Citrus Sinensis ID: 035416


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--
MKGLGTDDTTLVRVIVTRTEIDMQYIKAEYSKKYKKTLTDAVHSETSGNYRAFLLSLLGPKY
cccccccHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHccccHHHHHHHHHHHcccc
HccccccHHHHHHHHHHccHHHHHHHHHHHHHHHcccHHHHHHHHccHHHHHHHHHHHcccc
mkglgtddttLVRVIVTRTEIDMQYIKAEYSKKYKKTLTDAVHSETSGNYRAFLLSLLGPKY
mkglgtddttlvrvivtrteidmqyiKAEYSKKYKKTLTdavhsetsgnyRAFLLSLLGPKY
MKGLGTDDTTLVRVIVTRTEIDMQYIKAEYSKKYKKTLTDAVHSETSGNYRAFLLSLLGPKY
********TTLVRVIVTRTEIDMQYIKAEYSKKYKKTLTDAVHSETSGNYRAFLLSLL****
MKGLGTDDTTLVRVIVTRTEIDMQYIKAEYSKKYKKTLTDAVHSETSGNYRAFLLSLLGPK*
MKGLGTDDTTLVRVIVTRTEIDMQYIKAEYSKKYKKTLTDAVHSETSGNYRAFLLSLLGPKY
*****TDDTTLVRVIVTRTEIDMQYIKAEYSKKYKKTLTDAVHSETSGNYRAFLLSLLGPK*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKGLGTDDTTLVRVIVTRTEIDMQYIKAEYSKKYKKTLTDAVHSETSGNYRAFLLSLLGPKY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query62 2.2.26 [Sep-21-2011]
Q9C9X3316 Annexin D5 OS=Arabidopsis yes no 0.967 0.189 0.7 7e-20
Q99JG3317 Annexin A13 OS=Mus muscul yes no 0.935 0.182 0.586 1e-15
P27216316 Annexin A13 OS=Homo sapie no no 0.935 0.183 0.551 3e-14
P20072463 Annexin A7 OS=Bos taurus yes no 0.951 0.127 0.559 3e-13
Q07076463 Annexin A7 OS=Mus musculu no no 0.951 0.127 0.542 5e-13
Q29471316 Annexin A13 OS=Canis fami no no 0.935 0.183 0.534 6e-13
Q92125512 Annexin A7 OS=Xenopus lae N/A no 0.951 0.115 0.542 8e-13
P20073488 Annexin A7 OS=Homo sapien no no 0.951 0.120 0.525 2e-12
Q4R5L5488 Annexin A7 OS=Macaca fasc N/A no 0.951 0.120 0.525 6e-12
P22465320 Annexin-B10 OS=Drosophila no no 0.951 0.184 0.542 8e-12
>sp|Q9C9X3|ANXD5_ARATH Annexin D5 OS=Arabidopsis thaliana GN=ANN5 PE=2 SV=2 Back     alignment and function desciption
 Score = 95.9 bits (237), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 52/60 (86%)

Query: 1   MKGLGTDDTTLVRVIVTRTEIDMQYIKAEYSKKYKKTLTDAVHSETSGNYRAFLLSLLGP 60
           MKGLGTDDT L+R++VTR E+DMQ+I  EY K+YKKTL +AVHS+T+ +YR FLLSLLGP
Sbjct: 255 MKGLGTDDTALIRIVVTRAEVDMQFIITEYRKRYKKTLYNAVHSDTTSHYRTFLLSLLGP 314





Arabidopsis thaliana (taxid: 3702)
>sp|Q99JG3|ANX13_MOUSE Annexin A13 OS=Mus musculus GN=Anxa13 PE=2 SV=3 Back     alignment and function description
>sp|P27216|ANX13_HUMAN Annexin A13 OS=Homo sapiens GN=ANXA13 PE=1 SV=3 Back     alignment and function description
>sp|P20072|ANXA7_BOVIN Annexin A7 OS=Bos taurus GN=ANXA7 PE=1 SV=2 Back     alignment and function description
>sp|Q07076|ANXA7_MOUSE Annexin A7 OS=Mus musculus GN=Anxa7 PE=2 SV=2 Back     alignment and function description
>sp|Q29471|ANX13_CANFA Annexin A13 OS=Canis familiaris GN=ANXA13 PE=1 SV=2 Back     alignment and function description
>sp|Q92125|ANXA7_XENLA Annexin A7 OS=Xenopus laevis GN=anxa7 PE=2 SV=1 Back     alignment and function description
>sp|P20073|ANXA7_HUMAN Annexin A7 OS=Homo sapiens GN=ANXA7 PE=1 SV=3 Back     alignment and function description
>sp|Q4R5L5|ANXA7_MACFA Annexin A7 OS=Macaca fascicularis GN=ANXA7 PE=2 SV=1 Back     alignment and function description
>sp|P22465|ANX10_DROME Annexin-B10 OS=Drosophila melanogaster GN=AnnX PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query62
224125894 316 predicted protein [Populus trichocarpa] 1.0 0.196 0.838 2e-23
388514123 315 unknown [Lotus japonicus] 0.983 0.193 0.854 3e-23
224120364 316 predicted protein [Populus trichocarpa] 0.967 0.189 0.866 4e-23
356524724 315 PREDICTED: annexin D5-like [Glycine max] 0.967 0.190 0.883 4e-23
255648073 315 unknown [Glycine max] 0.967 0.190 0.883 4e-23
357521715 315 Annexin-like protein [Medicago truncatul 0.951 0.187 0.866 2e-22
414885317 316 TPA: hypothetical protein ZEAMMB73_57035 0.983 0.193 0.806 4e-22
388496086 315 unknown [Medicago truncatula] 0.951 0.187 0.85 5e-22
38828185685 putative annexin, partial [Pyrus pyrifol 1.0 0.729 0.806 6e-22
358248454 317 uncharacterized protein LOC100820062 [Gl 0.983 0.192 0.806 6e-22
>gi|224125894|ref|XP_002329743.1| predicted protein [Populus trichocarpa] gi|222870651|gb|EEF07782.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 52/62 (83%), Positives = 57/62 (91%)

Query: 1   MKGLGTDDTTLVRVIVTRTEIDMQYIKAEYSKKYKKTLTDAVHSETSGNYRAFLLSLLGP 60
           MKG+GT+DT L+RVIVTRTEIDM YIKAEY KKYKKTL DAVHSETSGNYRAFLL+LLGP
Sbjct: 255 MKGMGTNDTALIRVIVTRTEIDMHYIKAEYLKKYKKTLNDAVHSETSGNYRAFLLALLGP 314

Query: 61  KY 62
            +
Sbjct: 315 NH 316




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|388514123|gb|AFK45123.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|224120364|ref|XP_002318311.1| predicted protein [Populus trichocarpa] gi|222858984|gb|EEE96531.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356524724|ref|XP_003530978.1| PREDICTED: annexin D5-like [Glycine max] Back     alignment and taxonomy information
>gi|255648073|gb|ACU24491.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|357521715|ref|XP_003631146.1| Annexin-like protein [Medicago truncatula] gi|355525168|gb|AET05622.1| Annexin-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|414885317|tpg|DAA61331.1| TPA: hypothetical protein ZEAMMB73_570356 [Zea mays] Back     alignment and taxonomy information
>gi|388496086|gb|AFK36109.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|388281856|dbj|BAM15886.1| putative annexin, partial [Pyrus pyrifolia var. culta] Back     alignment and taxonomy information
>gi|358248454|ref|NP_001240140.1| uncharacterized protein LOC100820062 [Glycine max] gi|255642117|gb|ACU21324.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query62
TAIR|locus:2200281316 ANN5 "annexin 5" [Arabidopsis 0.967 0.189 0.7 2.5e-19
MGI|MGI:1917037317 Anxa13 "annexin A13" [Mus musc 0.935 0.182 0.586 3.3e-15
RGD|1307545319 Anxa13 "annexin A13" [Rattus n 0.935 0.181 0.586 4.5e-15
UNIPROTKB|P27216316 ANXA13 "Annexin A13" [Homo sap 0.935 0.183 0.551 7.9e-14
UNIPROTKB|J9P497316 ANXA13 "Annexin" [Canis lupus 0.935 0.183 0.534 6.5e-13
UNIPROTKB|Q29471316 ANXA13 "Annexin A13" [Canis lu 0.935 0.183 0.534 6.5e-13
ZFIN|ZDB-GENE-030131-5274341 anxa1c "annexin A1c" [Danio re 0.951 0.173 0.576 6.5e-13
UNIPROTKB|E1C1D1461 ANXA7 "Annexin" [Gallus gallus 0.951 0.127 0.542 8.6e-13
UNIPROTKB|E2QXD1488 ANXA7 "Annexin" [Canis lupus f 0.951 0.120 0.559 1.2e-12
UNIPROTKB|P20072463 ANXA7 "Annexin A7" [Bos taurus 0.951 0.127 0.559 1.4e-12
TAIR|locus:2200281 ANN5 "annexin 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 231 (86.4 bits), Expect = 2.5e-19, P = 2.5e-19
 Identities = 42/60 (70%), Positives = 52/60 (86%)

Query:     1 MKGLGTDDTTLVRVIVTRTEIDMQYIKAEYSKKYKKTLTDAVHSETSGNYRAFLLSLLGP 60
             MKGLGTDDT L+R++VTR E+DMQ+I  EY K+YKKTL +AVHS+T+ +YR FLLSLLGP
Sbjct:   255 MKGLGTDDTALIRIVVTRAEVDMQFIITEYRKRYKKTLYNAVHSDTTSHYRTFLLSLLGP 314


GO:0005509 "calcium ion binding" evidence=IEA;ISS
GO:0005544 "calcium-dependent phospholipid binding" evidence=IEA;ISS
GO:0009408 "response to heat" evidence=IEP
GO:0009409 "response to cold" evidence=IEP
GO:0009414 "response to water deprivation" evidence=IEP
GO:0009639 "response to red or far red light" evidence=IEP
GO:0009651 "response to salt stress" evidence=IEP
GO:0009827 "plant-type cell wall modification" evidence=RCA
GO:0009860 "pollen tube growth" evidence=RCA
GO:0030048 "actin filament-based movement" evidence=RCA
MGI|MGI:1917037 Anxa13 "annexin A13" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1307545 Anxa13 "annexin A13" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P27216 ANXA13 "Annexin A13" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9P497 ANXA13 "Annexin" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q29471 ANXA13 "Annexin A13" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5274 anxa1c "annexin A1c" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1C1D1 ANXA7 "Annexin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2QXD1 ANXA7 "Annexin" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P20072 ANXA7 "Annexin A7" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.01220062
hypothetical protein (317 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query62
pfam0019166 pfam00191, Annexin, Annexin 3e-21
smart0033553 smart00335, ANX, Annexin repeats 2e-18
>gnl|CDD|201070 pfam00191, Annexin, Annexin Back     alignment and domain information
 Score = 77.5 bits (192), Expect = 3e-21
 Identities = 27/57 (47%), Positives = 38/57 (66%)

Query: 1  MKGLGTDDTTLVRVIVTRTEIDMQYIKAEYSKKYKKTLTDAVHSETSGNYRAFLLSL 57
          MKGLGTD+ TL+R++ TR+   +Q I+  Y K Y K L   + SETSG++   LL+L
Sbjct: 10 MKGLGTDEDTLIRILATRSNAQLQAIREAYKKLYGKDLEKDIKSETSGDFEKLLLAL 66


This family of annexins also includes giardin that has been shown to function as an annexin. Length = 66

>gnl|CDD|197661 smart00335, ANX, Annexin repeats Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 62
PF0019166 Annexin: Annexin; InterPro: IPR018502 The annexins 99.89
KOG0819 321 consensus Annexin [Intracellular trafficking, secr 99.89
smart0033553 ANX Annexin repeats. 99.86
KOG0819 321 consensus Annexin [Intracellular trafficking, secr 99.83
PF1372083 Acetyltransf_11: Udp N-acetylglucosamine O-acyltra 83.62
PF1304340 DUF3903: Domain of unknown function (DUF3903) 82.82
>PF00191 Annexin: Annexin; InterPro: IPR018502 The annexins (or lipocortins) are a family of proteins that bind to phospholipids in a calcium-dependent manner [] Back     alignment and domain information
Probab=99.89  E-value=4.6e-23  Score=106.83  Aligned_cols=57  Identities=40%  Similarity=0.765  Sum_probs=54.4

Q ss_pred             CCcccCCHHHHHHHHhhCCHHHHHHHHHHHHhccCccHHHHHhhcccHHHHHHHHHh
Q 035416            1 MKGLGTDDTTLVRVIVTRTEIDMQYIKAEYSKKYKKTLTDAVHSETSGNYRAFLLSL   57 (62)
Q Consensus         1 mkg~gtde~~Li~il~~rs~~~l~~i~~~Y~~~y~~~L~~~i~~~~sG~~~~~ll~l   57 (62)
                      |+|+|||+..+++|+++||+.|+.+|+++|++.||++|.++|++++||+|+++|++|
T Consensus        10 ~~~~g~de~~li~Il~~rs~~ql~~i~~~Y~~~~g~~L~~~i~~e~sGd~~~~Ll~l   66 (66)
T PF00191_consen   10 LKGWGTDEDVLIEILCTRSPAQLRAIKQAYKKKYGKDLEEDIKKETSGDFEKLLLAL   66 (66)
T ss_dssp             HSSSSSTHHHHHHHHHHSTHHHHHHHHHHHHHHHSS-HHHHHHHHSTHHHHHHHHHH
T ss_pred             ccCCCCChhHhhhHHhhhcccccceeehhhhhhhHHHHHHHHHHhCCHHHHHHHHhC
Confidence            589999999999999999999999999999999999999999999999999999986



They are distributed ubiquitously in different tissues and cell types of higher and lower eukaryotes, including mammals, fish, birds, Drosophila melanogaster (Fruit fly), Xenopus laevis (African clawed frog), Caenorhabditis elegans , Dictyostelium discoideum (Slime mold) and Neurospora crassa [, ]. Annexins are absent from yeasts and prokaryotes []. The plant annexins are somewhat distinct from those found in other taxa []. Most eukaryotic species have 1-20 annexin (ANX) genes. All annexins share a core domain made up of four similar repeats, each approximately 70 amino acids long []. Each individual annexin repeat (sometimes referred to as endonexin folds) is folded into five alpha-helices, and in turn are wound into a right-handed super-helix; they usually contain a characteristic 'type 2' motif for binding calcium ions with the sequence 'GxGT-[38 residues]-D/E'. Animal and fungal annexins also have variable amino-terminal domains. The core domains of most vertebrate annexins have been analysed by X-ray crystallography, revealing conservation of their secondary and tertiary structures despite only 45-55% amino-acid identity among individual members. The four repeats pack into a structure that resembles a flattened disc, with a slightly convex surface on which the Ca 2+ -binding loops are located and a concave surface at which the amino and carboxyl termini come into close apposition. Annexins are traditionally thought of as calcium-dependent phospholipid-binding proteins, but recent work suggests a more complex set of functions. The famiy has been linked with inhibition of phospholipase activity, exocytosis and endoctyosis, signal transduction, organisation of the extracellular matrix, resistance to reactive oxygen species and DNA replication [].; GO: 0005509 calcium ion binding, 0005544 calcium-dependent phospholipid binding; PDB: 1N44_A 1BC1_A 2IE6_A 2H0M_A 1A8B_A 2H0K_A 1BCW_A 1BCZ_A 1N42_A 1BC0_A ....

>KOG0819 consensus Annexin [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00335 ANX Annexin repeats Back     alignment and domain information
>KOG0819 consensus Annexin [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13720 Acetyltransf_11: Udp N-acetylglucosamine O-acyltransferase; Domain 2; PDB: 3I3A_A 3I3X_A 3HSQ_B 2JF2_A 1LXA_A 2AQ9_A 2QIV_X 2QIA_A 2JF3_A 4EQY_F Back     alignment and domain information
>PF13043 DUF3903: Domain of unknown function (DUF3903) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query62
2zhi_A322 Crystal Structure Analysis Of The Sodium-Bound Anne 2e-12
2zoc_A319 Crystal Structure Of Recombinant Human Annexin Iv L 2e-12
1ann_A318 Annexin Iv Length = 318 4e-12
1i4a_A318 Crystal Structure Of Phosphorylation-Mimicking Muta 4e-12
1aow_A309 Annexin Iv Length = 309 4e-12
1w3w_A327 The 2.1 Angstroem Resolution Structure Of Annexin A 1e-11
1w45_A327 The 2.5 Angstroem Structure Of The K16a Mutant Of A 1e-11
1yii_A320 Crystal Structures Of Chicken Annexin V In Complex 1e-11
1ala_A321 Structure Of Chicken Annexin V At 2.25-Angstroms Re 1e-11
1m9i_A672 Crystal Structure Of Phosphorylation-Mimicking Muta 2e-11
1bcz_A319 Recombinant Rat Annexin V, T72s Mutant Length = 319 1e-10
1bc0_A319 Recombinant Rat Annexin V, W185a Mutant Length = 31 1e-10
1g5n_A318 Annexin V Complex With Heparin Oligosaccharides Len 1e-10
1a8a_A319 Rat Annexin V Complexed With Glycerophosphoserine L 1e-10
2ran_A316 Rat Annexin V Crystal Structure: Ca2+-Induced Confo 1e-10
1bcw_A319 Recombinant Rat Annexin V, T72a Mutant Length = 319 1e-10
1bcy_A319 Recombinant Rat Annexin V, T72k Mutant Length = 319 1e-10
1n44_A319 Crystal Structure Of Annexin V R23e Mutant Length = 1e-10
1n42_A319 Crystal Structure Of Annexin V R149e Mutant Length 1e-10
1bc3_A319 Recombinant Rat Annexin V, Triple Mutant (T72k, S14 1e-10
1n41_A319 Crystal Structure Of Annexin V K27e Mutant Length = 1e-10
1hm6_A346 X-Ray Structure Of Full-Length Annexin 1 Length = 3 2e-10
2h0l_A318 Crystal Structure Of A Mutant Of Rat Annexin A5 Len 3e-10
2h0k_A318 Crystal Structure Of A Mutant Of Rat Annexin A5 Len 3e-10
2h0m_A318 Structure Of A Mutant Of Rat Annexin A5 Length = 31 3e-10
1sav_A320 Human Annexin V With Proline Substitution By Thiopr 3e-10
1avc_A 673 Bovine Annexin Vi (Calcium-Bound) Length = 673 3e-10
1avh_A320 Crystal And Molecular Structure Of Human Annexin V 3e-10
1hve_A319 Structural And Electrophysiological Analysis Of Ann 3e-10
1anw_A319 The Effect Of Metal Binding On The Structure Of Ann 3e-10
1hvd_A319 Structural And Electrophysiological Analysis Of Ann 4e-10
1hvf_A319 Structural And Electrophysiological Analysis Of Ann 4e-10
1bc1_A319 Recombinant Rat Annexin V, Quadruple Mutant (T72k, 5e-10
1ain_A314 Crystal Structure Of Human Annexin I At 2.5 Angstro 8e-10
1aei_A315 Crystal Structure Of The Annexin Xii Hexamer Length 9e-10
1dm5_A315 Annexin Xii E105k Homohexamer Crystal Structure Len 9e-10
1aii_A323 Annexin Iii Length = 323 1e-09
1axn_A323 The High Resolution Structure Of Annexin Iii Shows 1e-09
1xjl_A319 Structure Of Human Annexin A2 In The Presence Of Ca 2e-09
1w7b_A339 Annexin A2: Does It Induce Membrane Aggregation By 3e-09
2hyu_A308 Human Annexin A2 With Heparin Tetrasaccharide Bound 3e-09
2xo2_A320 Human Annexin V With Incorporated Methionine Analog 3e-09
1dk5_A322 Crystal Structure Of Annexin 24(Ca32) From Capsicum 4e-07
1n00_A321 Annexin Gh1 From Cotton Length = 321 7e-07
3brx_A317 Crystal Structure Of Calcium-Bound Cotton Annexin G 7e-07
1ycn_A317 X-Ray Structure Of Annexin From Arabidopsis Thalian 8e-07
>pdb|2ZHI|A Chain A, Crystal Structure Analysis Of The Sodium-Bound Annexin A4 At 1.58 A Resolution Length = 322 Back     alignment and structure

Iteration: 1

Score = 67.4 bits (163), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 32/59 (54%), Positives = 43/59 (72%) Query: 1 MKGLGTDDTTLVRVIVTRTEIDMQYIKAEYSKKYKKTLTDAVHSETSGNYRAFLLSLLG 59 MKGLGTDD+TL+RV+V+R EIDM I+A + + Y K+L + +TSG+YR LL L G Sbjct: 261 MKGLGTDDSTLIRVMVSRAEIDMLDIRANFKRLYGKSLYSFIKGDTSGDYRKVLLILCG 319
>pdb|2ZOC|A Chain A, Crystal Structure Of Recombinant Human Annexin Iv Length = 319 Back     alignment and structure
>pdb|1ANN|A Chain A, Annexin Iv Length = 318 Back     alignment and structure
>pdb|1I4A|A Chain A, Crystal Structure Of Phosphorylation-Mimicking Mutant T6d Of Annexin Iv Length = 318 Back     alignment and structure
>pdb|1AOW|A Chain A, Annexin Iv Length = 309 Back     alignment and structure
>pdb|1W3W|A Chain A, The 2.1 Angstroem Resolution Structure Of Annexin A8 Length = 327 Back     alignment and structure
>pdb|1W45|A Chain A, The 2.5 Angstroem Structure Of The K16a Mutant Of Annexin A8, Which Has An Intact N-Terminus. Length = 327 Back     alignment and structure
>pdb|1YII|A Chain A, Crystal Structures Of Chicken Annexin V In Complex With Ca2+ Length = 320 Back     alignment and structure
>pdb|1ALA|A Chain A, Structure Of Chicken Annexin V At 2.25-Angstroms Resolution Length = 321 Back     alignment and structure
>pdb|1M9I|A Chain A, Crystal Structure Of Phosphorylation-Mimicking Mutant T356d Of Annexin Vi Length = 672 Back     alignment and structure
>pdb|1BCZ|A Chain A, Recombinant Rat Annexin V, T72s Mutant Length = 319 Back     alignment and structure
>pdb|1BC0|A Chain A, Recombinant Rat Annexin V, W185a Mutant Length = 319 Back     alignment and structure
>pdb|1G5N|A Chain A, Annexin V Complex With Heparin Oligosaccharides Length = 318 Back     alignment and structure
>pdb|1A8A|A Chain A, Rat Annexin V Complexed With Glycerophosphoserine Length = 319 Back     alignment and structure
>pdb|2RAN|A Chain A, Rat Annexin V Crystal Structure: Ca2+-Induced Conformational Changes Length = 316 Back     alignment and structure
>pdb|1BCW|A Chain A, Recombinant Rat Annexin V, T72a Mutant Length = 319 Back     alignment and structure
>pdb|1BCY|A Chain A, Recombinant Rat Annexin V, T72k Mutant Length = 319 Back     alignment and structure
>pdb|1N44|A Chain A, Crystal Structure Of Annexin V R23e Mutant Length = 319 Back     alignment and structure
>pdb|1N42|A Chain A, Crystal Structure Of Annexin V R149e Mutant Length = 319 Back     alignment and structure
>pdb|1BC3|A Chain A, Recombinant Rat Annexin V, Triple Mutant (T72k, S144k, S228k) Length = 319 Back     alignment and structure
>pdb|1N41|A Chain A, Crystal Structure Of Annexin V K27e Mutant Length = 319 Back     alignment and structure
>pdb|1HM6|A Chain A, X-Ray Structure Of Full-Length Annexin 1 Length = 346 Back     alignment and structure
>pdb|2H0L|A Chain A, Crystal Structure Of A Mutant Of Rat Annexin A5 Length = 318 Back     alignment and structure
>pdb|2H0K|A Chain A, Crystal Structure Of A Mutant Of Rat Annexin A5 Length = 318 Back     alignment and structure
>pdb|2H0M|A Chain A, Structure Of A Mutant Of Rat Annexin A5 Length = 318 Back     alignment and structure
>pdb|1SAV|A Chain A, Human Annexin V With Proline Substitution By Thioproline Length = 320 Back     alignment and structure
>pdb|1AVC|A Chain A, Bovine Annexin Vi (Calcium-Bound) Length = 673 Back     alignment and structure
>pdb|1AVH|A Chain A, Crystal And Molecular Structure Of Human Annexin V After Refinement. Implications For Structure, Membrane Binding And Ion Channel Formation Of The Annexin Family Of Proteins Length = 320 Back     alignment and structure
>pdb|1HVE|A Chain A, Structural And Electrophysiological Analysis Of Annexin V Mutants. Mutagenesis Of Human Annexin V, An In Vitro Voltage-Gated Calcium Channel, Provides Information About The Structural Features Of The Ion Pathway, The Voltage Sensor And The Ion Selectivity Filter Length = 319 Back     alignment and structure
>pdb|1ANW|A Chain A, The Effect Of Metal Binding On The Structure Of Annexin V And Implications For Membrane Binding Length = 319 Back     alignment and structure
>pdb|1HVD|A Chain A, Structural And Electrophysiological Analysis Of Annexin V Mutants. Mutagenesis Of Human Annexin V, An In Vitro Voltage-Gated Calcium Channel, Provides Information About The Structural Features Of The Ion Pathway, The Voltage Sensor And The Ion Selectivity Filter Length = 319 Back     alignment and structure
>pdb|1HVF|A Chain A, Structural And Electrophysiological Analysis Of Annexin V Mutants. Mutagenesis Of Human Annexin V, An In Vitro Voltage-Gated Calcium Channel, Provides Information About The Structural Features Of The Ion Pathway, The Voltage Sensor And The Ion Selectivity Filter Length = 319 Back     alignment and structure
>pdb|1BC1|A Chain A, Recombinant Rat Annexin V, Quadruple Mutant (T72k, S144k, S228k, S303k) Length = 319 Back     alignment and structure
>pdb|1AIN|A Chain A, Crystal Structure Of Human Annexin I At 2.5 Angstroms Resolution Length = 314 Back     alignment and structure
>pdb|1AEI|A Chain A, Crystal Structure Of The Annexin Xii Hexamer Length = 315 Back     alignment and structure
>pdb|1DM5|A Chain A, Annexin Xii E105k Homohexamer Crystal Structure Length = 315 Back     alignment and structure
>pdb|1AII|A Chain A, Annexin Iii Length = 323 Back     alignment and structure
>pdb|1AXN|A Chain A, The High Resolution Structure Of Annexin Iii Shows Differences With Annexin V Length = 323 Back     alignment and structure
>pdb|1XJL|A Chain A, Structure Of Human Annexin A2 In The Presence Of Calcium Ions Length = 319 Back     alignment and structure
>pdb|1W7B|A Chain A, Annexin A2: Does It Induce Membrane Aggregation By A New Multimeric State Of The Protein Length = 339 Back     alignment and structure
>pdb|2HYU|A Chain A, Human Annexin A2 With Heparin Tetrasaccharide Bound Length = 308 Back     alignment and structure
>pdb|2XO2|A Chain A, Human Annexin V With Incorporated Methionine Analogue Azidohomoalanine Length = 320 Back     alignment and structure
>pdb|1DK5|A Chain A, Crystal Structure Of Annexin 24(Ca32) From Capsicum Annuum Length = 322 Back     alignment and structure
>pdb|1N00|A Chain A, Annexin Gh1 From Cotton Length = 321 Back     alignment and structure
>pdb|3BRX|A Chain A, Crystal Structure Of Calcium-Bound Cotton Annexin Gh1 Length = 317 Back     alignment and structure
>pdb|1YCN|A Chain A, X-Ray Structure Of Annexin From Arabidopsis Thaliana Gene At1g35720 Length = 317 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query62
1n00_A321 Annexin GH1; membrane-binding, calcium-binding, me 3e-24
1n00_A 321 Annexin GH1; membrane-binding, calcium-binding, me 3e-13
1n00_A 321 Annexin GH1; membrane-binding, calcium-binding, me 2e-11
1n00_A321 Annexin GH1; membrane-binding, calcium-binding, me 3e-08
1axn_A323 Annexin III; annexin family, calcium/phospholipid- 8e-24
1axn_A 323 Annexin III; annexin family, calcium/phospholipid- 2e-15
1axn_A 323 Annexin III; annexin family, calcium/phospholipid- 6e-12
1axn_A323 Annexin III; annexin family, calcium/phospholipid- 2e-06
1w3w_A327 Annexin A8; coagulation, annexin family, calcium a 1e-23
1w3w_A 327 Annexin A8; coagulation, annexin family, calcium a 6e-15
1w3w_A 327 Annexin A8; coagulation, annexin family, calcium a 3e-11
1w3w_A327 Annexin A8; coagulation, annexin family, calcium a 5e-07
1dm5_A315 Annexin XII E105K mutant homohexamer; novel PH-dep 1e-22
1dm5_A 315 Annexin XII E105K mutant homohexamer; novel PH-dep 3e-15
1dm5_A 315 Annexin XII E105K mutant homohexamer; novel PH-dep 2e-10
1dm5_A315 Annexin XII E105K mutant homohexamer; novel PH-dep 1e-06
1yii_A320 Annexin A5, annexin V, lipocortin V, endonexin II; 1e-22
1yii_A 320 Annexin A5, annexin V, lipocortin V, endonexin II; 3e-14
1yii_A 320 Annexin A5, annexin V, lipocortin V, endonexin II; 5e-12
1yii_A320 Annexin A5, annexin V, lipocortin V, endonexin II; 1e-05
2zhj_A322 Annexin A4; zynogen granule, membrane binding prot 2e-22
2zhj_A 322 Annexin A4; zynogen granule, membrane binding prot 2e-15
2zhj_A 322 Annexin A4; zynogen granule, membrane binding prot 1e-11
2zhj_A322 Annexin A4; zynogen granule, membrane binding prot 2e-06
2hyv_A308 Annexin A2; calcium-binding protein, membrane-bind 2e-22
2hyv_A 308 Annexin A2; calcium-binding protein, membrane-bind 3e-15
2hyv_A 308 Annexin A2; calcium-binding protein, membrane-bind 2e-12
2hyv_A308 Annexin A2; calcium-binding protein, membrane-bind 6e-08
1hm6_A346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 4e-22
1hm6_A 346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 6e-14
1hm6_A 346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 4e-11
1hm6_A346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 3e-07
3chj_A337 Alpha-14 giardin; calcium-binding, annexin, metal 6e-22
3chj_A 337 Alpha-14 giardin; calcium-binding, annexin, metal 9e-13
3chj_A 337 Alpha-14 giardin; calcium-binding, annexin, metal 1e-08
3chj_A337 Alpha-14 giardin; calcium-binding, annexin, metal 7e-04
1m9i_A672 Annexin VI; calcium-binding, membrane-binding, pho 8e-22
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 4e-20
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 1e-15
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 3e-15
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 1e-11
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 2e-10
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 2e-07
1m9i_A672 Annexin VI; calcium-binding, membrane-binding, pho 4e-07
2ii2_A310 Alpha-11 giardin; helix-turn-helix, metal binding 3e-18
2ii2_A310 Alpha-11 giardin; helix-turn-helix, metal binding 3e-09
2ii2_A 310 Alpha-11 giardin; helix-turn-helix, metal binding 4e-08
2ii2_A 310 Alpha-11 giardin; helix-turn-helix, metal binding 1e-07
4evf_A 295 Alpha-1 giardin, giardin subunit alpha-1; annexin, 3e-12
4evf_A295 Alpha-1 giardin, giardin subunit alpha-1; annexin, 5e-11
4evf_A295 Alpha-1 giardin, giardin subunit alpha-1; annexin, 9e-09
4evf_A 295 Alpha-1 giardin, giardin subunit alpha-1; annexin, 6e-08
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Length = 321 Back     alignment and structure
 Score = 90.4 bits (224), Expect = 3e-24
 Identities = 23/59 (38%), Positives = 34/59 (57%)

Query: 1   MKGLGTDDTTLVRVIVTRTEIDMQYIKAEYSKKYKKTLTDAVHSETSGNYRAFLLSLLG 59
           +   GTD+  L RV+ TR E+D++ I  EY ++    LT A+  +T G+Y   LL L G
Sbjct: 259 INRRGTDEGALTRVVCTRAEVDLKVIADEYQRRNSVPLTRAIVKDTHGDYEKLLLVLAG 317


>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Length = 321 Back     alignment and structure
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Length = 321 Back     alignment and structure
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Length = 321 Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Length = 323 Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Length = 323 Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Length = 323 Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Length = 323 Back     alignment and structure
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Length = 327 Back     alignment and structure
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Length = 327 Back     alignment and structure
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Length = 327 Back     alignment and structure
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Length = 327 Back     alignment and structure
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Length = 315 Back     alignment and structure
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Length = 315 Back     alignment and structure
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Length = 315 Back     alignment and structure
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Length = 315 Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Length = 320 Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Length = 320 Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Length = 320 Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Length = 320 Back     alignment and structure
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Length = 322 Back     alignment and structure
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Length = 322 Back     alignment and structure
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Length = 322 Back     alignment and structure
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Length = 322 Back     alignment and structure
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Length = 308 Back     alignment and structure
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Length = 308 Back     alignment and structure
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Length = 308 Back     alignment and structure
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Length = 308 Back     alignment and structure
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Length = 346 Back     alignment and structure
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Length = 346 Back     alignment and structure
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Length = 346 Back     alignment and structure
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Length = 346 Back     alignment and structure
>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Length = 337 Back     alignment and structure
>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Length = 337 Back     alignment and structure
>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Length = 337 Back     alignment and structure
>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Length = 337 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Length = 310 Back     alignment and structure
>2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Length = 310 Back     alignment and structure
>2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Length = 310 Back     alignment and structure
>2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Length = 310 Back     alignment and structure
>4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Length = 295 Back     alignment and structure
>4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Length = 295 Back     alignment and structure
>4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Length = 295 Back     alignment and structure
>4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Length = 295 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query62
2hyv_A 308 Annexin A2; calcium-binding protein, membrane-bind 99.87
1hm6_A 346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 99.86
1n00_A 321 Annexin GH1; membrane-binding, calcium-binding, me 99.86
1axn_A 323 Annexin III; annexin family, calcium/phospholipid- 99.86
1w3w_A 327 Annexin A8; coagulation, annexin family, calcium a 99.85
1dm5_A 315 Annexin XII E105K mutant homohexamer; novel PH-dep 99.85
1yii_A 320 Annexin A5, annexin V, lipocortin V, endonexin II; 99.85
1w3w_A327 Annexin A8; coagulation, annexin family, calcium a 99.85
1dm5_A315 Annexin XII E105K mutant homohexamer; novel PH-dep 99.84
2zhj_A 322 Annexin A4; zynogen granule, membrane binding prot 99.84
2zhj_A 322 Annexin A4; zynogen granule, membrane binding prot 99.83
1n00_A321 Annexin GH1; membrane-binding, calcium-binding, me 99.83
1yii_A 320 Annexin A5, annexin V, lipocortin V, endonexin II; 99.83
1hm6_A346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 99.82
2hyv_A308 Annexin A2; calcium-binding protein, membrane-bind 99.82
1axn_A 323 Annexin III; annexin family, calcium/phospholipid- 99.82
3chj_A 337 Alpha-14 giardin; calcium-binding, annexin, metal 99.81
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 99.81
1m9i_A672 Annexin VI; calcium-binding, membrane-binding, pho 99.81
2ii2_A 310 Alpha-11 giardin; helix-turn-helix, metal binding 99.77
4evf_A 295 Alpha-1 giardin, giardin subunit alpha-1; annexin, 99.77
4evf_A 295 Alpha-1 giardin, giardin subunit alpha-1; annexin, 99.76
3chj_A337 Alpha-14 giardin; calcium-binding, annexin, metal 99.71
2ii2_A310 Alpha-11 giardin; helix-turn-helix, metal binding 99.7
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Back     alignment and structure
Probab=99.87  E-value=3.6e-22  Score=127.68  Aligned_cols=61  Identities=38%  Similarity=0.701  Sum_probs=59.2

Q ss_pred             CCcccCCHHHHHHHHhhCCHHHHHHHHHHHHhccCccHHHHHhhcccHHHHHHHHHhcCCC
Q 035416            1 MKGLGTDDTTLVRVIVTRTEIDMQYIKAEYSKKYKKTLTDAVHSETSGNYRAFLLSLLGPK   61 (62)
Q Consensus         1 mkg~gtde~~Li~il~~rs~~~l~~i~~~Y~~~y~~~L~~~i~~~~sG~~~~~ll~l~~~~   61 (62)
                      |||+||||.+||+|||+|||.|++.|+++|+++||++|+++|++++||+|+++|++|+.++
T Consensus        87 mkG~Gtde~~LieIL~~Rs~~q~~~Ik~aY~~~y~~~L~~di~se~sG~f~~ll~~l~~~~  147 (308)
T 2hyv_A           87 MKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGR  147 (308)
T ss_dssp             TSTTCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHSSCHHHHHHHTCCHHHHHHHHHHHTCC
T ss_pred             hhcCCCCHHHHHHHHhcCCHHHHHHHHHHHHHhhCCCHHHHHhhccCccHHHHHHHHHccc
Confidence            7999999999999999999999999999999999999999999999999999999999753



>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Back     alignment and structure
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Back     alignment and structure
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Back     alignment and structure
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Back     alignment and structure
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Back     alignment and structure
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Back     alignment and structure
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Back     alignment and structure
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Back     alignment and structure
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Back     alignment and structure
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Back     alignment and structure
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Back     alignment and structure
>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Back     alignment and structure
>2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Back     alignment and structure
>4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Back     alignment and structure
>4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Back     alignment and structure
>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Back     alignment and structure
>2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 62
d1hm6a_343 a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 6e-27
d1hm6a_ 343 a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 2e-12
d1hm6a_ 343 a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 7e-09
d1hm6a_343 a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 3e-05
d1avca2321 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) 3e-26
d1avca2 321 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) 8e-13
d1avca2 321 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) 4e-09
d1avca2321 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) 1e-04
d1dm5a_315 a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 5e-26
d1dm5a_ 315 a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 2e-13
d1dm5a_ 315 a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 1e-08
d1dm5a_315 a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 5e-05
d1axna_323 a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [T 6e-26
d1axna_ 323 a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [T 8e-13
d1axna_ 323 a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [T 3e-10
d1axna_323 a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [T 1e-04
d2ie7a1318 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegic 7e-26
d2ie7a1 318 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegic 2e-13
d2ie7a1 318 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegic 4e-10
d2ie7a1318 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegic 2e-06
d1n00a_318 a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsu 8e-26
d1n00a_ 318 a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsu 1e-12
d1n00a_ 318 a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsu 2e-08
d1avca1341 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [ 8e-26
d1avca1 341 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [ 8e-13
d1avca1 341 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [ 1e-09
d1avca1341 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [ 5e-04
d1w7ba_319 a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [Ta 1e-25
d1w7ba_ 319 a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [Ta 7e-13
d1w7ba_ 319 a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [Ta 5e-10
d1w7ba_319 a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [Ta 5e-06
d1i4aa_309 a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 1e-24
d1i4aa_ 309 a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 4e-13
d1i4aa_ 309 a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 4e-10
d1i4aa_309 a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 2e-06
d1bo9a_73 a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [Tax 2e-20
>d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Length = 343 Back     information, alignment and structure

class: All alpha proteins
fold: Annexin
superfamily: Annexin
family: Annexin
domain: Annexin I
species: Pig (Sus scrofa) [TaxId: 9823]
 Score = 97.0 bits (241), Expect = 6e-27
 Identities = 29/59 (49%), Positives = 40/59 (67%)

Query: 1   MKGLGTDDTTLVRVIVTRTEIDMQYIKAEYSKKYKKTLTDAVHSETSGNYRAFLLSLLG 59
           MKG+GT   TL+R++V+R+EIDM  IKA Y K Y  +L  A+  ET G+Y   L++L G
Sbjct: 285 MKGIGTRHKTLIRIMVSRSEIDMNDIKACYQKLYGISLCQAILDETKGDYEKILVALCG 343


>d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Length = 343 Back     information, alignment and structure
>d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Length = 343 Back     information, alignment and structure
>d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Length = 343 Back     information, alignment and structure
>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 321 Back     information, alignment and structure
>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 321 Back     information, alignment and structure
>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 321 Back     information, alignment and structure
>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 321 Back     information, alignment and structure
>d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Length = 315 Back     information, alignment and structure
>d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Length = 315 Back     information, alignment and structure
>d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Length = 315 Back     information, alignment and structure
>d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Length = 315 Back     information, alignment and structure
>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 318 Back     information, alignment and structure
>d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 318 Back     information, alignment and structure
>d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 318 Back     information, alignment and structure
>d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 318 Back     information, alignment and structure
>d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Length = 318 Back     information, alignment and structure
>d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Length = 318 Back     information, alignment and structure
>d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Length = 318 Back     information, alignment and structure
>d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 341 Back     information, alignment and structure
>d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 341 Back     information, alignment and structure
>d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 341 Back     information, alignment and structure
>d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 341 Back     information, alignment and structure
>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Length = 319 Back     information, alignment and structure
>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Length = 319 Back     information, alignment and structure
>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Length = 319 Back     information, alignment and structure
>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Length = 319 Back     information, alignment and structure
>d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Length = 309 Back     information, alignment and structure
>d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Length = 309 Back     information, alignment and structure
>d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Length = 309 Back     information, alignment and structure
>d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Length = 309 Back     information, alignment and structure
>d1bo9a_ a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query62
d1bo9a_73 Annexin I {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1avca2321 Annexin VI {Cow (Bos taurus) [TaxId: 9913]} 99.85
d1avca1341 Annexin VI {Cow (Bos taurus) [TaxId: 9913]} 99.84
d1i4aa_309 Annexin IV {Cow (Bos taurus) [TaxId: 9913]} 99.83
d1axna_323 Annexin III {Human (Homo sapiens) [TaxId: 9606]} 99.83
d2ie7a1318 Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} 99.82
d1avca2 321 Annexin VI {Cow (Bos taurus) [TaxId: 9913]} 99.82
d1w7ba_319 Annexin II {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1hm6a_343 Annexin I {Pig (Sus scrofa) [TaxId: 9823]} 99.81
d1w7ba_ 319 Annexin II {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1n00a_ 318 Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3 99.81
d1hm6a_ 343 Annexin I {Pig (Sus scrofa) [TaxId: 9823]} 99.81
d1dm5a_315 Annexin XII {Hydra vulgaris [TaxId: 6087]} 99.81
d1avca1 341 Annexin VI {Cow (Bos taurus) [TaxId: 9913]} 99.8
d1n00a_ 318 Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3 99.8
d1axna_ 323 Annexin III {Human (Homo sapiens) [TaxId: 9606]} 99.8
d1dm5a_ 315 Annexin XII {Hydra vulgaris [TaxId: 6087]} 99.8
d1i4aa_ 309 Annexin IV {Cow (Bos taurus) [TaxId: 9913]} 99.8
d2ie7a1 318 Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} 99.8
>d1bo9a_ a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Annexin
superfamily: Annexin
family: Annexin
domain: Annexin I
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.90  E-value=2.9e-26  Score=119.86  Aligned_cols=59  Identities=25%  Similarity=0.455  Sum_probs=57.4

Q ss_pred             CCcccCCHHHHHHHHhhCCHHHHHHHHHHHHhccCccHHHHHhhcccHHHHHHHHHhcC
Q 035416            1 MKGLGTDDTTLVRVIVTRTEIDMQYIKAEYSKKYKKTLTDAVHSETSGNYRAFLLSLLG   59 (62)
Q Consensus         1 mkg~gtde~~Li~il~~rs~~~l~~i~~~Y~~~y~~~L~~~i~~~~sG~~~~~ll~l~~   59 (62)
                      |+|+||||.+||+||++||+.|+..|+++|++.||++|.++|++++||+|+++|++|++
T Consensus        15 ~kG~Gtde~~li~Il~~rs~~~l~~i~~~Y~~~y~~~L~~~i~~e~sG~~~~~llall~   73 (73)
T d1bo9a_          15 IMVKGVDEATIIDILTKRNNAQRQQIKAAYLQETGKPLDETLKKALTGHLEEVVLALLK   73 (73)
T ss_dssp             HTTSSCCSSSHHHHHHHSCSTTHHHHHHHHHHHTSSCSSHHHHHHSCTTSTHHHHGGGC
T ss_pred             hcCCCCCHHHHHHHHHhCCHHHHHHHHHHHHHHHCcCHHHHHHHHCCcHHHHHHHHHhC
Confidence            68999999999999999999999999999999999999999999999999999999974



>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Back     information, alignment and structure
>d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Back     information, alignment and structure
>d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Back     information, alignment and structure
>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Back     information, alignment and structure
>d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure