Citrus Sinensis ID: 035156
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 72 | ||||||
| 255582437 | 197 | expressed protein, putative [Ricinus com | 0.986 | 0.360 | 0.746 | 9e-23 | |
| 225447610 | 195 | PREDICTED: N-acetyltransferase 9-like pr | 0.986 | 0.364 | 0.760 | 1e-22 | |
| 224129110 | 196 | predicted protein [Populus trichocarpa] | 0.986 | 0.362 | 0.704 | 2e-19 | |
| 449453590 | 201 | PREDICTED: N-acetyltransferase 9-like pr | 0.986 | 0.353 | 0.661 | 1e-18 | |
| 363814362 | 199 | uncharacterized protein LOC100817900 [Gl | 0.986 | 0.356 | 0.619 | 7e-18 | |
| 297835786 | 214 | hypothetical protein ARALYDRAFT_480115 [ | 0.986 | 0.331 | 0.690 | 9e-18 | |
| 21554294 | 214 | unknown [Arabidopsis thaliana] | 0.986 | 0.331 | 0.704 | 1e-15 | |
| 357462591 | 203 | N-acetyltransferase 9-like protein [Medi | 0.986 | 0.349 | 0.577 | 3e-15 | |
| 18395874 | 218 | Acyl-CoA N-acyltransferase domain-contai | 0.986 | 0.325 | 0.704 | 3e-15 | |
| 242041903 | 215 | hypothetical protein SORBIDRAFT_01g04419 | 0.763 | 0.255 | 0.709 | 4e-15 |
| >gi|255582437|ref|XP_002532006.1| expressed protein, putative [Ricinus communis] gi|223528337|gb|EEF30379.1| expressed protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 110 bits (276), Expect = 9e-23, Method: Compositional matrix adjust.
Identities = 53/71 (74%), Positives = 61/71 (85%)
Query: 1 MMMAYAVENFGIHVFRAKIGESNGASLCLFRKLGFEDISYSEIFKEVTLELPVENAKREE 60
MMMA+AV++ GIH+FRAKIGESNGASL +FR LGFE+ SYS+IFKEVTLELPV +K EE
Sbjct: 124 MMMAHAVQDLGIHLFRAKIGESNGASLNMFRNLGFEEASYSKIFKEVTLELPVTKSKHEE 183
Query: 61 LLVLTGNVVRH 71
LL L GNVV H
Sbjct: 184 LLNLIGNVVTH 194
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225447610|ref|XP_002273149.1| PREDICTED: N-acetyltransferase 9-like protein [Vitis vinifera] gi|296084990|emb|CBI28405.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224129110|ref|XP_002320503.1| predicted protein [Populus trichocarpa] gi|222861276|gb|EEE98818.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449453590|ref|XP_004144539.1| PREDICTED: N-acetyltransferase 9-like protein-like [Cucumis sativus] gi|449506903|ref|XP_004162879.1| PREDICTED: N-acetyltransferase 9-like protein-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|363814362|ref|NP_001242820.1| uncharacterized protein LOC100817900 [Glycine max] gi|255640478|gb|ACU20525.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297835786|ref|XP_002885775.1| hypothetical protein ARALYDRAFT_480115 [Arabidopsis lyrata subsp. lyrata] gi|297331615|gb|EFH62034.1| hypothetical protein ARALYDRAFT_480115 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|21554294|gb|AAM63369.1| unknown [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|357462591|ref|XP_003601577.1| N-acetyltransferase 9-like protein [Medicago truncatula] gi|355490625|gb|AES71828.1| N-acetyltransferase 9-like protein [Medicago truncatula] gi|388497608|gb|AFK36870.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|18395874|ref|NP_565315.1| Acyl-CoA N-acyltransferase domain-containing protein [Arabidopsis thaliana] gi|20197980|gb|AAM15335.1| Expressed protein [Arabidopsis thaliana] gi|330250780|gb|AEC05874.1| Acyl-CoA N-acyltransferase domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|242041903|ref|XP_002468346.1| hypothetical protein SORBIDRAFT_01g044190 [Sorghum bicolor] gi|241922200|gb|EER95344.1| hypothetical protein SORBIDRAFT_01g044190 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 72 | ||||||
| TAIR|locus:505006237 | 218 | AT2G04845 "AT2G04845" [Arabido | 0.986 | 0.325 | 0.704 | 2.7e-20 | |
| UNIPROTKB|F1NS03 | 212 | NAT9 "Uncharacterized protein" | 0.944 | 0.320 | 0.485 | 1.2e-12 | |
| UNIPROTKB|F1RV66 | 206 | NAT9 "Uncharacterized protein" | 1.0 | 0.349 | 0.430 | 3.5e-11 | |
| UNIPROTKB|F6RX64 | 207 | NAT9 "Uncharacterized protein" | 1.0 | 0.347 | 0.438 | 5.2e-10 | |
| UNIPROTKB|J3KT72 | 212 | NAT9 "N-acetyltransferase 9" [ | 0.986 | 0.334 | 0.408 | 6.6e-10 | |
| UNIPROTKB|J3QRL7 | 211 | NAT9 "N-acetyltransferase 9" [ | 0.986 | 0.336 | 0.408 | 6.6e-10 | |
| UNIPROTKB|Q9BTE0 | 207 | NAT9 "N-acetyltransferase 9" [ | 0.986 | 0.342 | 0.408 | 6.6e-10 | |
| UNIPROTKB|E2RGD7 | 207 | NAT9 "Uncharacterized protein" | 0.944 | 0.328 | 0.449 | 1.1e-09 | |
| RGD|1307096 | 241 | Nat9 "N-acetyltransferase 9 (G | 1.0 | 0.298 | 0.375 | 1.2e-09 | |
| MGI|MGI:1913426 | 241 | Nat9 "N-acetyltransferase 9 (G | 1.0 | 0.298 | 0.375 | 2.8e-09 |
| TAIR|locus:505006237 AT2G04845 "AT2G04845" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 240 (89.5 bits), Expect = 2.7e-20, P = 2.7e-20
Identities = 50/71 (70%), Positives = 55/71 (77%)
Query: 1 MMMAYAVENFGIHVFRAKIGESNGASLCLFRKLGFEDISYSEIFKEVTLELPVENAKREE 60
+MMAY V+N IH F AKIGESN ASL LFRKLGFE+ SYS IFKEVTLE PV N +REE
Sbjct: 130 IMMAYGVKNLEIHKFTAKIGESNTASLSLFRKLGFEESSYSGIFKEVTLEYPVTNLRREE 189
Query: 61 LLVLTGNVVRH 71
LL L V+RH
Sbjct: 190 LLKLLDEVIRH 200
|
|
| UNIPROTKB|F1NS03 NAT9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RV66 NAT9 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6RX64 NAT9 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3KT72 NAT9 "N-acetyltransferase 9" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3QRL7 NAT9 "N-acetyltransferase 9" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9BTE0 NAT9 "N-acetyltransferase 9" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RGD7 NAT9 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|1307096 Nat9 "N-acetyltransferase 9 (GCN5-related, putative)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1913426 Nat9 "N-acetyltransferase 9 (GCN5-related, putative)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_fgenesh4_pg.C_LG_XIV1004 | hypothetical protein (197 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 72 | |||
| pfam13302 | 136 | pfam13302, Acetyltransf_3, Acetyltransferase (GNAT | 1e-04 | |
| COG1247 | 169 | COG1247, COG1247, Sortase and related acyltransfer | 0.003 |
| >gnl|CDD|222034 pfam13302, Acetyltransf_3, Acetyltransferase (GNAT) domain | Back alignment and domain information |
|---|
Score = 36.9 bits (86), Expect = 1e-04
Identities = 13/36 (36%), Positives = 19/36 (52%)
Query: 1 MMMAYAVENFGIHVFRAKIGESNGASLCLFRKLGFE 36
++ YA E G+ A+I N AS + KLGF+
Sbjct: 101 ALLDYAFEELGLDRIVARIDPENIASQRVLEKLGFK 136
|
This domain catalyzes N-acetyltransferase reactions. Length = 136 |
| >gnl|CDD|224168 COG1247, COG1247, Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 72 | |||
| KOG4135 | 185 | consensus Predicted phosphoglucosamine acetyltrans | 99.07 | |
| COG1670 | 187 | RimL Acetyltransferases, including N-acetylases of | 99.07 | |
| PRK10809 | 194 | ribosomal-protein-S5-alanine N-acetyltransferase; | 99.01 | |
| PRK10151 | 179 | ribosomal-protein-L7/L12-serine acetyltransferase; | 99.0 | |
| TIGR03585 | 156 | PseH pseudaminic acid biosynthesis N-acetyl transf | 98.9 | |
| PF13420 | 155 | Acetyltransf_4: Acetyltransferase (GNAT) domain; P | 98.81 | |
| PRK15130 | 186 | spermidine N1-acetyltransferase; Provisional | 98.79 | |
| PF13302 | 142 | Acetyltransf_3: Acetyltransferase (GNAT) domain; P | 98.76 | |
| PRK10140 | 162 | putative acetyltransferase YhhY; Provisional | 98.59 | |
| PF13523 | 152 | Acetyltransf_8: Acetyltransferase (GNAT) domain; P | 98.54 | |
| COG1247 | 169 | Sortase and related acyltransferases [Cell envelop | 98.4 | |
| TIGR02382 | 191 | wecD_rffC TDP-D-fucosamine acetyltransferase. This | 98.29 | |
| PRK10975 | 194 | TDP-fucosamine acetyltransferase; Provisional | 98.14 | |
| PRK10514 | 145 | putative acetyltransferase; Provisional | 98.13 | |
| PRK03624 | 140 | putative acetyltransferase; Provisional | 98.03 | |
| PRK09491 | 146 | rimI ribosomal-protein-alanine N-acetyltransferase | 97.97 | |
| TIGR01575 | 131 | rimI ribosomal-protein-alanine acetyltransferase. | 97.94 | |
| PF00583 | 83 | Acetyltransf_1: Acetyltransferase (GNAT) family; I | 97.89 | |
| PRK10562 | 145 | putative acetyltransferase; Provisional | 97.82 | |
| PF08445 | 86 | FR47: FR47-like protein; InterPro: IPR013653 Prote | 97.67 | |
| TIGR02406 | 157 | ectoine_EctA L-2,4-diaminobutyric acid acetyltrans | 97.63 | |
| TIGR03448 | 292 | mycothiol_MshD mycothiol biosynthesis acetyltransf | 97.63 | |
| COG0456 | 177 | RimI Acetyltransferases [General function predicti | 97.54 | |
| TIGR03827 | 266 | GNAT_ablB putative beta-lysine N-acetyltransferase | 97.52 | |
| PLN02706 | 150 | glucosamine 6-phosphate N-acetyltransferase | 97.43 | |
| PRK10146 | 144 | aminoalkylphosphonic acid N-acetyltransferase; Pro | 97.43 | |
| KOG3139 | 165 | consensus N-acetyltransferase [General function pr | 97.13 | |
| TIGR03103 | 547 | trio_acet_GNAT GNAT-family acetyltransferase TIGR0 | 96.89 | |
| PTZ00330 | 147 | acetyltransferase; Provisional | 96.77 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 96.47 | |
| TIGR03448 | 292 | mycothiol_MshD mycothiol biosynthesis acetyltransf | 96.13 | |
| PRK09831 | 147 | putative acyltransferase; Provisional | 95.62 | |
| PF13508 | 79 | Acetyltransf_7: Acetyltransferase (GNAT) domain; P | 95.57 | |
| PF13673 | 117 | Acetyltransf_10: Acetyltransferase (GNAT) domain; | 95.47 | |
| KOG2488 | 202 | consensus Acetyltransferase (GNAT) domain-containi | 94.89 | |
| KOG3138 | 187 | consensus Predicted N-acetyltransferase [General f | 94.77 | |
| COG3981 | 174 | Predicted acetyltransferase [General function pred | 94.62 | |
| PRK07757 | 152 | acetyltransferase; Provisional | 94.02 | |
| PF12746 | 265 | GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S | 93.38 | |
| COG3393 | 268 | Predicted acetyltransferase [General function pred | 93.3 | |
| PF08444 | 89 | Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acylt | 93.21 | |
| PRK10314 | 153 | putative acyltransferase; Provisional | 92.44 | |
| PRK07922 | 169 | N-acetylglutamate synthase; Validated | 92.31 | |
| KOG3216 | 163 | consensus Diamine acetyltransferase [Amino acid tr | 91.46 | |
| PRK05279 | 441 | N-acetylglutamate synthase; Validated | 91.19 | |
| KOG3234 | 173 | consensus Acetyltransferase, (GNAT) family [Genera | 90.94 | |
| TIGR03827 | 266 | GNAT_ablB putative beta-lysine N-acetyltransferase | 90.72 | |
| PRK13688 | 156 | hypothetical protein; Provisional | 90.56 | |
| cd02169 | 297 | Citrate_lyase_ligase Citrate lyase ligase. Citrate | 90.49 | |
| PHA01807 | 153 | hypothetical protein | 90.11 | |
| TIGR00124 | 332 | cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP | 89.04 | |
| TIGR01211 | 522 | ELP3 histone acetyltransferase, ELP3 family. The S | 88.58 | |
| PLN02825 | 515 | amino-acid N-acetyltransferase | 88.49 | |
| TIGR01890 | 429 | N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi | 87.57 | |
| PHA00432 | 137 | internal virion protein A | 87.02 | |
| COG3818 | 167 | Predicted acetyltransferase, GNAT superfamily [Gen | 86.78 | |
| PRK12308 | 614 | bifunctional argininosuccinate lyase/N-acetylgluta | 86.4 | |
| PF11090 | 86 | DUF2833: Protein of unknown function (DUF2833); In | 85.57 | |
| PHA01733 | 153 | hypothetical protein | 80.39 | |
| TIGR03244 | 336 | arg_catab_AstA arginine N-succinyltransferase. In | 80.02 |
| >KOG4135 consensus Predicted phosphoglucosamine acetyltransferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
Probab=99.07 E-value=1.6e-10 Score=77.13 Aligned_cols=54 Identities=39% Similarity=0.584 Sum_probs=51.3
Q ss_pred ChHHHHHhhcCceEEEEEeCCCCHHHHHHHHhcCCeEEEEeeeeeeeeEEeecc
Q 035156 1 MMMAYAVENFGIHVFRAKIGESNGASLCLFRKLGFEDISYSEIFKEVTLELPVE 54 (72)
Q Consensus 1 l~l~ya~~~l~l~~i~a~i~~~N~~Si~LfeklGF~~~g~~~~~~ev~~~~~~~ 54 (72)
+|+.||.+.+++.++.++|+.+|.||++||+|++|..+....+|++|++++.++
T Consensus 131 ~ml~y~~s~l~l~Ky~vkig~~nk~sl~lFkk~~f~q~~~ns~f~~v~Le~~~t 184 (185)
T KOG4135|consen 131 AMLAYAYSVLKLDKYEVKIGMDNKPSLRLFKKFLFTQVFYNSSFPHVTLELDPT 184 (185)
T ss_pred HHHHHHHHHhhhheEEEEecCCCchHHHHHHHhhheeeeeeccccceEEecCCC
Confidence 479999999999999999999999999999999999999999999999998764
|
|
| >COG1670 RimL Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK10809 ribosomal-protein-S5-alanine N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10151 ribosomal-protein-L7/L12-serine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03585 PseH pseudaminic acid biosynthesis N-acetyl transferase | Back alignment and domain information |
|---|
| >PF13420 Acetyltransf_4: Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A | Back alignment and domain information |
|---|
| >PRK15130 spermidine N1-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13302 Acetyltransf_3: Acetyltransferase (GNAT) domain; PDB: 3TTH_C 3JUW_A 2ZXV_A 2Z0Z_A 2VI7_B 3EG7_F 1YRE_C 3IGR_B 3FBU_A 2FCK_A | Back alignment and domain information |
|---|
| >PRK10140 putative acetyltransferase YhhY; Provisional | Back alignment and domain information |
|---|
| >PF13523 Acetyltransf_8: Acetyltransferase (GNAT) domain; PDB: 2VQY_A 2BUE_A 1V0C_A 1YK3_D 2PR8_A 2QIR_A 2PRB_A 2QML_A 2PC1_A | Back alignment and domain information |
|---|
| >COG1247 Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase | Back alignment and domain information |
|---|
| >PRK10975 TDP-fucosamine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10514 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK03624 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09491 rimI ribosomal-protein-alanine N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01575 rimI ribosomal-protein-alanine acetyltransferase | Back alignment and domain information |
|---|
| >PF00583 Acetyltransf_1: Acetyltransferase (GNAT) family; InterPro: IPR000182 The N-acetyltransferases (NAT) (EC 2 | Back alignment and domain information |
|---|
| >PRK10562 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF08445 FR47: FR47-like protein; InterPro: IPR013653 Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 (Q9VR51 from SWISSPROT) | Back alignment and domain information |
|---|
| >TIGR02406 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferase | Back alignment and domain information |
|---|
| >TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase | Back alignment and domain information |
|---|
| >COG0456 RimI Acetyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase | Back alignment and domain information |
|---|
| >PLN02706 glucosamine 6-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG3139 consensus N-acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 | Back alignment and domain information |
|---|
| >PTZ00330 acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase | Back alignment and domain information |
|---|
| >PRK09831 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A | Back alignment and domain information |
|---|
| >PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A | Back alignment and domain information |
|---|
| >KOG2488 consensus Acetyltransferase (GNAT) domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3138 consensus Predicted N-acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG3981 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07757 acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF12746 GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S_B | Back alignment and domain information |
|---|
| >COG3393 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF08444 Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region; InterPro: IPR013652 This entry represents mammalian-specific glycine N-acyltransferase (also called aralkyl acyl-CoA:amino acid N-acyltransferase; 2 | Back alignment and domain information |
|---|
| >PRK10314 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07922 N-acetylglutamate synthase; Validated | Back alignment and domain information |
|---|
| >KOG3216 consensus Diamine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05279 N-acetylglutamate synthase; Validated | Back alignment and domain information |
|---|
| >KOG3234 consensus Acetyltransferase, (GNAT) family [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK13688 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd02169 Citrate_lyase_ligase Citrate lyase ligase | Back alignment and domain information |
|---|
| >PHA01807 hypothetical protein | Back alignment and domain information |
|---|
| >TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase | Back alignment and domain information |
|---|
| >TIGR01211 ELP3 histone acetyltransferase, ELP3 family | Back alignment and domain information |
|---|
| >PLN02825 amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >PHA00432 internal virion protein A | Back alignment and domain information |
|---|
| >COG3818 Predicted acetyltransferase, GNAT superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional | Back alignment and domain information |
|---|
| >PF11090 DUF2833: Protein of unknown function (DUF2833); InterPro: IPR020335 This entry contains proteins with no known function | Back alignment and domain information |
|---|
| >PHA01733 hypothetical protein | Back alignment and domain information |
|---|
| >TIGR03244 arg_catab_AstA arginine N-succinyltransferase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 72 | |||
| 3eo4_A | 164 | Uncharacterized protein MJ1062; APC60792.2,MJ_1062 | 3e-06 | |
| 1sqh_A | 312 | Hypothetical protein CG14615-PA; structural genomi | 5e-04 | |
| 3f8k_A | 160 | Protein acetyltransferase; GCN5-related N-acetyltr | 6e-04 | |
| 1vhs_A | 175 | Similar to phosphinothricin acetyltransferase; str | 7e-04 |
| >3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} Length = 164 | Back alignment and structure |
|---|
Score = 41.2 bits (97), Expect = 3e-06
Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 4/52 (7%)
Query: 1 MMMAYAVENFGIHVFRAKIGESNGASLCLFRKLGFEDISY---SEIFKEVTL 49
+++ + +N G A+I E+N S+ LF LGF+ +E EV L
Sbjct: 114 LVLKWL-KNIGYKKAHARILENNIRSIKLFESLGFKKTKKGRENEWIYEVNL 164
|
| >1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 Length = 312 | Back alignment and structure |
|---|
| >3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} Length = 160 | Back alignment and structure |
|---|
| >1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 Length = 175 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 72 | |||
| 3shp_A | 176 | Putative acetyltransferase STHE_0691; PSI-biology, | 99.24 | |
| 3dns_A | 135 | Ribosomal-protein-alanine acetyltransferase; N-ter | 99.05 | |
| 3r9f_A | 188 | MCCE protein; microcin C7, acetyltransferase, SELF | 99.0 | |
| 3fbu_A | 168 | Acetyltransferase, GNAT family; structur genomics, | 98.98 | |
| 3tcv_A | 246 | GCN5-related N-acetyltransferase; GRAM negative co | 98.95 | |
| 3igr_A | 184 | Ribosomal-protein-S5-alanine N-acetyltransferase; | 98.93 | |
| 2fl4_A | 149 | Spermine/spermidine acetyltransferase; structural | 98.93 | |
| 3tth_A | 170 | Spermidine N1-acetyltransferase; central intermedi | 98.91 | |
| 2z10_A | 194 | Ribosomal-protein-alanine acetyltransferase; alpha | 98.9 | |
| 2vzy_A | 218 | RV0802C; transferase, GCN5-related N-acetyltransfe | 98.88 | |
| 1yk3_A | 210 | Hypothetical protein RV1347C/MT1389; acyltransfera | 98.87 | |
| 2vi7_A | 177 | Acetyltransferase PA1377; GNAT, GCN5 family, N-ace | 98.87 | |
| 3pzj_A | 209 | Probable acetyltransferases; MCSG, PSI-2, structur | 98.86 | |
| 3juw_A | 175 | Probable GNAT-family acetyltransferase; structural | 98.85 | |
| 2jlm_A | 182 | Putative phosphinothricin N-acetyltransferase; met | 98.83 | |
| 1nsl_A | 184 | Probable acetyltransferase; structural genomics, h | 98.82 | |
| 2i79_A | 172 | Acetyltransferase, GNAT family; acetyl coenzyme *A | 98.82 | |
| 2ge3_A | 170 | Probable acetyltransferase; structural GEN PSI, pr | 98.8 | |
| 1vhs_A | 175 | Similar to phosphinothricin acetyltransferase; str | 98.79 | |
| 3eg7_A | 176 | Spermidine N1-acetyltransferase; structural genomi | 98.75 | |
| 1yre_A | 197 | Hypothetical protein PA3270; APC5563, midwest cent | 98.75 | |
| 2zw5_A | 301 | Bleomycin acetyltransferase; dimer, two domains; H | 98.74 | |
| 2fck_A | 181 | Ribosomal-protein-serine acetyltransferase, putat; | 98.74 | |
| 2qml_A | 198 | BH2621 protein; structural genomics, joint center | 98.73 | |
| 3owc_A | 188 | Probable acetyltransferase; structural genomics, P | 98.71 | |
| 2fsr_A | 195 | Acetyltransferase; alpha-beta-sandwich, structural | 98.71 | |
| 3eo4_A | 164 | Uncharacterized protein MJ1062; APC60792.2,MJ_1062 | 98.7 | |
| 3g8w_A | 169 | Lactococcal prophage PS3 protein 05; APC61042, ace | 98.7 | |
| 1s7k_A | 182 | Acetyl transferase; GNAT; 1.80A {Salmonella typhim | 98.68 | |
| 2x7b_A | 168 | N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf | 98.66 | |
| 2ae6_A | 166 | Acetyltransferase, GNAT family; GCN5-related N-ace | 98.64 | |
| 2j8m_A | 172 | Acetyltransferase PA4866 from P. aeruginosa; GCN5 | 98.62 | |
| 1yr0_A | 175 | AGR_C_1654P, phosphinothricin acetyltransferase; s | 98.62 | |
| 1on0_A | 158 | YYCN protein; structural genomics, alpha-beta prot | 98.58 | |
| 2i6c_A | 160 | Putative acetyltransferase; GNAT family, structura | 98.58 | |
| 2bue_A | 202 | AAC(6')-IB; GNAT, transferase, aminoglycoside, flu | 98.57 | |
| 3f5b_A | 182 | Aminoglycoside N(6')acetyltransferase; APC60744, l | 98.52 | |
| 2ob0_A | 170 | Human MAK3 homolog; acetyltransferase, structural | 98.48 | |
| 3dr6_A | 174 | YNCA; acetyltransferase, csgid target, essential g | 98.47 | |
| 2cnt_A | 160 | Modification of 30S ribosomal subunit protein S18; | 98.44 | |
| 3kkw_A | 182 | Putative uncharacterized protein; acetyltransferas | 98.43 | |
| 1s3z_A | 165 | Aminoglycoside 6'-N-acetyltransferase; GNAT, amino | 98.43 | |
| 2cy2_A | 174 | TTHA1209, probable acetyltransferase; structural g | 98.42 | |
| 4ava_A | 333 | Lysine acetyltransferase; allosteric regulation, d | 98.4 | |
| 4e0a_A | 164 | BH1408 protein; structural genomics, PSI-biology, | 98.4 | |
| 1tiq_A | 180 | Protease synthase and sporulation negative regulat | 98.38 | |
| 3lod_A | 162 | Putative acyl-COA N-acyltransferase; structural ge | 98.37 | |
| 4evy_A | 166 | Aminoglycoside N(6')-acetyltransferase type 1; cen | 98.37 | |
| 2eui_A | 153 | Probable acetyltransferase; dimer, structural geno | 98.36 | |
| 2oh1_A | 179 | Acetyltransferase, GNAT family; YP_013287.1, struc | 98.36 | |
| 2fia_A | 162 | Acetyltransferase; structural genomics, PSI, prote | 98.36 | |
| 1u6m_A | 199 | Acetyltransferase, GNAT family; structural genomic | 98.32 | |
| 3d8p_A | 163 | Acetyltransferase of GNAT family; NP_373092.1, str | 98.31 | |
| 1wwz_A | 159 | Hypothetical protein PH1933; structural genomics, | 98.31 | |
| 2dxq_A | 150 | AGR_C_4057P, acetyltransferase; structural genomic | 98.3 | |
| 1ufh_A | 180 | YYCN protein; alpha and beta, fold, acetyltransfer | 98.29 | |
| 2pc1_A | 201 | Acetyltransferase, GNAT family; NP_688560.1, struc | 98.29 | |
| 3pp9_A | 187 | Putative streptothricin acetyltransferase; toxin p | 98.29 | |
| 2fe7_A | 166 | Probable N-acetyltransferase; structural genomics, | 98.27 | |
| 3f8k_A | 160 | Protein acetyltransferase; GCN5-related N-acetyltr | 98.27 | |
| 4h89_A | 173 | GCN5-related N-acetyltransferase; N-acyltransferas | 98.27 | |
| 1ghe_A | 177 | Acetyltransferase; acyl coenzyme A complex; HET: A | 98.26 | |
| 2q7b_A | 181 | Acetyltransferase, GNAT family; NP_689019.1, struc | 98.25 | |
| 3h4q_A | 188 | Putative acetyltransferase; NP_371943.1, structura | 98.25 | |
| 2bei_A | 170 | Diamine acetyltransferase 2; SSAT2, BC011751, AAH1 | 98.24 | |
| 3ld2_A | 197 | SMU.2055, putative acetyltransferase; HET: COA; 2. | 98.23 | |
| 3i9s_A | 183 | Integron cassette protein; oyster POND, woods HOLE | 98.23 | |
| 1mk4_A | 157 | Hypothetical protein YQJY; alpha-beta-alpha sandwi | 98.23 | |
| 2b5g_A | 171 | Diamine acetyltransferase 1; structural genomics, | 98.21 | |
| 1sqh_A | 312 | Hypothetical protein CG14615-PA; structural genomi | 98.21 | |
| 3fix_A | 183 | N-acetyltransferase; termoplasma acidophilum, stru | 98.21 | |
| 3fnc_A | 163 | Protein LIN0611, putative acetyltransferase; GNAT, | 98.19 | |
| 2r1i_A | 172 | GCN5-related N-acetyltransferase; YP_831484.1, put | 98.18 | |
| 3bln_A | 143 | Acetyltransferase GNAT family; NP_981174.1, struct | 98.17 | |
| 2r7h_A | 177 | Putative D-alanine N-acetyltransferase of GNAT FA; | 98.14 | |
| 1z4e_A | 153 | Transcriptional regulator; nysgxrc target T2017, G | 98.13 | |
| 1qsm_A | 152 | HPA2 histone acetyltransferase; protein-acetyl coe | 98.12 | |
| 3exn_A | 160 | Probable acetyltransferase; GCN5-related N-acetylt | 98.08 | |
| 2ft0_A | 235 | TDP-fucosamine acetyltransferase; GNAT fold acetyl | 98.08 | |
| 3dsb_A | 157 | Putative acetyltransferase; APC60368.2, ST genomic | 98.07 | |
| 2wpx_A | 339 | ORF14; transferase, acetyl transferase, antibiotic | 98.06 | |
| 2pdo_A | 144 | Acetyltransferase YPEA; alpha-beta-alpha sandwich, | 98.03 | |
| 1y9k_A | 157 | IAA acetyltransferase; structural genomics, midwes | 98.02 | |
| 1vkc_A | 158 | Putative acetyl transferase; structural genomics, | 97.98 | |
| 1yvk_A | 163 | Hypothetical protein BSU33890; ALPHS-beta protein, | 97.96 | |
| 3d3s_A | 189 | L-2,4-diaminobutyric acid acetyltransferase; alpha | 97.96 | |
| 2g3a_A | 152 | Acetyltransferase; structural genomics, PSI, prote | 97.95 | |
| 3ec4_A | 228 | Putative acetyltransferase from the GNAT family; Y | 97.95 | |
| 2fiw_A | 172 | GCN5-related N-acetyltransferase:aminotransferase | 97.94 | |
| 3t9y_A | 150 | Acetyltransferase, GNAT family; PSI-biology, struc | 97.92 | |
| 3qb8_A | 197 | A654L protein; GNAT N-acetyltransferase, acetyltra | 97.9 | |
| 3fyn_A | 176 | Integron gene cassette protein HFX_CASS3; integron | 97.88 | |
| 2kcw_A | 147 | Uncharacterized acetyltransferase YJAB; GNAT fold, | 97.88 | |
| 3jvn_A | 166 | Acetyltransferase; alpha-beta protein, structural | 97.87 | |
| 1bo4_A | 168 | Protein (serratia marcescens aminoglycoside-3-N- a | 97.84 | |
| 3c26_A | 266 | Putative acetyltransferase TA0821; NP_394282.1, A | 97.83 | |
| 1p0h_A | 318 | Hypothetical protein RV0819; GNAT fold, acetyltran | 97.82 | |
| 2aj6_A | 159 | Hypothetical protein MW0638; structural genomics, | 97.8 | |
| 3iwg_A | 276 | Acetyltransferase, GNAT family; structural genomic | 97.76 | |
| 1yx0_A | 159 | Hypothetical protein YSNE; NESG, GFT structral gen | 97.76 | |
| 2gan_A | 190 | 182AA long hypothetical protein; alpha-beta protei | 97.68 | |
| 4fd4_A | 217 | Arylalkylamine N-acetyltransferase like 5B; GNAT; | 97.61 | |
| 1cjw_A | 166 | Protein (serotonin N-acetyltransferase); HET: COT; | 97.6 | |
| 1n71_A | 180 | AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, | 97.56 | |
| 3i3g_A | 161 | N-acetyltransferase; malaria, structural genomics, | 97.53 | |
| 1i12_A | 160 | Glucosamine-phosphate N-acetyltransferase; GNAT, a | 97.51 | |
| 1ygh_A | 164 | ADA4, protein (transcriptional activator GCN5); tr | 97.46 | |
| 2qec_A | 204 | Histone acetyltransferase HPA2 and related acetylt | 97.44 | |
| 3ey5_A | 181 | Acetyltransferase-like, GNAT family; structural ge | 97.37 | |
| 1y9w_A | 140 | Acetyltransferase; structural genomics, Pro struct | 97.37 | |
| 1qst_A | 160 | TGCN5 histone acetyl transferase; GCN5-related N-a | 97.36 | |
| 2ree_A | 224 | CURA; GNAT, S-acetyltransferase, decarboxylase, po | 97.36 | |
| 3tt2_A | 330 | GCN5-related N-acetyltransferase; structural genom | 97.33 | |
| 3g3s_A | 249 | GCN5-related N-acetyltransferase; ZP_00874857.1, a | 97.33 | |
| 2atr_A | 138 | Acetyltransferase, GNAT family; MCSG, structural g | 97.31 | |
| 1kux_A | 207 | Aralkylamine, serotonin N-acetyltransferase; enzym | 97.25 | |
| 1y7r_A | 133 | Hypothetical protein SA2161; structural genomics, | 97.16 | |
| 2o28_A | 184 | Glucosamine 6-phosphate N-acetyltransferase; struc | 97.15 | |
| 2wpx_A | 339 | ORF14; transferase, acetyl transferase, antibiotic | 97.14 | |
| 1m4i_A | 181 | Aminoglycoside 2'-N-acetyltransferase; COA binding | 97.09 | |
| 3mgd_A | 157 | Predicted acetyltransferase; structural genomics, | 97.05 | |
| 3frm_A | 254 | Uncharacterized conserved protein; APC61048, staph | 97.01 | |
| 4fd7_A | 238 | Putative arylalkylamine N-acetyltransferase 7; GNA | 97.0 | |
| 2q04_A | 211 | Acetoin utilization protein; ZP_00540088.1, struct | 96.95 | |
| 1xeb_A | 150 | Hypothetical protein PA0115; midwest center for st | 96.94 | |
| 3efa_A | 147 | Putative acetyltransferase; structural genom 2, pr | 96.89 | |
| 3te4_A | 215 | GH12636P, dopamine N acetyltransferase, isoform A; | 96.85 | |
| 1q2y_A | 140 | Protein YJCF, similar to hypothetical proteins; GC | 96.78 | |
| 3ddd_A | 288 | Putative acetyltransferase; NP_142035.1, structura | 96.75 | |
| 3t90_A | 149 | Glucose-6-phosphate acetyltransferase 1; GNAT fold | 96.74 | |
| 2vez_A | 190 | Putative glucosamine 6-phosphate acetyltransferase | 96.72 | |
| 2jdc_A | 146 | Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1. | 96.71 | |
| 4ag7_A | 165 | Glucosamine-6-phosphate N-acetyltransferase; HET: | 96.67 | |
| 3e0k_A | 150 | Amino-acid acetyltransferase; N-acetylglutamate sy | 96.67 | |
| 4fd5_A | 222 | Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A | 96.66 | |
| 3gy9_A | 150 | GCN5-related N-acetyltransferase; YP_001815201.1, | 96.59 | |
| 2q0y_A | 153 | GCN5-related N-acetyltransferase; YP_295895.1, ace | 96.35 | |
| 2pr1_A | 163 | Uncharacterized N-acetyltransferase YLBP; YIBP pro | 96.17 | |
| 3tt2_A | 330 | GCN5-related N-acetyltransferase; structural genom | 96.14 | |
| 2ozh_A | 142 | Hypothetical protein XCC2953; structural genomics, | 96.06 | |
| 2d4p_A | 141 | Hypothetical protein TTHA1254; structural genomics | 96.04 | |
| 1z4r_A | 168 | General control of amino acid synthesis protein 5- | 95.9 | |
| 1p0h_A | 318 | Hypothetical protein RV0819; GNAT fold, acetyltran | 95.05 | |
| 2ozg_A | 396 | GCN5-related N-acetyltransferase; YP_325469.1, ace | 95.03 | |
| 2g0b_A | 198 | FEEM; N-acyl transferase, environmental DNA, prote | 94.92 | |
| 3d2m_A | 456 | Putative acetylglutamate synthase; protein-COA-Glu | 94.89 | |
| 2k5t_A | 128 | Uncharacterized protein YHHK; N-acetyl transferase | 94.78 | |
| 3s6f_A | 145 | Hypothetical acetyltransferase; acyl-COA N-acyltra | 94.67 | |
| 3ddd_A | 288 | Putative acetyltransferase; NP_142035.1, structura | 93.85 | |
| 2zpa_A | 671 | Uncharacterized protein YPFI; RNA modification enz | 91.42 | |
| 1ro5_A | 201 | Autoinducer synthesis protein LASI; alpha-beta-alp | 89.76 | |
| 3p2h_A | 201 | AHL synthase; acyl-ACP binding, SAM binding, signa | 85.99 | |
| 2i00_A | 406 | Acetyltransferase, GNAT family; structural genomic | 82.05 |
| >3shp_A Putative acetyltransferase STHE_0691; PSI-biology, midwest center for structural genomics, MCSG; HET: SRT; 2.21A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
Probab=99.24 E-value=3.1e-11 Score=76.15 Aligned_cols=41 Identities=10% Similarity=0.197 Sum_probs=39.1
Q ss_pred hHHHHHhhcCceEEEEEeCCCCHHHHHHHHhcCCeEEEEee
Q 035156 2 MMAYAVENFGIHVFRAKIGESNGASLCLFRKLGFEDISYSE 42 (72)
Q Consensus 2 ~l~ya~~~l~l~~i~a~i~~~N~~Si~LfeklGF~~~g~~~ 42 (72)
+++|+|+.+|++++++.|.++|.+|+++++|+||+.+|+.+
T Consensus 109 ll~~af~~~~~~~i~~~v~~~N~~s~~l~ek~GF~~~G~~r 149 (176)
T 3shp_A 109 VVPWLRDEHELLVITVEIAADEQRTLAAAEAAGLKAAVRMR 149 (176)
T ss_dssp HHHHHHHHSCCSEEEEEEETTCHHHHHHHHHTTCEEEEEEE
T ss_pred HHHHHHhhCCeEEEEEEEcCCCHHHHHHHHHCCCEEEEEee
Confidence 68999999999999999999999999999999999999764
|
| >3dns_A Ribosomal-protein-alanine acetyltransferase; N-terminal domain of ribosomal-protein-alanine acetyltransfe MCSG, PSI; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3r9f_A MCCE protein; microcin C7, acetyltransferase, SELF immunity, resistance, A coenzyme A, transferase; HET: COA GSU; 1.20A {Escherichia coli} PDB: 3r95_A* 3r96_A* 3r9e_A* 3r9g_A* | Back alignment and structure |
|---|
| >3fbu_A Acetyltransferase, GNAT family; structur genomics, PSI2, MCSG, protein structure initiative, midwest for structural genomics; HET: COA; 1.80A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3tcv_A GCN5-related N-acetyltransferase; GRAM negative coccobacillus, brucellosis, acyl CO-A, arylami transferase; 1.75A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3igr_A Ribosomal-protein-S5-alanine N-acetyltransferase; fisch MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.00A {Vibrio fischeri} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2z10_A Ribosomal-protein-alanine acetyltransferase; alpha/beta protein, acyltransferase, structural genomics, NPPSFA; HET: IYR; 1.77A {Thermus thermophilus} PDB: 2z0z_A* 2z11_A* 2zxv_A* | Back alignment and structure |
|---|
| >2vzy_A RV0802C; transferase, GCN5-related N-acetyltransferase, succinyltransferase; HET: FLC; 2.00A {Mycobacterium tuberculosis} PDB: 2vzz_A* | Back alignment and structure |
|---|
| >1yk3_A Hypothetical protein RV1347C/MT1389; acyltransferase, GCN5-related fold, structural genomics, PSI, protein structure initiative; HET: BOG; 2.20A {Mycobacterium tuberculosis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3pzj_A Probable acetyltransferases; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: MSE; 1.85A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >3juw_A Probable GNAT-family acetyltransferase; structural genomics, APC60242, acetyltransferas protein structure initiative; HET: MSE; 2.11A {Bordetella pertussis} | Back alignment and structure |
|---|
| >2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi} | Back alignment and structure |
|---|
| >1nsl_A Probable acetyltransferase; structural genomics, hexamer, alpha-beta, PSI, protein struc initiative, midwest center for structural genomics; 2.70A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSC protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* | Back alignment and structure |
|---|
| >2fck_A Ribosomal-protein-serine acetyltransferase, putat; ribosomal-protein structural genomics, PSI, protein structure initiative; HET: MSE; 1.70A {Vibrio cholerae o1 biovar eltor} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2qml_A BH2621 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 1.55A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3owc_A Probable acetyltransferase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2fsr_A Acetyltransferase; alpha-beta-sandwich, structural genomics, PSI, protein struc initiative, midwest center for structural genomics; HET: PEG; 1.52A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >1s7k_A Acetyl transferase; GNAT; 1.80A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 1s7l_A* 1s7n_A* 1s7f_A 1z9u_A | Back alignment and structure |
|---|
| >2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A | Back alignment and structure |
|---|
| >1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* | Back alignment and structure |
|---|
| >2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A* | Back alignment and structure |
|---|
| >3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* | Back alignment and structure |
|---|
| >3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 3dr8_A* | Back alignment and structure |
|---|
| >2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* | Back alignment and structure |
|---|
| >3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* | Back alignment and structure |
|---|
| >2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* | Back alignment and structure |
|---|
| >4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* | Back alignment and structure |
|---|
| >4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* | Back alignment and structure |
|---|
| >1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A | Back alignment and structure |
|---|
| >2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} | Back alignment and structure |
|---|
| >3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >4h89_A GCN5-related N-acetyltransferase; N-acyltransferase superfamily, structural genomics, PSI-BIOL midwest center for structural genomics, MCSG; 1.37A {Kribbella flavida} | Back alignment and structure |
|---|
| >1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* | Back alignment and structure |
|---|
| >2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} | Back alignment and structure |
|---|
| >3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE P33; 2.50A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* | Back alignment and structure |
|---|
| >3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* | Back alignment and structure |
|---|
| >1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 | Back alignment and structure |
|---|
| >3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* | Back alignment and structure |
|---|
| >3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} | Back alignment and structure |
|---|
| >3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} | Back alignment and structure |
|---|
| >2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A | Back alignment and structure |
|---|
| >3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2ft0_A TDP-fucosamine acetyltransferase; GNAT fold acetyltransferase, structural genomics, montreal-K bacterial structural genomics initiative, BSGI; HET: ACO; 1.66A {Escherichia coli} PDB: 2fs5_A* | Back alignment and structure |
|---|
| >3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} | Back alignment and structure |
|---|
| >2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* | Back alignment and structure |
|---|
| >2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} | Back alignment and structure |
|---|
| >2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} | Back alignment and structure |
|---|
| >2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} | Back alignment and structure |
|---|
| >3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} | Back alignment and structure |
|---|
| >2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} | Back alignment and structure |
|---|
| >1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} | Back alignment and structure |
|---|
| >1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* | Back alignment and structure |
|---|
| >2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti} | Back alignment and structure |
|---|
| >1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A | Back alignment and structure |
|---|
| >1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* | Back alignment and structure |
|---|
| >3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A | Back alignment and structure |
|---|
| >1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A | Back alignment and structure |
|---|
| >1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* | Back alignment and structure |
|---|
| >2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* | Back alignment and structure |
|---|
| >3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3g3s_A GCN5-related N-acetyltransferase; ZP_00874857.1, acetyltransferase (GNAT) family, structural joint center for structural genomics, JCSG; HET: MSE; 1.80A {Streptococcus suis} | Back alignment and structure |
|---|
| >2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* | Back alignment and structure |
|---|
| >1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A | Back alignment and structure |
|---|
| >2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* | Back alignment and structure |
|---|
| >1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* | Back alignment and structure |
|---|
| >3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti} | Back alignment and structure |
|---|
| >2q04_A Acetoin utilization protein; ZP_00540088.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.33A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural GEN protein structure initiative, PSI, APC22065; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} PDB: 3v8i_A* | Back alignment and structure |
|---|
| >1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* | Back alignment and structure |
|---|
| >2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* | Back alignment and structure |
|---|
| >4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* | Back alignment and structure |
|---|
| >3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A | Back alignment and structure |
|---|
| >3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* | Back alignment and structure |
|---|
| >2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein, coenzyme A, structural GE PSI-2, protein structure initiative; HET: SUC COA; 3.20A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2d4p_A Hypothetical protein TTHA1254; structural genomics, NPPSFA, national project on protein STR and functional analyses; 1.70A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 2d4o_A | Back alignment and structure |
|---|
| >1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* | Back alignment and structure |
|---|
| >1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* | Back alignment and structure |
|---|
| >2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >2g0b_A FEEM; N-acyl transferase, environmental DNA, protein-product compl antibiotic synthase, transferase; HET: NLT; 3.00A {Uncultured bacterium} | Back alignment and structure |
|---|
| >3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* | Back alignment and structure |
|---|
| >2k5t_A Uncharacterized protein YHHK; N-acetyl transferase, COA, bound ligand, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: COA; NMR {Escherichia coli K12} | Back alignment and structure |
|---|
| >3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} | Back alignment and structure |
|---|
| >1ro5_A Autoinducer synthesis protein LASI; alpha-beta-alpha sandwich, phosphopantetheine fold, signalin; 2.30A {Pseudomonas aeruginosa} SCOP: d.108.1.3 | Back alignment and structure |
|---|
| >3p2h_A AHL synthase; acyl-ACP binding, SAM binding, signaling protein-I MTA complex, signaling protein-inhibitor complex; HET: MTA NOO; 2.00A {Burkholderia glumae} PDB: 3p2f_A* | Back alignment and structure |
|---|
| >2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 72 | |||
| d2fcka1 | 178 | Putative ribosomal-protein-serine acetyltransferas | 99.21 | |
| d1s7ka1 | 174 | L7/L12-Ribosomal-protein-serine acetyltransferase | 99.2 | |
| d2fsra1 | 164 | Probable acetyltranferase Atu2435 {Agrobacterium t | 99.17 | |
| d1nsla_ | 180 | Probable acetyltransferase YdaF {Bacillus subtilis | 99.17 | |
| d1yrea1 | 183 | Hypothetical protein PA3270 {Pseudomonas aeruginos | 99.11 | |
| d1yk3a1 | 198 | Hypothetical protein Rv1347c/MT1389 {Mycobacterium | 98.93 | |
| d1vhsa_ | 165 | Putative phosphinothricin acetyltransferase YwnH { | 98.84 | |
| d2ge3a1 | 164 | Probable acetyltransferase Atu2290 {Agrobacterium | 98.8 | |
| d1yvoa1 | 169 | Hypothetical protein PA4866 {Pseudomonas aeruginos | 98.78 | |
| d2fl4a1 | 146 | Probable spermine/spermidine acetyltransferase EF1 | 98.77 | |
| d1yr0a1 | 163 | Phosphinothricin acetyltransferase {Agrobacterium | 98.66 | |
| d2i6ca1 | 160 | Putative acetyltransferase PA4794 {Pseudomonas aer | 98.66 | |
| d2ae6a1 | 161 | Putative acetyltransferase EF0244 {Enterococcus fa | 98.63 | |
| d2cy2a1 | 174 | Probable acetyltransferase TTHA1209 {Thermus therm | 98.6 | |
| d1ufha_ | 155 | Putative acetyltransferase YycN {Bacillus subtilis | 98.48 | |
| d1s3za_ | 147 | Aminoglycoside N-acetyltransferase AAC(6')-IY {Sal | 98.47 | |
| d2beia1 | 167 | Diamine acetyltransferase 2 {Human (Homo sapiens) | 98.42 | |
| d2fiaa1 | 157 | Probable acetyltransferase EF1919 {Enterococcus fa | 98.37 | |
| d1mk4a_ | 157 | Hypothetical protein YqiY {Bacillus subtilis [TaxI | 98.34 | |
| d2b5ga1 | 167 | Diamine acetyltransferase 1 {Human (Homo sapiens) | 98.31 | |
| d1qsma_ | 150 | Histone acetyltransferase HPA2 {Baker's yeast (Sac | 98.3 | |
| d1u6ma_ | 189 | Putative acetyltransferase EF0945 {Enterococcus fa | 98.28 | |
| d2euia1 | 153 | Probable acetyltransferase PA4026 {Pseudomonas aer | 98.24 | |
| d1tiqa_ | 173 | Protease synthase and sporulation negative regulat | 98.24 | |
| d1yvka1 | 152 | Hypothetical protein YvbK (BSu33890) {Bacillus sub | 98.18 | |
| d1y9ka1 | 152 | IAA acetyltransferase {Bacillus cereus [TaxId: 139 | 98.09 | |
| d1wwza1 | 157 | Hypothetical protein PH1933 {Pyrococcus horikoshii | 98.08 | |
| d1z4ea1 | 150 | Transcriptional regulator BH1968 {Bacillus halodur | 98.05 | |
| d1p0ha_ | 308 | Mycothiol synthase MshD {Mycobacterium tuberculosi | 98.04 | |
| d1sqha_ | 297 | Hypothetical protein cg14615-pa {Fruit fly (Drosop | 98.01 | |
| d2fe7a1 | 156 | Probable N-acetyltransferase PA0478 {Pseudomonas a | 97.95 | |
| d1vkca_ | 149 | Putative acetyltransferase PF0028 {Pyrococcus furi | 97.87 | |
| d1ghea_ | 170 | Tabtoxin resistance protein {Pseudomonas syringae | 97.73 | |
| d1cjwa_ | 166 | Serotonin N-acetyltranferase {Sheep (Ovis aries) [ | 97.66 | |
| d1y9wa1 | 140 | Probable acetyltransferase BC2806 {Bacillus cereus | 97.57 | |
| d2gana1 | 182 | Hypothetical protein PH0736 {Pyrococcus horikoshii | 97.5 | |
| d2g3aa1 | 137 | Probable acetyltransferase Atu2258 {Agrobacterium | 97.47 | |
| d1i12a_ | 157 | Glucosamine-phosphate N-acetyltransferase GNA1 {Ba | 97.43 | |
| d1n71a_ | 180 | Aminoglycoside 6'-N-acetyltransferase {Enterococcu | 97.07 | |
| d1yx0a1 | 151 | Hypothetical protein YsnE {Bacillus subtilis [TaxI | 97.02 | |
| d2fiwa1 | 156 | Probable N-acetyltransferase RPA1999 {Rhodopseudom | 96.93 | |
| d1bo4a_ | 137 | Aminoglycoside 3-N-acetyltransferase {Serratia mar | 96.51 | |
| d2atra1 | 137 | Probable acetyltransferase SP0256 {Streptococcus p | 96.22 | |
| d1y7ra1 | 133 | Hypothetical protein SA2161 {Staphylococcus aureus | 95.88 | |
| d2jdca1 | 145 | Probable acetyltransferase YitI {Bacillus lichenif | 95.81 | |
| d1ygha_ | 164 | Catalytic domain of GCN5 histone acetyltransferase | 95.25 | |
| d1q2ya_ | 140 | Probable acetyltransferase YjcF {Bacillus subtilis | 95.06 | |
| d1z4ra1 | 162 | Catalytic domain of GCN5 histone acetyltransferase | 95.05 | |
| d1qsra_ | 162 | Catalytic domain of GCN5 histone acetyltransferase | 95.0 | |
| d1xeba_ | 149 | Hypothetical protein PA0115 {Pseudomonas aeruginos | 90.34 | |
| d1cjxa1 | 150 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom | 87.25 |
| >d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Acyl-CoA N-acyltransferases (Nat) superfamily: Acyl-CoA N-acyltransferases (Nat) family: N-acetyl transferase, NAT domain: Putative ribosomal-protein-serine acetyltransferase VC1889 species: Vibrio cholerae [TaxId: 666]
Probab=99.21 E-value=7.3e-12 Score=78.30 Aligned_cols=43 Identities=12% Similarity=0.108 Sum_probs=40.0
Q ss_pred hHHHHHhhcCceEEEEEeCCCCHHHHHHHHhcCCeEEEEeeee
Q 035156 2 MMAYAVENFGIHVFRAKIGESNGASLCLFRKLGFEDISYSEIF 44 (72)
Q Consensus 2 ~l~ya~~~l~l~~i~a~i~~~N~~Si~LfeklGF~~~g~~~~~ 44 (72)
+++|+|+.++++++.|.|.++|.+|+++++|+||+.+|+.+.+
T Consensus 119 l~~~af~~~~~~~i~~~~~~~N~~s~~l~ek~GF~~eg~~~~~ 161 (178)
T d2fcka1 119 LILFCFERLELTRLEIVCDPENVPSQALALRCGANREQLAPNR 161 (178)
T ss_dssp HHHHHHHTSCCSEEEEEECTTCHHHHHHHHHTTCEEEEEEEEE
T ss_pred eeeeeccccCcceeeEecCCCcHHHHHHHHHCCCEEEEEEeeE
Confidence 7899999999999999999999999999999999999976543
|
| >d1s7ka1 d.108.1.1 (A:3-176) L7/L12-Ribosomal-protein-serine acetyltransferase RimL {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2fsra1 d.108.1.1 (A:4-167) Probable acetyltranferase Atu2435 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1nsla_ d.108.1.1 (A:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yrea1 d.108.1.1 (A:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} | Back information, alignment and structure |
|---|
| >d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} | Back information, alignment and structure |
|---|
| >d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} | Back information, alignment and structure |
|---|
| >d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1cjxa1 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|