Citrus Sinensis ID: 035156

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--
MMMAYAVENFGIHVFRAKIGESNGASLCLFRKLGFEDISYSEIFKEVTLELPVENAKREELLVLTGNVVRHP
cHHHHHHHHccccEEEEEcccccHHHHHHHHHcccEEEEEEccEEEEEEEEEcccHHHHHHHHHHccccccc
cHHHHHHHHcccEEEEEEEccccHHHHHHHHHccccEEEHHHHEEEEEEEEcccHHHHHHHHHHHcccEccc
MMMAYAVENFGIHVFRAKigesngasLCLFRKlgfedisySEIFKEVTLelpvenakREELLVLTGNVVRHP
MMMAYAVENFGIHVFRAKIGESNGASLCLFRKLGFEDISYSEIFKEVTlelpvenakreellvltgnvvrhp
MMMAYAVENFGIHVFRAKIGESNGASLCLFRKLGFEDISYSEIFKEVTLELPVENAKREELLVLTGNVVRHP
***AYAVENFGIHVFRAKIGESNGASLCLFRKLGFEDISYSEIFKEVTLELPVENAKREELLVLTGNV****
MMMAYA*ENFGIHVFRAKIGESNGASLCLFRKLGFEDISYSEIFKEVTLELPVENAKREELLVLTGN*****
MMMAYAVENFGIHVFRAKIGESNGASLCLFRKLGFEDISYSEIFKEVTLELPVENAKREELLVLTGNVVRHP
MMMAYAVENFGIHVFRAKIGESNGASLCLFRKLGFEDISYSEIFKEVTLELPVENAKREELLVLTGNVVR**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooo
oooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMMAYAVENFGIHVFRAKIGESNGASLCLFRKLGFEDISYSEIFKEVTLELPVENAKREELLVLTGNVVRHP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query72 2.2.26 [Sep-21-2011]
Q9BTE0207 N-acetyltransferase 9 OS= yes no 0.986 0.342 0.408 4e-09
A7SLC8198 N-acetyltransferase 9-lik N/A no 0.763 0.277 0.509 1e-08
Q3UG98241 N-acetyltransferase 9 OS= yes no 1.0 0.298 0.375 2e-08
Q61FA3198 N-acetyltransferase 9-lik N/A no 0.75 0.272 0.490 3e-07
Q9BKR0202 N-acetyltransferase 9-lik yes no 0.722 0.257 0.509 1e-06
>sp|Q9BTE0|NAT9_HUMAN N-acetyltransferase 9 OS=Homo sapiens GN=NAT9 PE=2 SV=1 Back     alignment and function desciption
 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 44/71 (61%)

Query: 2   MMAYAVENFGIHVFRAKIGESNGASLCLFRKLGFEDISYSEIFKEVTLELPVENAKREEL 61
           M++Y V   G+  F AKIG+ N  S+ +F+KL FE ++ S +F+EVTL L V  ++ + L
Sbjct: 128 MLSYGVTTLGLTKFEAKIGQGNEPSIRMFQKLHFEQVATSSVFQEVTLRLTVSESEHQWL 187

Query: 62  LVLTGNVVRHP 72
           L  T +V   P
Sbjct: 188 LEQTSHVEEKP 198

Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: -
>sp|A7SLC8|NAT9_NEMVE N-acetyltransferase 9-like protein OS=Nematostella vectensis GN=nat9 PE=3 SV=1 Back     alignment and function description
>sp|Q3UG98|NAT9_MOUSE N-acetyltransferase 9 OS=Mus musculus GN=Nat9 PE=1 SV=2 Back     alignment and function description
>sp|Q61FA3|NAT9_CAEBR N-acetyltransferase 9-like protein OS=Caenorhabditis briggsae GN=CBG11716 PE=3 SV=1 Back     alignment and function description
>sp|Q9BKR0|NAT9_CAEEL N-acetyltransferase 9-like protein OS=Caenorhabditis elegans GN=Y67D2.5 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query72
255582437 197 expressed protein, putative [Ricinus com 0.986 0.360 0.746 9e-23
225447610 195 PREDICTED: N-acetyltransferase 9-like pr 0.986 0.364 0.760 1e-22
224129110 196 predicted protein [Populus trichocarpa] 0.986 0.362 0.704 2e-19
449453590 201 PREDICTED: N-acetyltransferase 9-like pr 0.986 0.353 0.661 1e-18
363814362 199 uncharacterized protein LOC100817900 [Gl 0.986 0.356 0.619 7e-18
297835786 214 hypothetical protein ARALYDRAFT_480115 [ 0.986 0.331 0.690 9e-18
21554294 214 unknown [Arabidopsis thaliana] 0.986 0.331 0.704 1e-15
357462591 203 N-acetyltransferase 9-like protein [Medi 0.986 0.349 0.577 3e-15
18395874 218 Acyl-CoA N-acyltransferase domain-contai 0.986 0.325 0.704 3e-15
242041903 215 hypothetical protein SORBIDRAFT_01g04419 0.763 0.255 0.709 4e-15
>gi|255582437|ref|XP_002532006.1| expressed protein, putative [Ricinus communis] gi|223528337|gb|EEF30379.1| expressed protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  110 bits (276), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 53/71 (74%), Positives = 61/71 (85%)

Query: 1   MMMAYAVENFGIHVFRAKIGESNGASLCLFRKLGFEDISYSEIFKEVTLELPVENAKREE 60
           MMMA+AV++ GIH+FRAKIGESNGASL +FR LGFE+ SYS+IFKEVTLELPV  +K EE
Sbjct: 124 MMMAHAVQDLGIHLFRAKIGESNGASLNMFRNLGFEEASYSKIFKEVTLELPVTKSKHEE 183

Query: 61  LLVLTGNVVRH 71
           LL L GNVV H
Sbjct: 184 LLNLIGNVVTH 194

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225447610|ref|XP_002273149.1| PREDICTED: N-acetyltransferase 9-like protein [Vitis vinifera] gi|296084990|emb|CBI28405.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224129110|ref|XP_002320503.1| predicted protein [Populus trichocarpa] gi|222861276|gb|EEE98818.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449453590|ref|XP_004144539.1| PREDICTED: N-acetyltransferase 9-like protein-like [Cucumis sativus] gi|449506903|ref|XP_004162879.1| PREDICTED: N-acetyltransferase 9-like protein-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|363814362|ref|NP_001242820.1| uncharacterized protein LOC100817900 [Glycine max] gi|255640478|gb|ACU20525.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|297835786|ref|XP_002885775.1| hypothetical protein ARALYDRAFT_480115 [Arabidopsis lyrata subsp. lyrata] gi|297331615|gb|EFH62034.1| hypothetical protein ARALYDRAFT_480115 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|21554294|gb|AAM63369.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357462591|ref|XP_003601577.1| N-acetyltransferase 9-like protein [Medicago truncatula] gi|355490625|gb|AES71828.1| N-acetyltransferase 9-like protein [Medicago truncatula] gi|388497608|gb|AFK36870.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|18395874|ref|NP_565315.1| Acyl-CoA N-acyltransferase domain-containing protein [Arabidopsis thaliana] gi|20197980|gb|AAM15335.1| Expressed protein [Arabidopsis thaliana] gi|330250780|gb|AEC05874.1| Acyl-CoA N-acyltransferase domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|242041903|ref|XP_002468346.1| hypothetical protein SORBIDRAFT_01g044190 [Sorghum bicolor] gi|241922200|gb|EER95344.1| hypothetical protein SORBIDRAFT_01g044190 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query72
TAIR|locus:505006237218 AT2G04845 "AT2G04845" [Arabido 0.986 0.325 0.704 2.7e-20
UNIPROTKB|F1NS03212 NAT9 "Uncharacterized protein" 0.944 0.320 0.485 1.2e-12
UNIPROTKB|F1RV66206 NAT9 "Uncharacterized protein" 1.0 0.349 0.430 3.5e-11
UNIPROTKB|F6RX64207 NAT9 "Uncharacterized protein" 1.0 0.347 0.438 5.2e-10
UNIPROTKB|J3KT72212 NAT9 "N-acetyltransferase 9" [ 0.986 0.334 0.408 6.6e-10
UNIPROTKB|J3QRL7211 NAT9 "N-acetyltransferase 9" [ 0.986 0.336 0.408 6.6e-10
UNIPROTKB|Q9BTE0207 NAT9 "N-acetyltransferase 9" [ 0.986 0.342 0.408 6.6e-10
UNIPROTKB|E2RGD7207 NAT9 "Uncharacterized protein" 0.944 0.328 0.449 1.1e-09
RGD|1307096241 Nat9 "N-acetyltransferase 9 (G 1.0 0.298 0.375 1.2e-09
MGI|MGI:1913426241 Nat9 "N-acetyltransferase 9 (G 1.0 0.298 0.375 2.8e-09
TAIR|locus:505006237 AT2G04845 "AT2G04845" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 240 (89.5 bits), Expect = 2.7e-20, P = 2.7e-20
 Identities = 50/71 (70%), Positives = 55/71 (77%)

Query:     1 MMMAYAVENFGIHVFRAKIGESNGASLCLFRKLGFEDISYSEIFKEVTLELPVENAKREE 60
             +MMAY V+N  IH F AKIGESN ASL LFRKLGFE+ SYS IFKEVTLE PV N +REE
Sbjct:   130 IMMAYGVKNLEIHKFTAKIGESNTASLSLFRKLGFEESSYSGIFKEVTLEYPVTNLRREE 189

Query:    61 LLVLTGNVVRH 71
             LL L   V+RH
Sbjct:   190 LLKLLDEVIRH 200
GO:0005575 "cellular_component" evidence=ND
GO:0008080 "N-acetyltransferase activity" evidence=IEA;ISS
GO:0008152 "metabolic process" evidence=ISS
UNIPROTKB|F1NS03 NAT9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1RV66 NAT9 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F6RX64 NAT9 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J3KT72 NAT9 "N-acetyltransferase 9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3QRL7 NAT9 "N-acetyltransferase 9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BTE0 NAT9 "N-acetyltransferase 9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RGD7 NAT9 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1307096 Nat9 "N-acetyltransferase 9 (GCN5-related, putative)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1913426 Nat9 "N-acetyltransferase 9 (GCN5-related, putative)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_LG_XIV1004
hypothetical protein (197 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query72
pfam13302136 pfam13302, Acetyltransf_3, Acetyltransferase (GNAT 1e-04
COG1247169 COG1247, COG1247, Sortase and related acyltransfer 0.003
>gnl|CDD|222034 pfam13302, Acetyltransf_3, Acetyltransferase (GNAT) domain Back     alignment and domain information 
 Score = 36.9 bits (86), Expect = 1e-04
 Identities = 13/36 (36%), Positives = 19/36 (52%)

Query: 1   MMMAYAVENFGIHVFRAKIGESNGASLCLFRKLGFE 36
            ++ YA E  G+    A+I   N AS  +  KLGF+
Sbjct: 101 ALLDYAFEELGLDRIVARIDPENIASQRVLEKLGFK 136

This domain catalyzes N-acetyltransferase reactions. Length = 136
>gnl|CDD|224168 COG1247, COG1247, Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 72
KOG4135185 consensus Predicted phosphoglucosamine acetyltrans 99.07
COG1670187 RimL Acetyltransferases, including N-acetylases of 99.07
PRK10809194 ribosomal-protein-S5-alanine N-acetyltransferase; 99.01
PRK10151179 ribosomal-protein-L7/L12-serine acetyltransferase; 99.0
TIGR03585156 PseH pseudaminic acid biosynthesis N-acetyl transf 98.9
PF13420155 Acetyltransf_4: Acetyltransferase (GNAT) domain; P 98.81
PRK15130186 spermidine N1-acetyltransferase; Provisional 98.79
PF13302142 Acetyltransf_3: Acetyltransferase (GNAT) domain; P 98.76
PRK10140162 putative acetyltransferase YhhY; Provisional 98.59
PF13523152 Acetyltransf_8: Acetyltransferase (GNAT) domain; P 98.54
COG1247169 Sortase and related acyltransferases [Cell envelop 98.4
TIGR02382191 wecD_rffC TDP-D-fucosamine acetyltransferase. This 98.29
PRK10975194 TDP-fucosamine acetyltransferase; Provisional 98.14
PRK10514145 putative acetyltransferase; Provisional 98.13
PRK03624140 putative acetyltransferase; Provisional 98.03
PRK09491146 rimI ribosomal-protein-alanine N-acetyltransferase 97.97
TIGR01575131 rimI ribosomal-protein-alanine acetyltransferase. 97.94
PF0058383 Acetyltransf_1: Acetyltransferase (GNAT) family; I 97.89
PRK10562145 putative acetyltransferase; Provisional 97.82
PF0844586 FR47: FR47-like protein; InterPro: IPR013653 Prote 97.67
TIGR02406157 ectoine_EctA L-2,4-diaminobutyric acid acetyltrans 97.63
TIGR03448292 mycothiol_MshD mycothiol biosynthesis acetyltransf 97.63
COG0456177 RimI Acetyltransferases [General function predicti 97.54
TIGR03827266 GNAT_ablB putative beta-lysine N-acetyltransferase 97.52
PLN02706150 glucosamine 6-phosphate N-acetyltransferase 97.43
PRK10146144 aminoalkylphosphonic acid N-acetyltransferase; Pro 97.43
KOG3139165 consensus N-acetyltransferase [General function pr 97.13
TIGR03103 547 trio_acet_GNAT GNAT-family acetyltransferase TIGR0 96.89
PTZ00330147 acetyltransferase; Provisional 96.77
TIGR01686320 FkbH FkbH-like domain. The C-terminal portion of t 96.47
TIGR03448 292 mycothiol_MshD mycothiol biosynthesis acetyltransf 96.13
PRK09831147 putative acyltransferase; Provisional 95.62
PF1350879 Acetyltransf_7: Acetyltransferase (GNAT) domain; P 95.57
PF13673117 Acetyltransf_10: Acetyltransferase (GNAT) domain; 95.47
KOG2488202 consensus Acetyltransferase (GNAT) domain-containi 94.89
KOG3138187 consensus Predicted N-acetyltransferase [General f 94.77
COG3981174 Predicted acetyltransferase [General function pred 94.62
PRK07757152 acetyltransferase; Provisional 94.02
PF12746265 GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S 93.38
COG3393268 Predicted acetyltransferase [General function pred 93.3
PF0844489 Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acylt 93.21
PRK10314153 putative acyltransferase; Provisional 92.44
PRK07922169 N-acetylglutamate synthase; Validated 92.31
KOG3216163 consensus Diamine acetyltransferase [Amino acid tr 91.46
PRK05279441 N-acetylglutamate synthase; Validated 91.19
KOG3234173 consensus Acetyltransferase, (GNAT) family [Genera 90.94
TIGR03827 266 GNAT_ablB putative beta-lysine N-acetyltransferase 90.72
PRK13688156 hypothetical protein; Provisional 90.56
cd02169 297 Citrate_lyase_ligase Citrate lyase ligase. Citrate 90.49
PHA01807153 hypothetical protein 90.11
TIGR00124 332 cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP 89.04
TIGR01211522 ELP3 histone acetyltransferase, ELP3 family. The S 88.58
PLN02825515 amino-acid N-acetyltransferase 88.49
TIGR01890429 N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi 87.57
PHA00432137 internal virion protein A 87.02
COG3818167 Predicted acetyltransferase, GNAT superfamily [Gen 86.78
PRK12308614 bifunctional argininosuccinate lyase/N-acetylgluta 86.4
PF1109086 DUF2833: Protein of unknown function (DUF2833); In 85.57
PHA01733153 hypothetical protein 80.39
TIGR03244336 arg_catab_AstA arginine N-succinyltransferase. In 80.02
>KOG4135 consensus Predicted phosphoglucosamine acetyltransferase [Carbohydrate transport and metabolism] Back     alignment and domain information 
Probab=99.07  E-value=1.6e-10  Score=77.13  Aligned_cols=54  Identities=39%  Similarity=0.584  Sum_probs=51.3

Q ss_pred             ChHHHHHhhcCceEEEEEeCCCCHHHHHHHHhcCCeEEEEeeeeeeeeEEeecc
Q 035156            1 MMMAYAVENFGIHVFRAKIGESNGASLCLFRKLGFEDISYSEIFKEVTLELPVE   54 (72)
Q Consensus         1 l~l~ya~~~l~l~~i~a~i~~~N~~Si~LfeklGF~~~g~~~~~~ev~~~~~~~   54 (72)
                      +|+.||.+.+++.++.++|+.+|.||++||+|++|..+....+|++|++++.++
T Consensus       131 ~ml~y~~s~l~l~Ky~vkig~~nk~sl~lFkk~~f~q~~~ns~f~~v~Le~~~t  184 (185)
T KOG4135|consen  131 AMLAYAYSVLKLDKYEVKIGMDNKPSLRLFKKFLFTQVFYNSSFPHVTLELDPT  184 (185)
T ss_pred             HHHHHHHHHhhhheEEEEecCCCchHHHHHHHhhheeeeeeccccceEEecCCC
Confidence            479999999999999999999999999999999999999999999999998764

>COG1670 RimL Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10809 ribosomal-protein-S5-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>PRK10151 ribosomal-protein-L7/L12-serine acetyltransferase; Provisional Back     alignment and domain information
>TIGR03585 PseH pseudaminic acid biosynthesis N-acetyl transferase Back     alignment and domain information
>PF13420 Acetyltransf_4: Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A Back     alignment and domain information
>PRK15130 spermidine N1-acetyltransferase; Provisional Back     alignment and domain information
>PF13302 Acetyltransf_3: Acetyltransferase (GNAT) domain; PDB: 3TTH_C 3JUW_A 2ZXV_A 2Z0Z_A 2VI7_B 3EG7_F 1YRE_C 3IGR_B 3FBU_A 2FCK_A Back     alignment and domain information
>PRK10140 putative acetyltransferase YhhY; Provisional Back     alignment and domain information
>PF13523 Acetyltransf_8: Acetyltransferase (GNAT) domain; PDB: 2VQY_A 2BUE_A 1V0C_A 1YK3_D 2PR8_A 2QIR_A 2PRB_A 2QML_A 2PC1_A Back     alignment and domain information
>COG1247 Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase Back     alignment and domain information
>PRK10975 TDP-fucosamine acetyltransferase; Provisional Back     alignment and domain information
>PRK10514 putative acetyltransferase; Provisional Back     alignment and domain information
>PRK03624 putative acetyltransferase; Provisional Back     alignment and domain information
>PRK09491 rimI ribosomal-protein-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>TIGR01575 rimI ribosomal-protein-alanine acetyltransferase Back     alignment and domain information
>PF00583 Acetyltransf_1: Acetyltransferase (GNAT) family; InterPro: IPR000182 The N-acetyltransferases (NAT) (EC 2 Back     alignment and domain information
>PRK10562 putative acetyltransferase; Provisional Back     alignment and domain information
>PF08445 FR47: FR47-like protein; InterPro: IPR013653 Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 (Q9VR51 from SWISSPROT) Back     alignment and domain information
>TIGR02406 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferase Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>COG0456 RimI Acetyltransferases [General function prediction only] Back     alignment and domain information
>TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase Back     alignment and domain information
>PLN02706 glucosamine 6-phosphate N-acetyltransferase Back     alignment and domain information
>PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional Back     alignment and domain information
>KOG3139 consensus N-acetyltransferase [General function prediction only] Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>PTZ00330 acetyltransferase; Provisional Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>PRK09831 putative acyltransferase; Provisional Back     alignment and domain information
>PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A Back     alignment and domain information
>PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A Back     alignment and domain information
>KOG2488 consensus Acetyltransferase (GNAT) domain-containing protein [General function prediction only] Back     alignment and domain information
>KOG3138 consensus Predicted N-acetyltransferase [General function prediction only] Back     alignment and domain information
>COG3981 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK07757 acetyltransferase; Provisional Back     alignment and domain information
>PF12746 GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S_B Back     alignment and domain information
>COG3393 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>PF08444 Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region; InterPro: IPR013652 This entry represents mammalian-specific glycine N-acyltransferase (also called aralkyl acyl-CoA:amino acid N-acyltransferase; 2 Back     alignment and domain information
>PRK10314 putative acyltransferase; Provisional Back     alignment and domain information
>PRK07922 N-acetylglutamate synthase; Validated Back     alignment and domain information
>KOG3216 consensus Diamine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05279 N-acetylglutamate synthase; Validated Back     alignment and domain information
>KOG3234 consensus Acetyltransferase, (GNAT) family [General function prediction only] Back     alignment and domain information
>TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase Back     alignment and domain information
>PRK13688 hypothetical protein; Provisional Back     alignment and domain information
>cd02169 Citrate_lyase_ligase Citrate lyase ligase Back     alignment and domain information
>PHA01807 hypothetical protein Back     alignment and domain information
>TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase Back     alignment and domain information
>TIGR01211 ELP3 histone acetyltransferase, ELP3 family Back     alignment and domain information
>PLN02825 amino-acid N-acetyltransferase Back     alignment and domain information
>TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase Back     alignment and domain information
>PHA00432 internal virion protein A Back     alignment and domain information
>COG3818 Predicted acetyltransferase, GNAT superfamily [General function prediction only] Back     alignment and domain information
>PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional Back     alignment and domain information
>PF11090 DUF2833: Protein of unknown function (DUF2833); InterPro: IPR020335 This entry contains proteins with no known function Back     alignment and domain information
>PHA01733 hypothetical protein Back     alignment and domain information
>TIGR03244 arg_catab_AstA arginine N-succinyltransferase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query72
3eo4_A164 Uncharacterized protein MJ1062; APC60792.2,MJ_1062 3e-06
1sqh_A312 Hypothetical protein CG14615-PA; structural genomi 5e-04
3f8k_A160 Protein acetyltransferase; GCN5-related N-acetyltr 6e-04
1vhs_A175 Similar to phosphinothricin acetyltransferase; str 7e-04
>3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} Length = 164 Back     alignment and structure
 Score = 41.2 bits (97), Expect = 3e-06
 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 4/52 (7%)

Query: 1   MMMAYAVENFGIHVFRAKIGESNGASLCLFRKLGFEDISY---SEIFKEVTL 49
           +++ +  +N G     A+I E+N  S+ LF  LGF+       +E   EV L
Sbjct: 114 LVLKWL-KNIGYKKAHARILENNIRSIKLFESLGFKKTKKGRENEWIYEVNL 164
>1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 Length = 312 Back     alignment and structure
>3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} Length = 160 Back     alignment and structure
>1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 Length = 175 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query72
3shp_A176 Putative acetyltransferase STHE_0691; PSI-biology, 99.24
3dns_A135 Ribosomal-protein-alanine acetyltransferase; N-ter 99.05
3r9f_A188 MCCE protein; microcin C7, acetyltransferase, SELF 99.0
3fbu_A168 Acetyltransferase, GNAT family; structur genomics, 98.98
3tcv_A246 GCN5-related N-acetyltransferase; GRAM negative co 98.95
3igr_A184 Ribosomal-protein-S5-alanine N-acetyltransferase; 98.93
2fl4_A149 Spermine/spermidine acetyltransferase; structural 98.93
3tth_A170 Spermidine N1-acetyltransferase; central intermedi 98.91
2z10_A194 Ribosomal-protein-alanine acetyltransferase; alpha 98.9
2vzy_A218 RV0802C; transferase, GCN5-related N-acetyltransfe 98.88
1yk3_A210 Hypothetical protein RV1347C/MT1389; acyltransfera 98.87
2vi7_A177 Acetyltransferase PA1377; GNAT, GCN5 family, N-ace 98.87
3pzj_A209 Probable acetyltransferases; MCSG, PSI-2, structur 98.86
3juw_A175 Probable GNAT-family acetyltransferase; structural 98.85
2jlm_A182 Putative phosphinothricin N-acetyltransferase; met 98.83
1nsl_A184 Probable acetyltransferase; structural genomics, h 98.82
2i79_A172 Acetyltransferase, GNAT family; acetyl coenzyme *A 98.82
2ge3_A170 Probable acetyltransferase; structural GEN PSI, pr 98.8
1vhs_A175 Similar to phosphinothricin acetyltransferase; str 98.79
3eg7_A176 Spermidine N1-acetyltransferase; structural genomi 98.75
1yre_A197 Hypothetical protein PA3270; APC5563, midwest cent 98.75
2zw5_A 301 Bleomycin acetyltransferase; dimer, two domains; H 98.74
2fck_A181 Ribosomal-protein-serine acetyltransferase, putat; 98.74
2qml_A198 BH2621 protein; structural genomics, joint center 98.73
3owc_A188 Probable acetyltransferase; structural genomics, P 98.71
2fsr_A195 Acetyltransferase; alpha-beta-sandwich, structural 98.71
3eo4_A164 Uncharacterized protein MJ1062; APC60792.2,MJ_1062 98.7
3g8w_A169 Lactococcal prophage PS3 protein 05; APC61042, ace 98.7
1s7k_A182 Acetyl transferase; GNAT; 1.80A {Salmonella typhim 98.68
2x7b_A168 N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf 98.66
2ae6_A166 Acetyltransferase, GNAT family; GCN5-related N-ace 98.64
2j8m_A172 Acetyltransferase PA4866 from P. aeruginosa; GCN5 98.62
1yr0_A175 AGR_C_1654P, phosphinothricin acetyltransferase; s 98.62
1on0_A158 YYCN protein; structural genomics, alpha-beta prot 98.58
2i6c_A160 Putative acetyltransferase; GNAT family, structura 98.58
2bue_A202 AAC(6')-IB; GNAT, transferase, aminoglycoside, flu 98.57
3f5b_A182 Aminoglycoside N(6')acetyltransferase; APC60744, l 98.52
2ob0_A170 Human MAK3 homolog; acetyltransferase, structural 98.48
3dr6_A174 YNCA; acetyltransferase, csgid target, essential g 98.47
2cnt_A160 Modification of 30S ribosomal subunit protein S18; 98.44
3kkw_A182 Putative uncharacterized protein; acetyltransferas 98.43
1s3z_A165 Aminoglycoside 6'-N-acetyltransferase; GNAT, amino 98.43
2cy2_A174 TTHA1209, probable acetyltransferase; structural g 98.42
4ava_A333 Lysine acetyltransferase; allosteric regulation, d 98.4
4e0a_A164 BH1408 protein; structural genomics, PSI-biology, 98.4
1tiq_A180 Protease synthase and sporulation negative regulat 98.38
3lod_A162 Putative acyl-COA N-acyltransferase; structural ge 98.37
4evy_A166 Aminoglycoside N(6')-acetyltransferase type 1; cen 98.37
2eui_A153 Probable acetyltransferase; dimer, structural geno 98.36
2oh1_A179 Acetyltransferase, GNAT family; YP_013287.1, struc 98.36
2fia_A162 Acetyltransferase; structural genomics, PSI, prote 98.36
1u6m_A199 Acetyltransferase, GNAT family; structural genomic 98.32
3d8p_A163 Acetyltransferase of GNAT family; NP_373092.1, str 98.31
1wwz_A159 Hypothetical protein PH1933; structural genomics, 98.31
2dxq_A150 AGR_C_4057P, acetyltransferase; structural genomic 98.3
1ufh_A180 YYCN protein; alpha and beta, fold, acetyltransfer 98.29
2pc1_A201 Acetyltransferase, GNAT family; NP_688560.1, struc 98.29
3pp9_A187 Putative streptothricin acetyltransferase; toxin p 98.29
2fe7_A166 Probable N-acetyltransferase; structural genomics, 98.27
3f8k_A160 Protein acetyltransferase; GCN5-related N-acetyltr 98.27
4h89_A173 GCN5-related N-acetyltransferase; N-acyltransferas 98.27
1ghe_A177 Acetyltransferase; acyl coenzyme A complex; HET: A 98.26
2q7b_A181 Acetyltransferase, GNAT family; NP_689019.1, struc 98.25
3h4q_A188 Putative acetyltransferase; NP_371943.1, structura 98.25
2bei_A170 Diamine acetyltransferase 2; SSAT2, BC011751, AAH1 98.24
3ld2_A197 SMU.2055, putative acetyltransferase; HET: COA; 2. 98.23
3i9s_A183 Integron cassette protein; oyster POND, woods HOLE 98.23
1mk4_A157 Hypothetical protein YQJY; alpha-beta-alpha sandwi 98.23
2b5g_A171 Diamine acetyltransferase 1; structural genomics, 98.21
1sqh_A312 Hypothetical protein CG14615-PA; structural genomi 98.21
3fix_A183 N-acetyltransferase; termoplasma acidophilum, stru 98.21
3fnc_A163 Protein LIN0611, putative acetyltransferase; GNAT, 98.19
2r1i_A172 GCN5-related N-acetyltransferase; YP_831484.1, put 98.18
3bln_A143 Acetyltransferase GNAT family; NP_981174.1, struct 98.17
2r7h_A177 Putative D-alanine N-acetyltransferase of GNAT FA; 98.14
1z4e_A153 Transcriptional regulator; nysgxrc target T2017, G 98.13
1qsm_A152 HPA2 histone acetyltransferase; protein-acetyl coe 98.12
3exn_A160 Probable acetyltransferase; GCN5-related N-acetylt 98.08
2ft0_A235 TDP-fucosamine acetyltransferase; GNAT fold acetyl 98.08
3dsb_A157 Putative acetyltransferase; APC60368.2, ST genomic 98.07
2wpx_A339 ORF14; transferase, acetyl transferase, antibiotic 98.06
2pdo_A144 Acetyltransferase YPEA; alpha-beta-alpha sandwich, 98.03
1y9k_A157 IAA acetyltransferase; structural genomics, midwes 98.02
1vkc_A158 Putative acetyl transferase; structural genomics, 97.98
1yvk_A163 Hypothetical protein BSU33890; ALPHS-beta protein, 97.96
3d3s_A189 L-2,4-diaminobutyric acid acetyltransferase; alpha 97.96
2g3a_A152 Acetyltransferase; structural genomics, PSI, prote 97.95
3ec4_A228 Putative acetyltransferase from the GNAT family; Y 97.95
2fiw_A172 GCN5-related N-acetyltransferase:aminotransferase 97.94
3t9y_A150 Acetyltransferase, GNAT family; PSI-biology, struc 97.92
3qb8_A197 A654L protein; GNAT N-acetyltransferase, acetyltra 97.9
3fyn_A176 Integron gene cassette protein HFX_CASS3; integron 97.88
2kcw_A147 Uncharacterized acetyltransferase YJAB; GNAT fold, 97.88
3jvn_A166 Acetyltransferase; alpha-beta protein, structural 97.87
1bo4_A168 Protein (serratia marcescens aminoglycoside-3-N- a 97.84
3c26_A266 Putative acetyltransferase TA0821; NP_394282.1, A 97.83
1p0h_A318 Hypothetical protein RV0819; GNAT fold, acetyltran 97.82
2aj6_A159 Hypothetical protein MW0638; structural genomics, 97.8
3iwg_A276 Acetyltransferase, GNAT family; structural genomic 97.76
1yx0_A159 Hypothetical protein YSNE; NESG, GFT structral gen 97.76
2gan_A190 182AA long hypothetical protein; alpha-beta protei 97.68
4fd4_A217 Arylalkylamine N-acetyltransferase like 5B; GNAT; 97.61
1cjw_A166 Protein (serotonin N-acetyltransferase); HET: COT; 97.6
1n71_A180 AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, 97.56
3i3g_A161 N-acetyltransferase; malaria, structural genomics, 97.53
1i12_A160 Glucosamine-phosphate N-acetyltransferase; GNAT, a 97.51
1ygh_A164 ADA4, protein (transcriptional activator GCN5); tr 97.46
2qec_A204 Histone acetyltransferase HPA2 and related acetylt 97.44
3ey5_A181 Acetyltransferase-like, GNAT family; structural ge 97.37
1y9w_A140 Acetyltransferase; structural genomics, Pro struct 97.37
1qst_A160 TGCN5 histone acetyl transferase; GCN5-related N-a 97.36
2ree_A224 CURA; GNAT, S-acetyltransferase, decarboxylase, po 97.36
3tt2_A330 GCN5-related N-acetyltransferase; structural genom 97.33
3g3s_A249 GCN5-related N-acetyltransferase; ZP_00874857.1, a 97.33
2atr_A138 Acetyltransferase, GNAT family; MCSG, structural g 97.31
1kux_A207 Aralkylamine, serotonin N-acetyltransferase; enzym 97.25
1y7r_A133 Hypothetical protein SA2161; structural genomics, 97.16
2o28_A184 Glucosamine 6-phosphate N-acetyltransferase; struc 97.15
2wpx_A 339 ORF14; transferase, acetyl transferase, antibiotic 97.14
1m4i_A181 Aminoglycoside 2'-N-acetyltransferase; COA binding 97.09
3mgd_A157 Predicted acetyltransferase; structural genomics, 97.05
3frm_A254 Uncharacterized conserved protein; APC61048, staph 97.01
4fd7_A238 Putative arylalkylamine N-acetyltransferase 7; GNA 97.0
2q04_A211 Acetoin utilization protein; ZP_00540088.1, struct 96.95
1xeb_A150 Hypothetical protein PA0115; midwest center for st 96.94
3efa_A147 Putative acetyltransferase; structural genom 2, pr 96.89
3te4_A215 GH12636P, dopamine N acetyltransferase, isoform A; 96.85
1q2y_A140 Protein YJCF, similar to hypothetical proteins; GC 96.78
3ddd_A 288 Putative acetyltransferase; NP_142035.1, structura 96.75
3t90_A149 Glucose-6-phosphate acetyltransferase 1; GNAT fold 96.74
2vez_A190 Putative glucosamine 6-phosphate acetyltransferase 96.72
2jdc_A146 Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1. 96.71
4ag7_A165 Glucosamine-6-phosphate N-acetyltransferase; HET: 96.67
3e0k_A150 Amino-acid acetyltransferase; N-acetylglutamate sy 96.67
4fd5_A222 Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A 96.66
3gy9_A150 GCN5-related N-acetyltransferase; YP_001815201.1, 96.59
2q0y_A153 GCN5-related N-acetyltransferase; YP_295895.1, ace 96.35
2pr1_A163 Uncharacterized N-acetyltransferase YLBP; YIBP pro 96.17
3tt2_A 330 GCN5-related N-acetyltransferase; structural genom 96.14
2ozh_A142 Hypothetical protein XCC2953; structural genomics, 96.06
2d4p_A141 Hypothetical protein TTHA1254; structural genomics 96.04
1z4r_A168 General control of amino acid synthesis protein 5- 95.9
1p0h_A 318 Hypothetical protein RV0819; GNAT fold, acetyltran 95.05
2ozg_A 396 GCN5-related N-acetyltransferase; YP_325469.1, ace 95.03
2g0b_A198 FEEM; N-acyl transferase, environmental DNA, prote 94.92
3d2m_A456 Putative acetylglutamate synthase; protein-COA-Glu 94.89
2k5t_A128 Uncharacterized protein YHHK; N-acetyl transferase 94.78
3s6f_A145 Hypothetical acetyltransferase; acyl-COA N-acyltra 94.67
3ddd_A288 Putative acetyltransferase; NP_142035.1, structura 93.85
2zpa_A 671 Uncharacterized protein YPFI; RNA modification enz 91.42
1ro5_A201 Autoinducer synthesis protein LASI; alpha-beta-alp 89.76
3p2h_A201 AHL synthase; acyl-ACP binding, SAM binding, signa 85.99
2i00_A 406 Acetyltransferase, GNAT family; structural genomic 82.05
>3shp_A Putative acetyltransferase STHE_0691; PSI-biology, midwest center for structural genomics, MCSG; HET: SRT; 2.21A {Sphaerobacter thermophilus} Back     alignment and structure
Probab=99.24  E-value=3.1e-11  Score=76.15  Aligned_cols=41  Identities=10%  Similarity=0.197  Sum_probs=39.1

Q ss_pred             hHHHHHhhcCceEEEEEeCCCCHHHHHHHHhcCCeEEEEee
Q 035156            2 MMAYAVENFGIHVFRAKIGESNGASLCLFRKLGFEDISYSE   42 (72)
Q Consensus         2 ~l~ya~~~l~l~~i~a~i~~~N~~Si~LfeklGF~~~g~~~   42 (72)
                      +++|+|+.+|++++++.|.++|.+|+++++|+||+.+|+.+
T Consensus       109 ll~~af~~~~~~~i~~~v~~~N~~s~~l~ek~GF~~~G~~r  149 (176)
T 3shp_A          109 VVPWLRDEHELLVITVEIAADEQRTLAAAEAAGLKAAVRMR  149 (176)
T ss_dssp             HHHHHHHHSCCSEEEEEEETTCHHHHHHHHHTTCEEEEEEE
T ss_pred             HHHHHHhhCCeEEEEEEEcCCCHHHHHHHHHCCCEEEEEee
Confidence            68999999999999999999999999999999999999764
>3dns_A Ribosomal-protein-alanine acetyltransferase; N-terminal domain of ribosomal-protein-alanine acetyltransfe MCSG, PSI; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3r9f_A MCCE protein; microcin C7, acetyltransferase, SELF immunity, resistance, A coenzyme A, transferase; HET: COA GSU; 1.20A {Escherichia coli} PDB: 3r95_A* 3r96_A* 3r9e_A* 3r9g_A* Back     alignment and structure
>3fbu_A Acetyltransferase, GNAT family; structur genomics, PSI2, MCSG, protein structure initiative, midwest for structural genomics; HET: COA; 1.80A {Bacillus anthracis str} Back     alignment and structure
>3tcv_A GCN5-related N-acetyltransferase; GRAM negative coccobacillus, brucellosis, acyl CO-A, arylami transferase; 1.75A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} Back     alignment and structure
>3igr_A Ribosomal-protein-S5-alanine N-acetyltransferase; fisch MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.00A {Vibrio fischeri} SCOP: d.108.1.0 Back     alignment and structure
>2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii} Back     alignment and structure
>2z10_A Ribosomal-protein-alanine acetyltransferase; alpha/beta protein, acyltransferase, structural genomics, NPPSFA; HET: IYR; 1.77A {Thermus thermophilus} PDB: 2z0z_A* 2z11_A* 2zxv_A* Back     alignment and structure
>2vzy_A RV0802C; transferase, GCN5-related N-acetyltransferase, succinyltransferase; HET: FLC; 2.00A {Mycobacterium tuberculosis} PDB: 2vzz_A* Back     alignment and structure
>1yk3_A Hypothetical protein RV1347C/MT1389; acyltransferase, GCN5-related fold, structural genomics, PSI, protein structure initiative; HET: BOG; 2.20A {Mycobacterium tuberculosis} SCOP: d.108.1.1 Back     alignment and structure
>2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>3pzj_A Probable acetyltransferases; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: MSE; 1.85A {Chromobacterium violaceum} Back     alignment and structure
>3juw_A Probable GNAT-family acetyltransferase; structural genomics, APC60242, acetyltransferas protein structure initiative; HET: MSE; 2.11A {Bordetella pertussis} Back     alignment and structure
>2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi} Back     alignment and structure
>1nsl_A Probable acetyltransferase; structural genomics, hexamer, alpha-beta, PSI, protein struc initiative, midwest center for structural genomics; 2.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} Back     alignment and structure
>2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 Back     alignment and structure
>1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} SCOP: d.108.1.0 Back     alignment and structure
>1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSC protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* Back     alignment and structure
>2fck_A Ribosomal-protein-serine acetyltransferase, putat; ribosomal-protein structural genomics, PSI, protein structure initiative; HET: MSE; 1.70A {Vibrio cholerae o1 biovar eltor} SCOP: d.108.1.1 Back     alignment and structure
>2qml_A BH2621 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 1.55A {Bacillus halodurans} Back     alignment and structure
>3owc_A Probable acetyltransferase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2fsr_A Acetyltransferase; alpha-beta-sandwich, structural genomics, PSI, protein struc initiative, midwest center for structural genomics; HET: PEG; 1.52A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} Back     alignment and structure
>3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>1s7k_A Acetyl transferase; GNAT; 1.80A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 1s7l_A* 1s7n_A* 1s7f_A 1z9u_A Back     alignment and structure
>2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} Back     alignment and structure
>2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A Back     alignment and structure
>1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* Back     alignment and structure
>2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A* Back     alignment and structure
>3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp} Back     alignment and structure
>2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* Back     alignment and structure
>3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 3dr8_A* Back     alignment and structure
>2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* Back     alignment and structure
>3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* Back     alignment and structure
>2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* Back     alignment and structure
>1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A Back     alignment and structure
>2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 Back     alignment and structure
>2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} Back     alignment and structure
>2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} Back     alignment and structure
>3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} Back     alignment and structure
>2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 Back     alignment and structure
>3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} Back     alignment and structure
>4h89_A GCN5-related N-acetyltransferase; N-acyltransferase superfamily, structural genomics, PSI-BIOL midwest center for structural genomics, MCSG; 1.37A {Kribbella flavida} Back     alignment and structure
>1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* Back     alignment and structure
>2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} Back     alignment and structure
>3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE P33; 2.50A {Staphylococcus aureus subsp} Back     alignment and structure
>2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* Back     alignment and structure
>3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} Back     alignment and structure
>3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} Back     alignment and structure
>1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* Back     alignment and structure
>1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 Back     alignment and structure
>3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* Back     alignment and structure
>3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} SCOP: d.108.1.0 Back     alignment and structure
>2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} Back     alignment and structure
>3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} Back     alignment and structure
>2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 Back     alignment and structure
>1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A Back     alignment and structure
>3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} Back     alignment and structure
>2ft0_A TDP-fucosamine acetyltransferase; GNAT fold acetyltransferase, structural genomics, montreal-K bacterial structural genomics initiative, BSGI; HET: ACO; 1.66A {Escherichia coli} PDB: 2fs5_A* Back     alignment and structure
>3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Back     alignment and structure
>2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} Back     alignment and structure
>1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 Back     alignment and structure
>1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 Back     alignment and structure
>1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} Back     alignment and structure
>2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 Back     alignment and structure
>3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} Back     alignment and structure
>3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} Back     alignment and structure
>3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} Back     alignment and structure
>2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} Back     alignment and structure
>3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} Back     alignment and structure
>1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 Back     alignment and structure
>3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Back     alignment and structure
>2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 Back     alignment and structure
>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} Back     alignment and structure
>1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti} Back     alignment and structure
>1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A Back     alignment and structure
>1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* Back     alignment and structure
>3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A Back     alignment and structure
>1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A Back     alignment and structure
>1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Back     alignment and structure
>2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 Back     alignment and structure
>1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* Back     alignment and structure
>2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* Back     alignment and structure
>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Back     alignment and structure
>3g3s_A GCN5-related N-acetyltransferase; ZP_00874857.1, acetyltransferase (GNAT) family, structural joint center for structural genomics, JCSG; HET: MSE; 1.80A {Streptococcus suis} Back     alignment and structure
>2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 Back     alignment and structure
>1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* Back     alignment and structure
>1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 Back     alignment and structure
>2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Back     alignment and structure
>1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* Back     alignment and structure
>3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Back     alignment and structure
>3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} Back     alignment and structure
>4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti} Back     alignment and structure
>2q04_A Acetoin utilization protein; ZP_00540088.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.33A {Exiguobacterium sibiricum} Back     alignment and structure
>1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural GEN protein structure initiative, PSI, APC22065; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} PDB: 3v8i_A* Back     alignment and structure
>1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} Back     alignment and structure
>3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} Back     alignment and structure
>2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* Back     alignment and structure
>2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* Back     alignment and structure
>4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* Back     alignment and structure
>3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} Back     alignment and structure
>4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A Back     alignment and structure
>3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* Back     alignment and structure
>2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Back     alignment and structure
>2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein, coenzyme A, structural GE PSI-2, protein structure initiative; HET: SUC COA; 3.20A {Bacillus subtilis} Back     alignment and structure
>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Back     alignment and structure
>2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV} Back     alignment and structure
>2d4p_A Hypothetical protein TTHA1254; structural genomics, NPPSFA, national project on protein STR and functional analyses; 1.70A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 2d4o_A Back     alignment and structure
>1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Back     alignment and structure
>2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>2g0b_A FEEM; N-acyl transferase, environmental DNA, protein-product compl antibiotic synthase, transferase; HET: NLT; 3.00A {Uncultured bacterium} Back     alignment and structure
>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Back     alignment and structure
>2k5t_A Uncharacterized protein YHHK; N-acetyl transferase, COA, bound ligand, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: COA; NMR {Escherichia coli K12} Back     alignment and structure
>3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} Back     alignment and structure
>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>1ro5_A Autoinducer synthesis protein LASI; alpha-beta-alpha sandwich, phosphopantetheine fold, signalin; 2.30A {Pseudomonas aeruginosa} SCOP: d.108.1.3 Back     alignment and structure
>3p2h_A AHL synthase; acyl-ACP binding, SAM binding, signaling protein-I MTA complex, signaling protein-inhibitor complex; HET: MTA NOO; 2.00A {Burkholderia glumae} PDB: 3p2f_A* Back     alignment and structure
>2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query72
d2fcka1178 Putative ribosomal-protein-serine acetyltransferas 99.21
d1s7ka1174 L7/L12-Ribosomal-protein-serine acetyltransferase 99.2
d2fsra1164 Probable acetyltranferase Atu2435 {Agrobacterium t 99.17
d1nsla_180 Probable acetyltransferase YdaF {Bacillus subtilis 99.17
d1yrea1183 Hypothetical protein PA3270 {Pseudomonas aeruginos 99.11
d1yk3a1198 Hypothetical protein Rv1347c/MT1389 {Mycobacterium 98.93
d1vhsa_165 Putative phosphinothricin acetyltransferase YwnH { 98.84
d2ge3a1164 Probable acetyltransferase Atu2290 {Agrobacterium 98.8
d1yvoa1169 Hypothetical protein PA4866 {Pseudomonas aeruginos 98.78
d2fl4a1146 Probable spermine/spermidine acetyltransferase EF1 98.77
d1yr0a1163 Phosphinothricin acetyltransferase {Agrobacterium 98.66
d2i6ca1160 Putative acetyltransferase PA4794 {Pseudomonas aer 98.66
d2ae6a1161 Putative acetyltransferase EF0244 {Enterococcus fa 98.63
d2cy2a1174 Probable acetyltransferase TTHA1209 {Thermus therm 98.6
d1ufha_155 Putative acetyltransferase YycN {Bacillus subtilis 98.48
d1s3za_147 Aminoglycoside N-acetyltransferase AAC(6')-IY {Sal 98.47
d2beia1167 Diamine acetyltransferase 2 {Human (Homo sapiens) 98.42
d2fiaa1157 Probable acetyltransferase EF1919 {Enterococcus fa 98.37
d1mk4a_157 Hypothetical protein YqiY {Bacillus subtilis [TaxI 98.34
d2b5ga1167 Diamine acetyltransferase 1 {Human (Homo sapiens) 98.31
d1qsma_150 Histone acetyltransferase HPA2 {Baker's yeast (Sac 98.3
d1u6ma_189 Putative acetyltransferase EF0945 {Enterococcus fa 98.28
d2euia1153 Probable acetyltransferase PA4026 {Pseudomonas aer 98.24
d1tiqa_173 Protease synthase and sporulation negative regulat 98.24
d1yvka1152 Hypothetical protein YvbK (BSu33890) {Bacillus sub 98.18
d1y9ka1152 IAA acetyltransferase {Bacillus cereus [TaxId: 139 98.09
d1wwza1157 Hypothetical protein PH1933 {Pyrococcus horikoshii 98.08
d1z4ea1150 Transcriptional regulator BH1968 {Bacillus halodur 98.05
d1p0ha_308 Mycothiol synthase MshD {Mycobacterium tuberculosi 98.04
d1sqha_297 Hypothetical protein cg14615-pa {Fruit fly (Drosop 98.01
d2fe7a1156 Probable N-acetyltransferase PA0478 {Pseudomonas a 97.95
d1vkca_149 Putative acetyltransferase PF0028 {Pyrococcus furi 97.87
d1ghea_170 Tabtoxin resistance protein {Pseudomonas syringae 97.73
d1cjwa_166 Serotonin N-acetyltranferase {Sheep (Ovis aries) [ 97.66
d1y9wa1140 Probable acetyltransferase BC2806 {Bacillus cereus 97.57
d2gana1182 Hypothetical protein PH0736 {Pyrococcus horikoshii 97.5
d2g3aa1137 Probable acetyltransferase Atu2258 {Agrobacterium 97.47
d1i12a_157 Glucosamine-phosphate N-acetyltransferase GNA1 {Ba 97.43
d1n71a_180 Aminoglycoside 6'-N-acetyltransferase {Enterococcu 97.07
d1yx0a1151 Hypothetical protein YsnE {Bacillus subtilis [TaxI 97.02
d2fiwa1156 Probable N-acetyltransferase RPA1999 {Rhodopseudom 96.93
d1bo4a_137 Aminoglycoside 3-N-acetyltransferase {Serratia mar 96.51
d2atra1137 Probable acetyltransferase SP0256 {Streptococcus p 96.22
d1y7ra1133 Hypothetical protein SA2161 {Staphylococcus aureus 95.88
d2jdca1145 Probable acetyltransferase YitI {Bacillus lichenif 95.81
d1ygha_164 Catalytic domain of GCN5 histone acetyltransferase 95.25
d1q2ya_140 Probable acetyltransferase YjcF {Bacillus subtilis 95.06
d1z4ra1162 Catalytic domain of GCN5 histone acetyltransferase 95.05
d1qsra_162 Catalytic domain of GCN5 histone acetyltransferase 95.0
d1xeba_149 Hypothetical protein PA0115 {Pseudomonas aeruginos 90.34
d1cjxa1150 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom 87.25
>d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Acyl-CoA N-acyltransferases (Nat)
superfamily: Acyl-CoA N-acyltransferases (Nat)
family: N-acetyl transferase, NAT
domain: Putative ribosomal-protein-serine acetyltransferase VC1889
species: Vibrio cholerae [TaxId: 666]

Probab=99.21  E-value=7.3e-12  Score=78.30  Aligned_cols=43  Identities=12%  Similarity=0.108  Sum_probs=40.0

Q ss_pred             hHHHHHhhcCceEEEEEeCCCCHHHHHHHHhcCCeEEEEeeee
Q 035156            2 MMAYAVENFGIHVFRAKIGESNGASLCLFRKLGFEDISYSEIF   44 (72)
Q Consensus         2 ~l~ya~~~l~l~~i~a~i~~~N~~Si~LfeklGF~~~g~~~~~   44 (72)
                      +++|+|+.++++++.|.|.++|.+|+++++|+||+.+|+.+.+
T Consensus       119 l~~~af~~~~~~~i~~~~~~~N~~s~~l~ek~GF~~eg~~~~~  161 (178)
T d2fcka1         119 LILFCFERLELTRLEIVCDPENVPSQALALRCGANREQLAPNR  161 (178)
T ss_dssp             HHHHHHHTSCCSEEEEEECTTCHHHHHHHHHTTCEEEEEEEEE
T ss_pred             eeeeeccccCcceeeEecCCCcHHHHHHHHHCCCEEEEEEeeE
Confidence            7899999999999999999999999999999999999976543
>d1s7ka1 d.108.1.1 (A:3-176) L7/L12-Ribosomal-protein-serine acetyltransferase RimL {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2fsra1 d.108.1.1 (A:4-167) Probable acetyltranferase Atu2435 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nsla_ d.108.1.1 (A:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yrea1 d.108.1.1 (A:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} Back     information, alignment and structure
>d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} Back     information, alignment and structure
>d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1cjxa1 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure