942 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>cd01791 Ubl5 UBL5 ubiquitin-like modifier Back     alignment and domain information
>cd01805 RAD23_N Ubiquitin-like domain of RAD23 Back     alignment and domain information
>cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP Back     alignment and domain information
>PF14478 DUF4430: Domain of unknown function (DUF4430); PDB: 3U7Z_B 2BB5_A Back     alignment and domain information
>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PRK11507 ribosome-associated protein; Provisional Back     alignment and domain information
>PF13275 S4_2: S4 domain; PDB: 1P9K_A Back     alignment and domain information
>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins Back     alignment and domain information
>PRK12385 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>cd01813 UBP_N UBP ubiquitin processing protease Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>PF14950 DUF4502: Domain of unknown function (DUF4502) Back     alignment and domain information
>PF11834 DUF3354: Domain of unknown function (DUF3354); InterPro: IPR021789 Potassium channels take part in important processes of higher plants, including opening and closing of stomatal pores and leaf movement Back     alignment and domain information
>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query73
1xo3_A101 Solution Structure Of Ubiquitin Like Protein From M 8e-21
1wgk_A114 Solution Structure Of Mouse Hypothetical Protein 29 1e-20
2k9x_A110 Solution Structure Of Urm1 From Trypanosoma Brucei 1e-12
2qjl_A99 Crystal Structure Of Urm1 Length = 99 3e-11
2ax5_A107 Solution Structure Of Urm1 From Saccharomyces Cerev 3e-11
>pdb|1XO3|A Chain A, Solution Structure Of Ubiquitin Like Protein From Mus Musculus Length = 101 Back     alignment and structure 
Iteration: 1

 Score = 95.1 bits (235), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 40/64 (62%), Positives = 56/64 (87%)
Query: 10  MKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFIST 69
           +++LL W+  NL+KERPE+F++GDSVRPG+LVL+ND DWEL G+LD  L+++D ++FIST
Sbjct: 38  IRNLLVWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSILFIST 97
Query: 70  LHGG 73
           LHGG
Sbjct: 98  LHGG 101
>pdb|1WGK|A Chain A, Solution Structure Of Mouse Hypothetical Protein 2900073h19rik Length = 114 Back     alignment and structure
>pdb|2K9X|A Chain A, Solution Structure Of Urm1 From Trypanosoma Brucei Length = 110 Back     alignment and structure
>pdb|2QJL|A Chain A, Crystal Structure Of Urm1 Length = 99 Back     alignment and structure
>pdb|2AX5|A Chain A, Solution Structure Of Urm1 From Saccharomyces Cerevisiae Length = 107 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query73
1wgk_A114 Riken cDNA 2900073H19 protein; THis domain, ubiqut 3e-27
2qjl_A99 URM1, ubiquitin-related modifier 1; ubiquitin-like 9e-25
2k9x_A110 Tburm1, uncharacterized protein; unknown function; 5e-24
2g1e_A90 Hypothetical protein TA0895; MOAD, molybdopterin, 6e-10
1v8c_A168 MOAD related protein; riken structural genomics/pr 4e-07
3dwg_C93 9.5 kDa culture filtrate antigen CFP10A; sulfur ca 1e-05
2l52_A99 Methanosarcina acetivorans SAMP1 homolog; beta-grA 6e-05
3po0_A89 Small archaeal modifier protein 1; ubiquitin-like 1e-04
>1wgk_A Riken cDNA 2900073H19 protein; THis domain, ubiqutin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.3.3 PDB: 1xo3_A Length = 114 Back     alignment and structure
 Score = 94.3 bits (234), Expect = 3e-27
 Identities = 40/64 (62%), Positives = 56/64 (87%)

Query: 10  MKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFIST 69
           +++LL W+  NL+KERPE+F++GDSVRPG+LVL+ND DWEL G+LD  L+++D ++FIST
Sbjct: 45  IRNLLVWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSILFIST 104

Query: 70  LHGG 73
           LHGG
Sbjct: 105 LHGG 108
>2qjl_A URM1, ubiquitin-related modifier 1; ubiquitin-like protein, signaling protein; 1.44A {Saccharomyces cerevisiae} PDB: 2pko_A 2ax5_A Length = 99 Back     alignment and structure
>2k9x_A Tburm1, uncharacterized protein; unknown function; NMR {Trypanosoma brucei} Length = 110 Back     alignment and structure
>2g1e_A Hypothetical protein TA0895; MOAD, molybdopterin, transferase; NMR {Thermoplasma acidophilum} PDB: 2k22_A Length = 90 Back     alignment and structure
>1v8c_A MOAD related protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, protein binding; 1.60A {Thermus thermophilus} SCOP: d.15.3.1 d.129.5.1 Length = 168 Back     alignment and structure
>3dwg_C 9.5 kDa culture filtrate antigen CFP10A; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} PDB: 3dwm_A Length = 93 Back     alignment and structure
>2l52_A Methanosarcina acetivorans SAMP1 homolog; beta-grAsp fold, protein binding, E1-like, SAMP activator, ELSA, adenylation, ubiquitin; NMR {Methanosarcina acetivorans} Length = 99 Back     alignment and structure
>3po0_A Small archaeal modifier protein 1; ubiquitin-like protein, protein binding; 1.55A {Haloferax volcanii} PDB: 2l83_A Length = 89 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query73
1wgk_A114 Riken cDNA 2900073H19 protein; THis domain, ubiqut 99.95
2k9x_A110 Tburm1, uncharacterized protein; unknown function; 99.94
2qjl_A99 URM1, ubiquitin-related modifier 1; ubiquitin-like 99.92
3dwg_C93 9.5 kDa culture filtrate antigen CFP10A; sulfur ca 99.91
3po0_A89 Small archaeal modifier protein 1; ubiquitin-like 99.89
2g1e_A90 Hypothetical protein TA0895; MOAD, molybdopterin, 99.87
1vjk_A98 Molybdopterin converting factor, subunit 1; struct 99.85
2l52_A99 Methanosarcina acetivorans SAMP1 homolog; beta-grA 99.84
1v8c_A168 MOAD related protein; riken structural genomics/pr 99.75
1fm0_D81 Molybdopterin convertin factor, subunit 1; molybde 99.66
3rpf_C74 Molybdopterin converting factor, subunit 1 (MOAD); 99.66
2q5w_D77 Molybdopterin converting factor, subunit 1; MOCO, 99.61
1f0z_A66 THis protein; ubiquitin fold, transport protein; N 99.54
2cu3_A64 Unknown function protein; thermus thermophilus HB8 99.53
1tyg_B87 YJBS; alpha beta barrel, protein-protein complex, 99.4
1rws_A77 Hypothetical protein PF1061; residual dipolar coup 99.32
1ryj_A70 Unknown; beta/alpha protein, structural genomics, 99.24
2kl0_A73 Putative thiamin biosynthesis THis; structural gen 99.04
2k5p_A78 THis protein, thiamine-biosynthesis protein; NESG, 98.97
2l32_A74 Small archaeal modifier protein 2; protein BIN; NM 98.59
2hj1_A97 Hypothetical protein; structural genomics, PSI, pr 98.55
2kmm_A73 Guanosine-3',5'-BIS(diphosphate) 3'- pyrophosphohy 97.63
3hvz_A78 Uncharacterized protein; alpha-beta protein, struc 97.63
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 95.83
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 95.71
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 95.42
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 95.28
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 94.57
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 94.54
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 94.18
2eki_A93 DRG 1, developmentally-regulated GTP-binding prote 94.17
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 94.03
4hcn_B98 Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas 93.91
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 93.72
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 93.33
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 93.29
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 93.06
1wwt_A88 Threonyl-tRNA synthetase, cytoplasmic; TGS domain, 92.97
3vdz_A111 Ubiquitin-40S ribosomal protein S27A; gadolinium, 92.45
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 92.22
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 92.17
3va4_A132 Mediator of DNA damage checkpoint protein 1; cell 92.11
3fm8_A124 Kinesin-like protein KIF13B; kinesin, GAP, GTPase 92.1
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 91.91
4ejq_A154 Kinesin-like protein KIF1A; homodimer, FHA domain, 91.29
1we6_A111 Splicing factor, putative; structural genomics, ub 91.27
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 91.27
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 91.03
1wln_A120 Afadin; beta sandwich, FHA domain, structural geno 91.0
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 90.98
2io0_B91 Small ubiquitin-related modifier 2 precursor; SUMO 90.87
3goe_A82 DNA repair protein RAD60; SUMO-like domain, sumoyl 90.86
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 90.58
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 90.47
4h87_A130 Kanadaptin; FHA domain of PF00498, mRNA processing 90.3
2io1_B94 Small ubiquitin-related modifier 3 precursor; SUMO 90.12
1tke_A 224 Threonyl-tRNA synthetase; ligase; 1.46A {Escherich 90.01
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 89.92
2d07_B93 Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho 89.75
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 89.61
4egx_A184 Kinesin-like protein KIF1A; FHA domain, transport 89.28
2bps_A81 YUKD protein; ubiquitin-like protein, ubiquitin; 2 88.98
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 88.86
2pjh_A80 Protein NPL4, nuclear protein localization protein 88.6
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 88.53
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 88.4
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 88.31
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 88.29
1lgp_A116 Cell cycle checkpoint protein CHFR; FHA, tungstate 88.18
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 88.14
2pie_A138 E3 ubiquitin-protein ligase RNF8; FHA domain, comp 88.11
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 88.07
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 88.03
3u7z_A101 Putative metal binding protein rumgna_00854; the b 88.01
1gxc_A149 CHK2, CDS1, serine/threonine-protein kinase CHK2; 87.92
2dzj_A88 Synaptic glycoprotein SC2; ubiquitin-like fold, st 87.74
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 87.52
2pmv_A399 Gastric intrinsic factor; cobalamin transport prot 87.03
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 86.82
3po8_A100 RV0020C protein, putative uncharacterized protein 86.76
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 86.73
3hx1_A131 SLR1951 protein; P74513_SYNY3, adenylate cyclase-l 86.73
1uht_A118 Expressed protein; FHA domain, beta-sandwich, anti 86.39
2jqj_A151 DNA damage response protein kinase DUN1; protein/p 86.37
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 85.94
3v6c_B91 Ubiquitin; structural genomics, structural genomic 85.78
1wz0_A104 Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li 85.65
1wjn_A97 Tubulin-folding protein TBCE; ubiquitin-like domai 85.42
2k6p_A92 Uncharacterized protein HP_1423; alpha-L motif, RN 85.17
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 84.96
3m62_B106 UV excision repair protein RAD23; armadillo-like r 84.95
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 84.93
2xt9_B115 Putative signal transduction protein GARA; lyase-s 84.71
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 84.64
3gqs_A106 Adenylate cyclase-like protein; FHA domain, struct 84.57
1dmz_A158 Protein (protein kinase SPK1); beta-sandwich, anti 84.52
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 84.38
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 84.12
1wia_A95 Hypothetical ubiquitin-like protein (riken cDNA 20 84.11
2eke_C106 Ubiquitin-like protein SMT3; UBC9, SUMO binding mo 83.96
2csw_A145 Ubiquitin ligase protein RNF8; 11-stranded beta sa 83.69
2bb6_A414 TCII, TC II, transcobalamin II; alpha_6 - alpha_6 83.62
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 83.57
1g6g_A127 Protein kinase RAD53; beta-sandwich, phosphopeptid 83.09
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 82.92
1g3g_A164 Protien kinase SPK1; FHA domain, RAD53, phosphopep 82.75
1qu5_A182 Protein kinase SPK1; FHA, RAD53, transferase; NMR 82.52
2kfu_A162 RV1827 PThr 22; FHA domain, phosphorylation, intra 82.25
3oun_A157 Putative uncharacterized protein TB39.8; peptidogl 82.05
2k8h_A110 Small ubiquitin protein; SUMO, post-translational 81.91
3kt9_A102 Aprataxin; FHA domain, beta sandwich, beta sheet, 81.67
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 81.15
2kb3_A143 Oxoglutarate dehydrogenase inhibitor; forkhead-ass 80.79
1wm3_A72 Ubiquitin-like protein SMT3B; ubiquitin fold, half 80.77
2bs2_B 241 Quinol-fumarate reductase iron-sulfur subunit B; 2 80.49
1dm9_A133 Hypothetical 15.5 KD protein in MRCA-PCKA intergen 80.47
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 80.09
>1wgk_A Riken cDNA 2900073H19 protein; THis domain, ubiqutin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.3.3 PDB: 1xo3_A Back     alignment and structure
Probab=99.95  E-value=5.5e-29  Score=155.96  Aligned_cols=72  Identities=57%  Similarity=1.089  Sum_probs=68.1

Q ss_pred             cccC---ccCcHHHHHHHHHHhcCcccccccccCCcccCceEEEEcCccccccCCccCccCCCCEEEEEecCCCC
Q 035093            2 LSLT---FQLIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG   73 (73)
Q Consensus         2 ~~l~---~~~TV~~ll~~L~~~~~~~~~~l~~~~g~lr~~v~ilvNg~~i~~l~g~~t~l~dgD~V~i~PpvaGG   73 (73)
                      ++++   ++.||++||++|+++||++++++|+++|++|++|+|+|||+||++++|++|+|+|||+|+||||+|||
T Consensus        34 vel~~~~~~~TV~~Ll~~L~~~~~~~~~~lf~~~g~lr~~i~VlVN~~di~~l~gldt~L~dGDeV~iip~vaGG  108 (114)
T 1wgk_A           34 VALPGQEEPWDIRNLLVWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSILFISTLHGG  108 (114)
T ss_dssp             EEECCCSSCCBHHHHHHHHTTTTCCSCHHHHCCSSSCCSSEEEEESSSBHHHHCTTTCBCCSSEEEEEEECSCCC
T ss_pred             EEeCCCCCCCCHHHHHHHHHHHccchhHhhCccCCcccCCeEEEECCeeeeccCCcCcCCCCCCEEEEeCCCCCC
Confidence            5666   34799999999999999999999999999999999999999999999999999999999999999998
>2k9x_A Tburm1, uncharacterized protein; unknown function; NMR {Trypanosoma brucei} Back     alignment and structure
>2qjl_A URM1, ubiquitin-related modifier 1; ubiquitin-like protein, signaling protein; 1.44A {Saccharomyces cerevisiae} PDB: 2pko_A 2ax5_A Back     alignment and structure
>3dwg_C 9.5 kDa culture filtrate antigen CFP10A; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} PDB: 3dwm_A Back     alignment and structure
>3po0_A Small archaeal modifier protein 1; ubiquitin-like protein, protein binding; 1.55A {Haloferax volcanii} PDB: 2l83_A Back     alignment and structure
>2g1e_A Hypothetical protein TA0895; MOAD, molybdopterin, transferase; NMR {Thermoplasma acidophilum} PDB: 2k22_A Back     alignment and structure
>1vjk_A Molybdopterin converting factor, subunit 1; structural genomics, PSI, protein structure INI southeast collaboratory for structural genomics; 1.51A {Pyrococcus furiosus} SCOP: d.15.3.1 Back     alignment and structure
>2l52_A Methanosarcina acetivorans SAMP1 homolog; beta-grAsp fold, protein binding, E1-like, SAMP activator, ELSA, adenylation, ubiquitin; NMR {Methanosarcina acetivorans} Back     alignment and structure
>1v8c_A MOAD related protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, protein binding; 1.60A {Thermus thermophilus} SCOP: d.15.3.1 d.129.5.1 Back     alignment and structure
>1fm0_D Molybdopterin convertin factor, subunit 1; molybdenum cofactor biosynthesis, transferase; 1.45A {Escherichia coli} SCOP: d.15.3.1 PDB: 1fma_D 1jw9_D 1jwa_D* 1jwb_D* 3bii_D 1nvi_D Back     alignment and structure
>3rpf_C Molybdopterin converting factor, subunit 1 (MOAD); MCSG, PSI-biology, structural genomics, midwest center for S genomics, transferase; 1.90A {Helicobacter pylori} Back     alignment and structure
>2q5w_D Molybdopterin converting factor, subunit 1; MOCO, MPT synthase, MOAD, MOAE, transferase, molybdenum cofactor biosynthesis; 2.00A {Staphylococcus aureus} PDB: 2qie_B* Back     alignment and structure
>1f0z_A THis protein; ubiquitin fold, transport protein; NMR {Escherichia coli} SCOP: d.15.3.2 PDB: 1zud_2 Back     alignment and structure
>2cu3_A Unknown function protein; thermus thermophilus HB8, structural genomics, riken structu genomics/proteomics initiative, RSGI, NPPSFA; 1.70A {Thermus thermophilus} SCOP: d.15.3.2 PDB: 2htm_E Back     alignment and structure
>1tyg_B YJBS; alpha beta barrel, protein-protein complex, THis, BIOS protein; 3.15A {Bacillus subtilis} SCOP: d.15.3.2 Back     alignment and structure
>1rws_A Hypothetical protein PF1061; residual dipolar couplings, structural genomics, unknown FUN; NMR {Pyrococcus furiosus} SCOP: d.15.3.2 PDB: 1sf0_A Back     alignment and structure
>1ryj_A Unknown; beta/alpha protein, structural genomics, protein structure initiative, OCSP, NESG, PSI; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.15.3.2 Back     alignment and structure
>2k5p_A THis protein, thiamine-biosynthesis protein; NESG, GMR137, structural genomics, PSI-2, protein structure initiative; NMR {Geobacter metallireducens gs-15} PDB: 3cwi_A Back     alignment and structure
>2l32_A Small archaeal modifier protein 2; protein BIN; NMR {Haloferax volcanii} Back     alignment and structure
>2hj1_A Hypothetical protein; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; 2.10A {Haemophilus influenzae} SCOP: d.15.3.4 Back     alignment and structure
>2kmm_A Guanosine-3',5'-BIS(diphosphate) 3'- pyrophosphohydrolase; methods development, TGS domain, predominantly beta-sheet structure; NMR {Porphyromonas gingivalis} Back     alignment and structure
>3hvz_A Uncharacterized protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; 2.20A {Clostridium leptum} Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2eki_A DRG 1, developmentally-regulated GTP-binding protein 1; protein NEDD3, neural precursor cell expressed developmentally DOWN-regulated protein 3; NMR {Homo sapiens} Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Back     alignment and structure
>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>1wwt_A Threonyl-tRNA synthetase, cytoplasmic; TGS domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, ligase; NMR {Homo sapiens} Back     alignment and structure
>3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Back     alignment and structure
>3va4_A Mediator of DNA damage checkpoint protein 1; cell cycle, FHA domain, DNA-damage, CHK2 and MDC1 dimerizati; HET: TPO; 1.54A {Mus musculus} PDB: 3va1_A* 3umz_A 3unm_A 3unn_A* 3uot_A* 3un0_B Back     alignment and structure
>3fm8_A Kinesin-like protein KIF13B; kinesin, GAP, GTPase activation, structural genomics consort ATP-binding, cytoskeleton, microtubule, motor protein, NUCL binding; 2.30A {Homo sapiens} PDB: 3mdb_A* Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>4ejq_A Kinesin-like protein KIF1A; homodimer, FHA domain, transport protein; 1.89A {Homo sapiens} PDB: 2eh0_A 2g1l_A Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>1wln_A Afadin; beta sandwich, FHA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.26.1.2 Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>4h87_A Kanadaptin; FHA domain of PF00498, mRNA processing, nucleus, structural joint center for structural genomics, JCSG, protein structu initiative; HET: SO4; 1.55A {Homo sapiens} Back     alignment and structure
>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1tke_A Threonyl-tRNA synthetase; ligase; 1.46A {Escherichia coli} SCOP: d.15.10.1 d.67.1.1 PDB: 1tje_A 1tkg_A* 1tky_A* Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Back     alignment and structure
>2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>4egx_A Kinesin-like protein KIF1A; FHA domain, transport protein; 2.51A {Homo sapiens} Back     alignment and structure
>2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis} Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Back     alignment and structure
>1lgp_A Cell cycle checkpoint protein CHFR; FHA, tungstate, domain swapping; 2.00A {Homo sapiens} SCOP: b.26.1.2 PDB: 1lgq_A Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Back     alignment and structure
>2pie_A E3 ubiquitin-protein ligase RNF8; FHA domain, complex, ligase, signaling protein; HET: TPO; 1.35A {Homo sapiens} SCOP: b.26.1.2 Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>3u7z_A Putative metal binding protein rumgna_00854; the binding protein, transport protein, structural genomics, center for structural genomics; 1.30A {Ruminococcus gnavus} Back     alignment and structure
>1gxc_A CHK2, CDS1, serine/threonine-protein kinase CHK2; phosphoprotein-binding domain, checkpoint kinase, transferase; HET: TPO; 2.7A {Homo sapiens} SCOP: b.26.1.2 Back     alignment and structure
>2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Back     alignment and structure
>2pmv_A Gastric intrinsic factor; cobalamin transport protein alpha6-alpha6 motif two domain P transport protein; HET: NAG B12; 2.60A {Homo sapiens} PDB: 3kq4_A* Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3po8_A RV0020C protein, putative uncharacterized protein TB39.8; FHA domain, synthetic peptide, peptide binding protein; 1.50A {Mycobacterium tuberculosis} SCOP: b.26.1.0 PDB: 3poa_A* 2lc1_A Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>3hx1_A SLR1951 protein; P74513_SYNY3, adenylate cyclase-like protein, NESG, structural genomics, PSI-2, protein structure initiative; 2.50A {Synechocystis SP} Back     alignment and structure
>1uht_A Expressed protein; FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.26.1.2 Back     alignment and structure
>2jqj_A DNA damage response protein kinase DUN1; protein/phosphopeptide, cell cycle; HET: DNA; NMR {Saccharomyces cerevisiae} PDB: 2jql_A* Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure
>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2k6p_A Uncharacterized protein HP_1423; alpha-L motif, RNA-binding, unknown function; NMR {Helicobacter pylori} Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>2xt9_B Putative signal transduction protein GARA; lyase-signaling protein complex, KDH, KGD; HET: TPP; 2.20A {Mycobacterium smegmatis} Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3gqs_A Adenylate cyclase-like protein; FHA domain, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.20A {Chlamydia trachomatis} Back     alignment and structure
>1dmz_A Protein (protein kinase SPK1); beta-sandwich, antiparallel beta-sheets, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1fhq_A 1fhr_A* 1j4k_A* 1j4l_A* 1k2m_A* 1k2n_A* Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 Back     alignment and structure
>2csw_A Ubiquitin ligase protein RNF8; 11-stranded beta sandwich, ring finger protein 8, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.26.1.2 Back     alignment and structure
>2bb6_A TCII, TC II, transcobalamin II; alpha_6 - alpha_6 barrel, transport protein; HET: B12; 2.00A {Bos taurus} PDB: 2bbc_A* 2v3n_A* 2v3p_A* 2bb5_A* Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1g6g_A Protein kinase RAD53; beta-sandwich, phosphopeptide complex, cell cycle; HET: TPO; 1.60A {Saccharomyces cerevisiae} SCOP: b.26.1.2 Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1g3g_A Protien kinase SPK1; FHA domain, RAD53, phosphopeptide, phosphoprotein, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1j4o_A 1j4p_A* 1j4q_A* 1k3j_A 1k3n_A* 1k3q_A* 2a0t_A* 2jqi_A* Back     alignment and structure
>1qu5_A Protein kinase SPK1; FHA, RAD53, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 Back     alignment and structure
>2kfu_A RV1827 PThr 22; FHA domain, phosphorylation, intramolecular interaction, glutamate metabolism, phosphoprotein, protein binding; HET: TPO; NMR {Mycobacterium tuberculosis} PDB: 2kkl_A Back     alignment and structure
>3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} Back     alignment and structure
>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Back     alignment and structure
>3kt9_A Aprataxin; FHA domain, beta sandwich, beta sheet, AMP hydrolase, alternative splicing, disease mutation, DNA damage, DNA repair, DNA-binding; 1.65A {Homo sapiens} SCOP: b.26.1.0 Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Back     alignment and structure
>2kb3_A Oxoglutarate dehydrogenase inhibitor; forkhead-associated domain, kinase substrate, GARA, FHA, cytoplasm, phosphoprotein; HET: TPO; NMR {Corynebacterium glutamicum} PDB: 2kb4_A Back     alignment and structure
>1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Back     alignment and structure
>1dm9_A Hypothetical 15.5 KD protein in MRCA-PCKA intergenic region; heat shock proteins, protein-RNA interactions, ribosome, structural genomics; 2.00A {Escherichia coli} SCOP: d.66.1.3 PDB: 3bbu_A Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 73
d1xo3a_101 d.15.3.3 (A:) C9orf74 homolog {Mouse (Mus musculus 9e-19
d1v8ca187 d.15.3.1 (A:1-87) MoaD-related protein, N-terminal 9e-06
>d1xo3a_ d.15.3.3 (A:) C9orf74 homolog {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: MoaD/ThiS
family: C9orf74 homolog
domain: C9orf74 homolog
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 71.1 bits (174), Expect = 9e-19
 Identities = 40/64 (62%), Positives = 56/64 (87%)

Query: 10  MKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFIST 69
           +++LL W+  NL+KERPE+F++GDSVRPG+LVL+ND DWEL G+LD  L+++D ++FIST
Sbjct: 38  IRNLLVWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSILFIST 97

Query: 70  LHGG 73
           LHGG
Sbjct: 98  LHGG 101
>d1v8ca1 d.15.3.1 (A:1-87) MoaD-related protein, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 87 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query73
d1xo3a_101 C9orf74 homolog {Mouse (Mus musculus) [TaxId: 1009 99.95
d1v8ca187 MoaD-related protein, N-terminal domain {Thermus t 99.9
d1vjka_88 Molybdopterin synthase subunit MoaD {Pyrococcus fu 99.82
d1fm0d_81 Molybdopterin synthase subunit MoaD {Escherichia c 99.59
d1zud2165 Thiamin biosynthesis sulfur carrier protein ThiS { 98.97
d1rwsa_68 Hypothetical protein PF1061 {Archaeon Pyrococcus f 98.36
d1tygb_65 Thiamin biosynthesis sulfur carrier protein ThiS { 98.24
d2cu3a163 Uncharacterised protein TTHA0675 {Thermus thermoph 98.23
d2hj1a177 Hypothetical protein HI0395 {Haemophilus influenza 96.89
d1wxqa276 GTP-binding protein PH0525 {Pyrococcus horikoshii 96.84
d1tkea162 Threonyl-tRNA synthetase (ThrRS), N-terminal 'addi 96.48
d1nyra259 Threonyl-tRNA synthetase (ThrRS), N-terminal 'addi 95.21
d1euvb_79 SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy 94.29
d1ryja_70 Hypothetical protein MTH1743 {Archaeon Methanobact 94.15
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 93.99
d2bs2b2106 Fumarate reductase iron-sulfur protein, N-terminal 93.7
d2g1la1102 Kinesin-like protein kif1c {Human (Homo sapiens) [ 93.11
d1kf6b2105 Fumarate reductase iron-sulfur protein, N-terminal 92.51
d1wjna_97 Tubulin-folding protein TbcE {Mouse (Mus musculus) 92.47
d1v86a_95 hypothetical D7wsu128e protein {Mouse (Mus musculu 92.06
d1oqya477 Ubiquitin-like domain of Rad23 homolog A (Hhr23a) 91.25
d1gxca_116 Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} 90.9
d1z2ma176 Interferon-induced 15 kDa protein {Human (Homo sap 90.78
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 90.75
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 90.43
d1lgpa_113 Cell cycle checkpoint protein Chfr {Human (Homo sa 90.37
d1g6ga_127 Phosphotyrosine binding domain of Rad53 {Baker's y 89.36
d2brfa1101 Polynucleotide kinase 3'-phosphatase {Human (Homo 88.12
d1nekb2106 Succinate dehydogenase iron-sulfur protein, N-term 87.97
d1bt0a_73 Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI 87.59
d1c06a_159 Ribosomal protein S4 {Bacillus stearothermophilus 86.77
d1dm9a_104 Heat shock protein 15 kD {Escherichia coli [TaxId: 86.66
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 86.57
d2ff4a399 Probable regulatory protein EmbR, C-terminal domai 86.17
d2uyzb177 SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax 86.02
d2piea1127 Ubiquitin ligase protein RNF8 {Human (Homo sapiens 86.01
d2exda172 Hypothetical protein PH0471 {Pyrococcus horikoshii 85.67
d2bwfa173 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 85.37
d1wlna1107 Afadin {Mouse (Mus musculus) [TaxId: 10090]} 85.36
d1vioa258 Pseudouridine synthase RsuA N-terminal domain {Hae 85.36
d2affa198 Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} 84.84
d1wh3a_87 2'-5'-oligoadenylate synthetase-like protein, OASL 84.71
d2gy9d1204 Ribosomal protein S4 {Escherichia coli [TaxId: 562 84.26
d1mzka_122 Kinase associated protein phosphatase {Thale cress 83.85
d2uubd1208 Ribosomal protein S4 {Thermus thermophilus [TaxId: 83.11
d1v5oa_102 1700011n24rik protein {Mouse (Mus musculus) [TaxId 82.96
d1wgga_96 Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M 82.72
d1c1yb_77 c-Raf1 RBD {Human (Homo sapiens) [TaxId: 9606]} 82.42
d1yqba184 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 82.32
d1dmza_158 Phosphotyrosine binding domain of Rad53 {Baker's y 82.3
d1wx8a183 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 81.92
d1uela_95 Ubiquitin-like domain of Rad23 homolog B (Hhr23B) 81.76
d2zeqa178 Ubiquitin-like domain of parkin {Mouse (Mus muscul 81.38
d1wxva181 Bag-family molecular chaperone regulator-1 {Human 81.05
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 80.11
d1wxma173 A-Raf proto-oncogene serine/threonine-protein kina 80.08
>d1xo3a_ d.15.3.3 (A:) C9orf74 homolog {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: MoaD/ThiS
family: C9orf74 homolog
domain: C9orf74 homolog
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.95  E-value=4.3e-29  Score=151.39  Aligned_cols=68  Identities=59%  Similarity=1.119  Sum_probs=66.7

Q ss_pred             ccCcHHHHHHHHHHhcCcccccccccCCcccCceEEEEcCccccccCCccCccCCCCEEEEEecCCCC
Q 035093            6 FQLIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG   73 (73)
Q Consensus         6 ~~~TV~~ll~~L~~~~~~~~~~l~~~~g~lr~~v~ilvNg~~i~~l~g~~t~l~dgD~V~i~PpvaGG   73 (73)
                      ++.||++||++|+++||+.++++|+++|++|++|+|+|||+||++++|++|+|++||+|+||||+|||
T Consensus        34 ~~~TV~dll~~L~~~~p~~~~~l~~~~~~lr~~v~v~vN~~di~~l~gl~t~l~dgDeV~~~p~v~GG  101 (101)
T d1xo3a_          34 EPWDIRNLLVWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSILFISTLHGG  101 (101)
T ss_dssp             CCCCHHHHHHHHHHHHCCSCGGGSCCTTSCCSSEEEEETTEEHHHHTTTSCCCCTTCEEEEEETTCCC
T ss_pred             CCcCHHHHHHHHHHhCCcchhhhhccCcCeeeeEEEEEcCcceeccCCCccCcCCCCEEEEeCCCCCC
Confidence            57899999999999999999999999999999999999999999999999999999999999999998
>d1v8ca1 d.15.3.1 (A:1-87) MoaD-related protein, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vjka_ d.15.3.1 (A:) Molybdopterin synthase subunit MoaD {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fm0d_ d.15.3.1 (D:) Molybdopterin synthase subunit MoaD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zud21 d.15.3.2 (2:2-66) Thiamin biosynthesis sulfur carrier protein ThiS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rwsa_ d.15.3.2 (A:) Hypothetical protein PF1061 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1tygb_ d.15.3.2 (B:) Thiamin biosynthesis sulfur carrier protein ThiS {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cu3a1 d.15.3.2 (A:1-63) Uncharacterised protein TTHA0675 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2hj1a1 d.15.3.4 (A:11-87) Hypothetical protein HI0395 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wxqa2 d.15.10.2 (A:320-395) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1tkea1 d.15.10.1 (A:1-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nyra2 d.15.10.1 (A:4-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Back     information, alignment and structure
>d1ryja_ d.15.3.2 (A:) Hypothetical protein MTH1743 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d2g1la1 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxca_ b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lgpa_ b.26.1.2 (A:) Cell cycle checkpoint protein Chfr {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6ga_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2brfa1 b.26.1.2 (A:8-108) Polynucleotide kinase 3'-phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1c06a_ d.66.1.2 (A:) Ribosomal protein S4 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1dm9a_ d.66.1.3 (A:) Heat shock protein 15 kD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ff4a3 b.26.1.2 (A:284-382) Probable regulatory protein EmbR, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2piea1 b.26.1.2 (A:13-139) Ubiquitin ligase protein RNF8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2exda1 b.40.12.1 (A:72-143) Hypothetical protein PH0471 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wlna1 b.26.1.2 (A:8-114) Afadin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vioa2 d.66.1.5 (A:0-57) Pseudouridine synthase RsuA N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2affa1 b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gy9d1 d.66.1.2 (D:2-205) Ribosomal protein S4 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mzka_ b.26.1.2 (A:) Kinase associated protein phosphatase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2uubd1 d.66.1.2 (D:2-209) Ribosomal protein S4 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c1yb_ d.15.1.5 (B:) c-Raf1 RBD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dmza_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxma1 d.15.1.5 (A:8-80) A-Raf proto-oncogene serine/threonine-protein kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure