Citrus Sinensis ID: 035519

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MEAVTIYLSIYFCLLFLLVLIRFINKLWWNPIWTQSQMRSQGIKGPSYKFIHGNTKEIINMTNEIMSSPMELTHQIFPRVYPHVYSWIKLYGTNFLMWNGLQPQLVVAEPDLIKEILNDKDRAYPKREPTNFIKKFLGDGLVTTQGEKWFKQRKLANHAFHVETLKVNA
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHccccEEEEccccEEEEccHHHHHHHHHccccccccccccHHHHHHHHcccccccccHHHHHHccccccccHHHHHccc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccccccEEEcccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccEEEEEccccEEEEccHHHHHHHHHHcccccccccccHHHHHHHHcccEccccHHHHHHHHHHcHHccHHHHHHHc
MEAVTIYLSIYFCLLFLLVLIRFINKlwwnpiwtqsqmrsqgikgpsykfihgNTKEIINMTNEimsspmelthqifprvyphVYSWIKLYGTnflmwnglqpqlvvaePDLIKEILndkdraypkreptNFIKKFLGDGLVTTQGEKWFKQRKLANHAFHVETLKVNA
MEAVTIYLSIYFCLLFLLVLIRFINKLWWNPIWTQSQMRSQGIKGPSYKFIHGNTKEIINMTNEIMSSPMELTHQIFPRVYPHVYSWIKLYGTNFLMWNGLQPQLVVAEPDLIKEIlndkdraypkrepTNFIKKFLGDGLVTTQGEKWFKQRKLANhafhvetlkvna
MEAVTIYLSIYFCLLFLLVLIRFINKLWWNPIWTQSQMRSQGIKGPSYKFIHGNTKEIINMTNEIMSSPMELTHQIFPRVYPHVYSWIKLYGTNFLMWNGLQPQLVVAEPDLIKEILNDKDRAYPKREPTNFIKKFLGDGLVTTQGEKWFKQRKLANHAFHVETLKVNA
***VTIYLSIYFCLLFLLVLIRFINKLWWNPIWTQSQMRSQGIKGPSYKFIHGNTKEIINMTNEIMSSPMELTHQIFPRVYPHVYSWIKLYGTNFLMWNGLQPQLVVAEPDLIKEILNDKDRAYPKREPTNFIKKFLGDGLVTTQGEKWFKQRKLANHAFHVET*****
*EAVTIYLSIYFCLLFLLVLIRFINKLWWNPIWTQSQMRSQGIKGPSYKFIHGNTKEIIN**********ELTHQIFPRVYPHVYSWIKLYGTNFLMWNGLQPQLVVAEPDLIKEILNDKDRAYPKREPTNFIKKFLGDGLVTTQGEKWFKQRKLANHAFHVETLKVNA
MEAVTIYLSIYFCLLFLLVLIRFINKLWWNPIWTQSQMRSQGIKGPSYKFIHGNTKEIINMTNEIMSSPMELTHQIFPRVYPHVYSWIKLYGTNFLMWNGLQPQLVVAEPDLIKEILNDKDRAYPKREPTNFIKKFLGDGLVTTQGEKWFKQRKLANHAFHVETLKVNA
MEAVTIYLSIYFCLLFLLVLIRFINKLWWNPIWTQSQMRSQGIKGPSYKFIHGNTKEIINMTNEIMSSPMELTHQIFPRVYPHVYSWIKLYGTNFLMWNGLQPQLVVAEPDLIKEILNDKDRAYPKREPTNFIKKFLGDGLVTTQGEKWFKQRKLANHAFHVETLKVN*
ooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEAVTIYLSIYFCLLFLLVLIRFINKLWWNPIWTQSQMRSQGIKGPSYKFIHGNTKEIINMTNEIMSSPMELTHQIFPRVYPHVYSWIKLYGTNFLMWNGLQPQLVVAEPDLIKEILNDKDRAYPKREPTNFIKKFLGDGLVTTQGEKWFKQRKLANHAFHVETLKVNA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query169 2.2.26 [Sep-21-2011]
O48786 520 Cytochrome P450 734A1 OS= yes no 0.928 0.301 0.398 4e-30
Q8LIF2 537 Cytochrome P450 734A5 OS= yes no 0.846 0.266 0.386 2e-27
Q6Z6D6 557 Cytochrome P450 734A2 OS= no no 0.869 0.263 0.362 7e-27
B9X287 542 Cytochrome P450 734A6 OS= no no 0.863 0.269 0.322 5e-25
Q69XM6 538 Cytochrome P450 734A4 OS= no no 0.852 0.267 0.328 1e-24
Q05047 524 Secologanin synthase OS=C N/A no 0.976 0.314 0.355 2e-22
Q9ZW95 512 Cytokinin hydroxylase OS= no no 0.928 0.306 0.345 8e-20
Q9FF18 518 Cytokinin hydroxylase OS= no no 0.923 0.301 0.353 1e-19
Q9SHG5 519 Cytochrome P450 72C1 OS=A no no 0.917 0.298 0.299 6e-15
Q6NT55 531 Cytochrome P450 4F22 OS=H yes no 0.426 0.135 0.405 1e-07
>sp|O48786|C734A_ARATH Cytochrome P450 734A1 OS=Arabidopsis thaliana GN=CYP734A1 PE=2 SV=1 Back     alignment and function desciption
 Score =  130 bits (327), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 63/158 (39%), Positives = 93/158 (58%), Gaps = 1/158 (0%)

Query: 10  IYFCLLFLLVLIRFINKLWWNPIWTQSQMRSQGIKGPSYKFIHGNTKEIINMTNEIMSSP 69
           +   ++  LV+++ ++ LWW P   +     QGI+GP Y F  GN KE++ M  +  S P
Sbjct: 14  LVLSVILSLVIVKGMSLLWWRPRKIEEHFSKQGIRGPPYHFFIGNVKELVGMMLKASSHP 73

Query: 70  MELTHQIFPRVYPHVYSWIKLYGTNFLMWNGLQPQLVVAEPDLIKEILNDKDRAYPKREP 129
           M  +H I PRV    + W K+YG  FL+W G   +L VA+PDLI+EI + K   Y K E 
Sbjct: 74  MPFSHNILPRVLSFYHHWRKIYGATFLVWFGPTFRLTVADPDLIREIFS-KSEFYEKNEA 132

Query: 130 TNFIKKFLGDGLVTTQGEKWFKQRKLANHAFHVETLKV 167
              +K+  GDGL++ +GEKW   RK+ +  FH+E LK+
Sbjct: 133 HPLVKQLEGDGLLSLKGEKWAHHRKIISPTFHMENLKL 170
Cytochrome P450 involved in brassinosteroids (BRs) inactivation and regulation of BRs homeostasis. Inactivates the BRs castasterone and brassinolide through carbon 26 hydroxylation. Acts in association with CYP72C1 to inactivate BRs and modulate photomorphogenesis.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|Q8LIF2|C7345_ORYSJ Cytochrome P450 734A5 OS=Oryza sativa subsp. japonica GN=CYP734A5 PE=2 SV=1 Back     alignment and function description
>sp|Q6Z6D6|C7342_ORYSJ Cytochrome P450 734A2 OS=Oryza sativa subsp. japonica GN=CYP734A2 PE=2 SV=1 Back     alignment and function description
>sp|B9X287|C7346_ORYSJ Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 Back     alignment and function description
>sp|Q69XM6|C7344_ORYSJ Cytochrome P450 734A4 OS=Oryza sativa subsp. japonica GN=CYP734A4 PE=2 SV=1 Back     alignment and function description
>sp|Q05047|C72A1_CATRO Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZW95|C7352_ARATH Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FF18|C7351_ARATH Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A1 PE=1 SV=1 Back     alignment and function description
>sp|Q9SHG5|C72C1_ARATH Cytochrome P450 72C1 OS=Arabidopsis thaliana GN=CYP72C1 PE=2 SV=2 Back     alignment and function description
>sp|Q6NT55|CP4FN_HUMAN Cytochrome P450 4F22 OS=Homo sapiens GN=CYP4F22 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query169
224111864 512 cytochrome P450 [Populus trichocarpa] gi 0.982 0.324 0.638 4e-58
224111860 517 predicted protein [Populus trichocarpa] 0.946 0.309 0.631 2e-57
224111870 513 cytochrome P450 [Populus trichocarpa] gi 0.982 0.323 0.598 1e-55
255541946 513 cytochrome P450, putative [Ricinus commu 0.982 0.323 0.578 2e-54
255541948 516 cytochrome P450, putative [Ricinus commu 0.923 0.302 0.608 6e-51
224144528 519 cytochrome P450 [Populus trichocarpa] gi 0.857 0.279 0.627 1e-50
224112191 517 cytochrome P450 [Populus trichocarpa] gi 0.952 0.311 0.602 5e-50
224144535 519 cytochrome P450 [Populus trichocarpa] gi 0.857 0.279 0.620 5e-50
255541952 514 cytochrome P450, putative [Ricinus commu 0.840 0.276 0.615 4e-48
224145041 567 cytochrome P450 [Populus trichocarpa] gi 0.982 0.292 0.524 4e-48
>gi|224111864|ref|XP_002316007.1| cytochrome P450 [Populus trichocarpa] gi|222865047|gb|EEF02178.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  229 bits (583), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 106/166 (63%), Positives = 129/166 (77%)

Query: 1   MEAVTIYLSIYFCLLFLLVLIRFINKLWWNPIWTQSQMRSQGIKGPSYKFIHGNTKEIIN 60
           MEA+ I++    C+ F+L LI+F  K+WW+PI  QS MRSQG+KGP Y+F+HGNTKEI N
Sbjct: 1   MEALIIFILSCLCVFFILHLIKFFIKVWWDPIRIQSAMRSQGMKGPPYRFLHGNTKEIYN 60

Query: 61  MTNEIMSSPMELTHQIFPRVYPHVYSWIKLYGTNFLMWNGLQPQLVVAEPDLIKEILNDK 120
           M NEIMSSPMEL+HQ+  R+ PHVYSWIKLYG NFL W G Q QLV+ EP LIKE+L++K
Sbjct: 61  MRNEIMSSPMELSHQMLARIQPHVYSWIKLYGMNFLNWYGPQAQLVITEPKLIKEVLSNK 120

Query: 121 DRAYPKREPTNFIKKFLGDGLVTTQGEKWFKQRKLANHAFHVETLK 166
           D AYPK    N+ +K LGDGLV +QG+KW K RKLA HAFH E+LK
Sbjct: 121 DGAYPKLVIQNYAEKLLGDGLVLSQGKKWLKMRKLAIHAFHAESLK 166

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224111860|ref|XP_002316006.1| predicted protein [Populus trichocarpa] gi|222865046|gb|EEF02177.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224111870|ref|XP_002316008.1| cytochrome P450 [Populus trichocarpa] gi|222865048|gb|EEF02179.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255541946|ref|XP_002512037.1| cytochrome P450, putative [Ricinus communis] gi|223549217|gb|EEF50706.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255541948|ref|XP_002512038.1| cytochrome P450, putative [Ricinus communis] gi|223549218|gb|EEF50707.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224144528|ref|XP_002325322.1| cytochrome P450 [Populus trichocarpa] gi|222862197|gb|EEE99703.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224112191|ref|XP_002332818.1| cytochrome P450 [Populus trichocarpa] gi|222833221|gb|EEE71698.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224144535|ref|XP_002325324.1| cytochrome P450 [Populus trichocarpa] gi|222862199|gb|EEE99705.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255541952|ref|XP_002512040.1| cytochrome P450, putative [Ricinus communis] gi|223549220|gb|EEF50709.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224145041|ref|XP_002325505.1| cytochrome P450 [Populus trichocarpa] gi|222862380|gb|EEE99886.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query169
TAIR|locus:2043823 520 BAS1 "PHYB ACTIVATION TAGGED S 0.905 0.294 0.409 2.7e-30
UNIPROTKB|Q6Z6D6 557 CYP734A2 "Cytochrome P450 734A 0.869 0.263 0.362 8.7e-25
UNIPROTKB|Q69XM6 538 CYP734A4 "Cytochrome P450 734A 0.958 0.301 0.335 9.9e-25
TAIR|locus:2089561 514 CYP72A10 ""cytochrome P450, fa 0.846 0.278 0.365 1.4e-24
UNIPROTKB|B9X287 542 CYP734A6 "Cytochrome P450 734A 0.881 0.274 0.322 9.8e-24
TAIR|locus:2041389 519 CYP709B1 ""cytochrome P450, fa 0.970 0.315 0.323 1.4e-23
TAIR|locus:2137697 518 CYP709B3 ""cytochrome P450, fa 0.893 0.291 0.331 8e-22
TAIR|locus:2041399 572 CYP709B2 ""cytochrome P450, fa 0.946 0.279 0.335 1.4e-21
TAIR|locus:2089621 512 CYP72A14 ""cytochrome P450, fa 0.917 0.302 0.345 2.1e-21
TAIR|locus:2089521 512 CYP72A15 ""cytochrome P450, fa 0.840 0.277 0.328 4.3e-20
TAIR|locus:2043823 BAS1 "PHYB ACTIVATION TAGGED SUPPRESSOR 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 337 (123.7 bits), Expect = 2.7e-30, P = 2.7e-30
 Identities = 63/154 (40%), Positives = 92/154 (59%)

Query:    14 LLFLLVLIRFINKLWWNPIWTQSQMRSQGIKGPSYKFIHGNTKEIINMTNEIMSSPMELT 73
             ++  LV+++ ++ LWW P   +     QGI+GP Y F  GN KE++ M  +  S PM  +
Sbjct:    18 VILSLVIVKGMSLLWWRPRKIEEHFSKQGIRGPPYHFFIGNVKELVGMMLKASSHPMPFS 77

Query:    74 HQIFPRVYPHVYSWIKLYGTNFLMWNGLQPQLVVAEPDLIKEILNDKDRAYPKREPTNFI 133
             H I PRV    + W K+YG  FL+W G   +L VA+PDLI+EI + K   Y K E    +
Sbjct:    78 HNILPRVLSFYHHWRKIYGATFLVWFGPTFRLTVADPDLIREIFS-KSEFYEKNEAHPLV 136

Query:   134 KKFLGDGLVTTQGEKWFKQRKLANHAFHVETLKV 167
             K+  GDGL++ +GEKW   RK+ +  FH+E LK+
Sbjct:   137 KQLEGDGLLSLKGEKWAHHRKIISPTFHMENLKL 170
GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0008395 "steroid hydroxylase activity" evidence=IMP
GO:0016131 "brassinosteroid metabolic process" evidence=IMP;IDA
GO:0009416 "response to light stimulus" evidence=IGI
GO:0009741 "response to brassinosteroid stimulus" evidence=IEP;RCA
GO:0010268 "brassinosteroid homeostasis" evidence=IEP
GO:0009733 "response to auxin stimulus" evidence=RCA
UNIPROTKB|Q6Z6D6 CYP734A2 "Cytochrome P450 734A2" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q69XM6 CYP734A4 "Cytochrome P450 734A4" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2089561 CYP72A10 ""cytochrome P450, family 72, subfamily A, polypeptide 10"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|B9X287 CYP734A6 "Cytochrome P450 734A6" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2041389 CYP709B1 ""cytochrome P450, family 709, subfamily B, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137697 CYP709B3 ""cytochrome P450, family 709, subfamily B, polypeptide 3"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2041399 CYP709B2 ""cytochrome P450, family 709, subfamily B, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089621 CYP72A14 ""cytochrome P450, family 72, subfamily A, polypeptide 14"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089521 CYP72A15 ""cytochrome P450, family 72, subfamily A, polypeptide 15"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query169
PLN02290 516 PLN02290, PLN02290, cytokinin trans-hydroxylase 9e-27
pfam00067 461 pfam00067, p450, Cytochrome P450 1e-07
PLN02738 633 PLN02738, PLN02738, carotene beta-ring hydroxylase 1e-04
PLN03195 516 PLN03195, PLN03195, fatty acid omega-hydroxylase; 0.002
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information 
 Score =  104 bits (261), Expect = 9e-27
 Identities = 53/171 (30%), Positives = 89/171 (52%), Gaps = 8/171 (4%)

Query: 1   MEAVTIYLSIYFCLLFLLVLIRFINKLWWNPIWTQSQMRSQGIKGPSYKFIHGNTKEIIN 60
           +  V   L + F  L L V    I+  +  P   +  M  QG++GP  + + GN  ++  
Sbjct: 2   LGVVLKVLLVIFLTLLLRVAYDTISCYFLTPRRIKKIMERQGVRGPKPRPLTGNILDVSA 61

Query: 61  MTNEIMSSPME-LTHQIFPRVYPHVYSWIKLYGTNFLMWNGLQPQLVVAEPDLIKEILND 119
           + ++  S  M+ + H I  R+ PH  +W K YG  F+ WNG +P+L + E +LIKE+L  
Sbjct: 62  LVSQSTSKDMDSIHHDIVGRLLPHYVAWSKQYGKRFIYWNGTEPRLCLTETELIKELLTK 121

Query: 120 KD----RAYPKREPTNFIKKFLGDGLVTTQGEKWFKQRKLANHAFHVETLK 166
            +    +++ +++ T   K F+G GL+   G  W+ QR +A  AF  + LK
Sbjct: 122 YNTVTGKSWLQQQGT---KHFIGRGLLMANGADWYHQRHIAAPAFMGDRLK 169

Length = 516
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 169
PLN02290 516 cytokinin trans-hydroxylase 99.88
KOG0157 497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 99.8
PTZ00404 482 cytochrome P450; Provisional 99.8
KOG0156 489 consensus Cytochrome P450 CYP2 subfamily [Secondar 99.79
PLN02500 490 cytochrome P450 90B1 99.78
KOG0158 499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 99.77
PLN02196 463 abscisic acid 8'-hydroxylase 99.77
PLN00168 519 Cytochrome P450; Provisional 99.76
PLN02687 517 flavonoid 3'-monooxygenase 99.76
PLN02971 543 tryptophan N-hydroxylase 99.75
PLN02394 503 trans-cinnamate 4-monooxygenase 99.75
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.74
PLN02183 516 ferulate 5-hydroxylase 99.74
PLN02774 463 brassinosteroid-6-oxidase 99.73
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.73
PLN02302 490 ent-kaurenoic acid oxidase 99.71
PLN03195 516 fatty acid omega-hydroxylase; Provisional 99.7
PLN03112 514 cytochrome P450 family protein; Provisional 99.7
PLN02987 472 Cytochrome P450, family 90, subfamily A 99.68
PLN03234 499 cytochrome P450 83B1; Provisional 99.67
PLN03141 452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.65
PLN02655 466 ent-kaurene oxidase 99.63
PLN03018 534 homomethionine N-hydroxylase 99.62
PLN02738 633 carotene beta-ring hydroxylase 99.61
PLN02966 502 cytochrome P450 83A1 99.61
PLN02936 489 epsilon-ring hydroxylase 99.6
PF00067 463 p450: Cytochrome P450 p450 superfamily signature b 99.6
PLN02648 480 allene oxide synthase 99.49
PLN02426 502 cytochrome P450, family 94, subfamily C protein 99.38
KOG0159 519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 99.34
KOG0684 486 consensus Cytochrome P450 [Secondary metabolites b 99.09
COG2124 411 CypX Cytochrome P450 [Secondary metabolites biosyn 98.08
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information 
Probab=99.88  E-value=3.8e-21  Score=155.80  Aligned_cols=149  Identities=32%  Similarity=0.593  Sum_probs=111.2

Q ss_pred             HHHHHhhhhhhhHHhHHHhhhcCCCCCCcccccCCHHHHHHHhhhhcCCCc-ccccccccCchHHHHHHHHHhCCeEeec
Q 035519           20 LIRFINKLWWNPIWTQSQMRSQGIKGPSYKFIHGNTKEIINMTNEIMSSPM-ELTHQIFPRVYPHVYSWIKLYGTNFLMW   98 (169)
Q Consensus        20 l~~~~~~~~~~~~~~~~~~~~~~~Pgp~~~pi~G~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~yG~~~~~~   98 (169)
                      +...+..|++.+++.+.+++++++|||+++|++||+.++...........+ ...+++..+....+.++.++||+++.+|
T Consensus        21 ~~~~~~~~~~~~~~~~~~~~~~~~PGP~~~P~iGnl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~yG~i~~~~  100 (516)
T PLN02290         21 AYDTISCYFLTPRRIKKIMERQGVRGPKPRPLTGNILDVSALVSQSTSKDMDSIHHDIVGRLLPHYVAWSKQYGKRFIYW  100 (516)
T ss_pred             HHHHHHHHhccHHHHHHHHHHcCCCCCCCCcCCCCHHHHHHHHHHhhcCCCCCCCcccccccchHHHHHHHHhCCeEEEc
Confidence            334455677888999999999999999999999999888642111000000 0112223344556789999999999999


Q ss_pred             cCCccEEEEcCHHHHHHHHhhCCCCCCCCCch-hhhHhhcCCCccccCCchHHHHhhhhcCCCCHHHHhhc
Q 035519           99 NGLQPQLVVAEPDLIKEILNDKDRAYPKREPT-NFIKKFLGDGLVTTQGEKWFKQRKLANHAFHVETLKVN  168 (169)
Q Consensus        99 ~~~~~~v~i~~p~~~~~il~~~~~~~~k~~~~-~~~~~~~g~~l~~~~g~~w~~~R~~~~~~fs~~~l~~~  168 (169)
                      +|+.++|+++|||.+++++.++...+.++... ......+|.|+++++|+.|+++|+++++.|+.++++.+
T Consensus       101 ~g~~~~vvv~dp~~v~~il~~~~~~~~r~~~~~~~~~~~~g~~l~~~~g~~Wk~~Rk~~~~~f~~~~l~~~  171 (516)
T PLN02290        101 NGTEPRLCLTETELIKELLTKYNTVTGKSWLQQQGTKHFIGRGLLMANGADWYHQRHIAAPAFMGDRLKGY  171 (516)
T ss_pred             cCCccEEEECCHHHHHHHHhcCCCCCCCcchhhhHHHHHhcCCccccCchHHHHHHhhcccccCHHHHHHH
Confidence            99999999999999999998764333555411 12445678899999999999999999999999988765

>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query169
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 4e-25
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 4e-24
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 8e-24
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 2e-18
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 6e-16
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 2e-15
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 4e-15
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 9e-15
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 1e-12
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 3e-11
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 2e-10
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 1e-09
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 2e-08
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 2e-08
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 5e-06
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 3e-05
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 6e-05
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 8e-05
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 8e-05
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 3e-04
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 5e-04
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
 Score = 98.9 bits (247), Expect = 4e-25
 Identities = 20/128 (15%), Positives = 38/128 (29%), Gaps = 19/128 (14%)

Query: 41  QGIKGPSYKFIHGNTKEIINMTNEIMSSPMELTHQIFPRVYPHVYSWIKLYGTNFLMWNG 100
           + +  P       N   +                    +    +       G  F     
Sbjct: 3   KEMPQPKTFGELKNLPLLNT-----------------DKPVQALMKIADELGEIFKFEAP 45

Query: 101 LQPQLVVAEPDLIKEILNDKDRAYPKREPTNFIKKFLGDGLVT--TQGEKWFKQRKLANH 158
            +    ++   LIKE  ++        +   F++ F GDGL T  T  + W K   +   
Sbjct: 46  GRVTRYLSSQRLIKEACDESRFDKNLSQALKFVRDFAGDGLFTSWTHEKNWKKAHNILLP 105

Query: 159 AFHVETLK 166
           +F  + +K
Sbjct: 106 SFSQQAMK 113
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query169
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.81
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.74
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.74
3ld6_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.72
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.68
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.68
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 99.67
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.67
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.65
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.64
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.63
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.63
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 99.61
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.61
2cd8_A 436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.59
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.59
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.58
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.58
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.57
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.57
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.56
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.55
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.55
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.51
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.46
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.46
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 99.41
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.4
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.4
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.3
1jfb_A 404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.29
1ued_A 406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.25
3ejb_B 404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.24
1z8o_A 404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.23
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.22
2zbx_A 412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.22
2jjn_A 411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.22
3oo3_A 384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.2
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.18
1s1f_A 406 Putative cytochrome P450; cytochrome P450 oxidored 99.15
2y5n_A 417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.15
3aba_A 403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.15
4fb2_A 398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.13
3abb_A 408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.11
2z36_A 413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.09
1odo_A 408 Putative cytochrome P450 154A1; P450 monooxygenase 99.08
2zwu_A 415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.08
1gwi_A 411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.07
2z3t_A 425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.07
3tyw_A 417 Putative cytochrome P450; P450 monooxygenase, oxid 99.05
2xbk_A 404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.04
2uuq_A 414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.02
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.01
2dkk_A 411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.01
3ivy_A 433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.0
2wm5_A 435 CYP124, putative cytochrome P450 124; metal-bindin 99.0
1q5d_A 419 P450 epoxidase; cytochrome P450, epothilone, oxydo 98.98
2xkr_A 398 CYP142, putative cytochrome P450 142; oxidoreducta 98.98
3r9b_A 418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 98.97
1cpt_A 428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 98.95
3lxh_A 421 Cytochrome P450; heme, iron, metal-binding, monoox 98.95
3tkt_A 450 Cytochrome P450; aromatic hydrocarbon binding of P 98.94
3oft_A 396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 98.93
3buj_A 397 CALO2; heme, iron, metal-binding, monooxygenase, o 98.93
3mgx_A 415 Putative P450 monooxygenase; cytochrome P450 oxida 98.91
1lfk_A 398 OXYB, P450 monooxygenase; oxidative phenol couplin 98.9
3nc3_A 441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 98.88
1io7_A 368 Cytochrome P450 CYP119; thermophilic, cytochromo P 98.88
3b4x_A 367 367AA long hypothetical cytochrome P450; HEM prote 98.84
3rwl_A 426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 98.71
2rfb_A 343 Cytochrome P450; heme, iron, metal-binding, monoox 98.68
1n40_A 396 P450 MT2, cytochrome P450 121; heme binding, oxyge 98.66
3p3o_A 416 Cytochrome P450; monooxygenase, oxidoreductase; HE 98.53
4dnj_A 412 Putative cytochrome P450; oxidoreductase; HET: HEM 98.41
2wiy_A 394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 98.31
4dxy_A 417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 97.71
2yjn_B 381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 96.62
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
Probab=99.81  E-value=2.5e-20  Score=147.90  Aligned_cols=114  Identities=24%  Similarity=0.374  Sum_probs=93.8

Q ss_pred             HHhhhcCCCCCCcccccCCHHHHHHHhhhhcCCCcccccccccCchHHHHHHHHHhCCeEeeccCCccEEEEcCHHHHHH
Q 035519           36 SQMRSQGIKGPSYKFIHGNTKEIINMTNEIMSSPMELTHQIFPRVYPHVYSWIKLYGTNFLMWNGLQPQLVVAEPDLIKE  115 (169)
Q Consensus        36 ~~~~~~~~Pgp~~~pi~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~yG~~~~~~~~~~~~v~i~~p~~~~~  115 (169)
                      .+++++++|||+++|++|++..+..                  ..+.++.+++++||+++++++++.++|+++|||++++
T Consensus         9 ~~~k~~~~PGP~~~PliGn~~~~~~------------------~~~~~~~~~~~~yG~i~~~~~g~~~~vvv~dp~~i~~   70 (485)
T 3nxu_A            9 GLFKKLGIPGPTPLPFLGNILSYHK------------------GFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKT   70 (485)
T ss_dssp             THHHHHTCCCCCCBTTTBTGGGGGG------------------CHHHHHHHHHHHHCSEEEEEETTEEEEEECCHHHHHH
T ss_pred             hHHhhCCCCCCCCcCeecCcHHhhc------------------ChHHHHHHHHHHcCCeEEEEeCCCCEEEECCHHHHHH
Confidence            4566779999999999999987632                  2377889999999999999999999999999999999


Q ss_pred             HHhhC-CCCCCCCCchhhhHhhcCCCccccCCchHHHHhhhhcCCCCHHHHhhc
Q 035519          116 ILNDK-DRAYPKREPTNFIKKFLGDGLVTTQGEKWFKQRKLANHAFHVETLKVN  168 (169)
Q Consensus       116 il~~~-~~~~~k~~~~~~~~~~~g~~l~~~~g~~w~~~R~~~~~~fs~~~l~~~  168 (169)
                      |+.++ ...|..+. ......+.+.|+++.+|+.|+++|++++++|+.++++.+
T Consensus        71 il~~~~~~~f~~r~-~~~~~~~~~~~l~~~~g~~w~~~R~~~~~~fs~~~l~~~  123 (485)
T 3nxu_A           71 VLVKECYSVFTNRR-PFGPVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEM  123 (485)
T ss_dssp             HHTTTTTTTCCCCC-CCSCCGGGGGSTTTCCHHHHHHHHHHHGGGGCHHHHHHH
T ss_pred             HHhccchhhccCCc-ccccccccccCccccCCcHHHHHHhhcChhcCHHHHHHH
Confidence            99876 45564433 112223567889999999999999999999999998765
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 169
d1tqna_ 472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 4e-13
d1po5a_ 465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 5e-13
d2ij2a1 453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 1e-12
d1r9oa_ 467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 5e-12
d1n97a_ 385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 9e-12
d1izoa_ 411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 1e-09
d3czha1 463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 2e-09
d2ciba1 445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 8e-09
d1odoa_ 401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 1e-05
d1ueda_ 403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 4e-05
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 63.9 bits (154), Expect = 4e-13
 Identities = 25/127 (19%), Positives = 42/127 (33%), Gaps = 18/127 (14%)

Query: 39  RSQGIKGPSYKFIHGNTKEIINMTNEIMSSPMELTHQIFPRVYPHVYSWIKLYGTNFLMW 98
           +  GI GP+     GN                                  K YG  +  +
Sbjct: 7   KKLGIPGPTPLPFLGNI------------------LSYHKGFCMFDMECHKKYGKVWGFY 48

Query: 99  NGLQPQLVVAEPDLIKEILNDKDRAYPKREPTNFIKKFLGDGLVTTQGEKWFKQRKLANH 158
           +G QP L + +PD+IK +L  +  +            F+   +   + E+W + R L + 
Sbjct: 49  DGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISIAEDEEWKRLRSLLSP 108

Query: 159 AFHVETL 165
            F    L
Sbjct: 109 TFTSGKL 115
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query169
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.81
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.78
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.69
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.66
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.64
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.63
d1n97a_ 385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.56
d1izoa_ 411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.45
d1odoa_ 401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.2
d1z8oa1 402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.15
d1gwia_ 403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.08
d1ueda_ 403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 98.99
d1jfba_ 399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 98.78
d1q5da_ 401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 98.71
d1s1fa_ 399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 98.56
d1cpta_ 428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 98.49
d1io7a_ 366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 98.42
d1lfka_ 394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 98.15
d1ue8a_ 367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 98.06
d1re9a_ 404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 97.97
d1n40a_ 395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 96.98
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.81  E-value=9.4e-21  Score=147.32  Aligned_cols=114  Identities=23%  Similarity=0.323  Sum_probs=93.3

Q ss_pred             HhhhcCCCCCCcccccCCHHHHHHHhhhhcCCCcccccccccCchHHHHHHHHHhCCeEeeccCCccEEEEcCHHHHHHH
Q 035519           37 QMRSQGIKGPSYKFIHGNTKEIINMTNEIMSSPMELTHQIFPRVYPHVYSWIKLYGTNFLMWNGLQPQLVVAEPDLIKEI  116 (169)
Q Consensus        37 ~~~~~~~Pgp~~~pi~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~yG~~~~~~~~~~~~v~i~~p~~~~~i  116 (169)
                      .+++.++|||+++|++|+++++..                  ..+.++.+++++||++|++++++.++|+++||+++++|
T Consensus         5 ~~~~~~iPGP~~~P~iG~~~~~~~------------------~~~~~~~~~~~kyG~i~~~~l~~~~~vvv~~p~~~~~i   66 (472)
T d1tqna_           5 LFKKLGIPGPTPLPFLGNILSYHK------------------GFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTV   66 (472)
T ss_dssp             HHHHTTCCCCCCBTTTBTGGGGGG------------------CHHHHHHHHHHHHCSEEEEEETTEEEEEECCHHHHHHH
T ss_pred             chhhcCCCCCCCcCceeEHHHhhC------------------CHHHHHHHHHHHhCCEEEEEECCeeEEEECCHHHHHHH
Confidence            355679999999999999987743                  24788999999999999999999999999999999999


Q ss_pred             HhhCCCCCCCCCchhhhHhhcCCCccccCCchHHHHhhhhcCCCCHHHHhhc
Q 035519          117 LNDKDRAYPKREPTNFIKKFLGDGLVTTQGEKWFKQRKLANHAFHVETLKVN  168 (169)
Q Consensus       117 l~~~~~~~~k~~~~~~~~~~~g~~l~~~~g~~w~~~R~~~~~~fs~~~l~~~  168 (169)
                      +.++...+..+........+.++|+++++|+.|+++|+++++.|+.++++.|
T Consensus        67 l~~~~~~~~~~~~~~~~~~~~~~~i~~~~g~~~~~~R~~~~~~~~~~~l~~~  118 (472)
T d1tqna_          67 LVKECYSVFTNRRPFGPVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEM  118 (472)
T ss_dssp             HTTTTTTTCCBCCCCSCCGGGGGSTTTCCHHHHHHHHHHTTGGGSHHHHHTT
T ss_pred             HhcCCcccccCCcccccccccCCceeccCcHHHHHhhhhcCccccchhhhcc
Confidence            9875543422220222334567899999999999999999999999998765
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure